Electrical power inverter having a phase modulated, twin-inverter, high frequency link and an energy storage module

Science.gov (United States)

Pitel, Ira J.

1987-02-03

The present invention provides an electrical power inverter method and apparatus, which includes a high frequency link, for converting DC power into AC power. Generally stated, the apparatus includes a first high frequency module which produces an AC voltage at a first output frequency, and a second high frequency inverter module which produces an AC voltage at a second output frequency that is substantially the same as the first output frequency. The second AC voltage is out of phase with the first AC voltage by a selected angular phase displacement. A mixer mixes the first and second output voltages to produce a high frequency carrier which has a selected base frequency impressed on the sidebands thereof. A rectifier rectifies the carrier, and a filter filters the rectified carrier. An output inverter inverts the filtered carrier to produce an AC line voltage at the selected base frequency. A phase modulator adjusts the relative angular phase displacement between the outputs of the first and second high frequency modules to control the base frequency and magnitude of the AC line voltage.

Dependence of quality of Thallium-201 on irradiation data

International Nuclear Information System (INIS)

Sattari, I.; Aslani, G.; Dehghan, M. K.; Shirazi, B.; Shafie, M.; Shadanpour, N.; Winkel, P. V.

2003-01-01

Background: Thallium-201 is produced through 203 Tl (p,3 n) 201 pb 201 Tl reaction by cyclotron. This radioisotope has known as one of the cyclotron radioisotopes which is used for myocardial perfusion in the coronary artery disease, Ti-201 after chemical purification and quality control in the form of 201 Tl-chloride is ready to send the hospitals. Materials and methods: In this work the effect of the proton energy on quality of a Ti-201, was studied. Radionuclidic purity was determined by high purity Ge (H P Ge) detector Gamma spectrometer, in production time and after one half-life (73 h). The targets were coated with Enriched Thallium-203 (97%). Results: The variation of thickness of targets was 18.3±1.3μm. The different energies of bombardment on quality of Tl-201 and Tl-200, Tl-202, and Pb-203 (as impurity) were studied. The results have been that optimum energy for proton was 28.5 MeV. Conclusion: The variation energy of bombardment can change the purity of Tl-201 but all results were in standard range according to the United States Pharmacopoeia (USP) and European Pharmacopoeia

Low Power Consumption Complementary Inverters with n-MoS2 and p-WSe2 Dichalcogenide Nanosheets on Glass for Logic and Light-Emitting Diode Circuits.

Science.gov (United States)

Jeon, Pyo Jin; Kim, Jin Sung; Lim, June Yeong; Cho, Youngsuk; Pezeshki, Atiye; Lee, Hee Sung; Yu, Sanghyuck; Min, Sung-Wook; Im, Seongil

2015-10-14

Two-dimensional (2D) semiconductor materials with discrete bandgap become important because of their interesting physical properties and potentials toward future nanoscale electronics. Many 2D-based field effect transistors (FETs) have thus been reported. Several attempts to fabricate 2D complementary (CMOS) logic inverters have been made too. However, those CMOS devices seldom showed the most important advantage of typical CMOS: low power consumption. Here, we adopted p-WSe2 and n-MoS2 nanosheets separately for the channels of bottom-gate-patterned FETs, to fabricate 2D dichalcogenide-based hetero-CMOS inverters on the same glass substrate. Our hetero-CMOS inverters with electrically isolated FETs demonstrate novel and superior device performances of a maximum voltage gain as ∼27, sub-nanowatt power consumption, almost ideal noise margin approaching 0.5VDD (supply voltage, VDD=5 V) with a transition voltage of 2.3 V, and ∼800 μs for switching delay. Moreover, our glass-substrate CMOS device nicely performed digital logic (NOT, OR, and AND) and push-pull circuits for organic light-emitting diode switching, directly displaying the prospective of practical applications.

(-201) β-Gallium oxide substrate for high quality GaN materials

KAUST Repository

Roqan, Iman S.

2015-03-13

(-201) oriented β-Ga2O3 has the potential to be used as a transparent and conductive substrate for GaN-growth. The key advantages of Ga2O3 are its small lattice mismatches (4.7%), appropriate structural, thermal and electrical properties and a competitive price compared to other substrates. Optical characterization show that GaN layers grown on (-201) oriented β-Ga2O3 are dominated by intense bandedge emission with a high luminescence efficiency. Atomic force microscopy studies show a modest threading dislocation density of ~108 cm-2, while complementary Raman spectroscopy indicates that the GaN epilayer is of high quality with slight compressive strain. Room temperature time-findings suggest that the limitation of the photoluminescence lifetime (~500 ps) is due to nonradiative recombination arising from threading dislocation. Therefore, by optimizing the growth conditions, high quality material with significant optical efficiency can be obtained.

Arduino Mega 2560 Microcontroller Built 3-Phase Seven Level Inverter

Directory of Open Access Journals (Sweden)

PAVANKUMAR Shriram Mehtre

2017-10-01

Full Text Available n this paper, the implementation of 3-phase seven level cascaded H-bridge inverter is discussed with Arduino microcontroller and harmonic analysis is performed using Fourier series. The multilevel inverters (MLI give several benefits as reduced switching voltage stresses and the capability to operate in higher level voltage applications. A new and simple architecture Arduino Mega 2560 microcontroller is employed to produce the control signals for the seven level cascaded H-bridge MLI switches. The computer simulation is carried out in PSIM environment and prototype experimental model is developed with TLP 250 driver ICs and power MOSFET switches to validate the simulation results. The THDs present in different voltage level inverters are mathematically analysed using Fourier series.

Status and Needs of Power Electronics for Photovoltaic Inverters

Science.gov (United States)

Qin, Y. C.; Mohan, N.; West, R.; Bonn, R.

2002-06-01

Photovoltaics is the utility connected distributed energy resource (DER) that is in widespread use today. It has one element, the inverter, which is common with all DER sources except rotating generators. The inverter is required to transfer dc energy to ac energy. With all the DER technologies, (solar, wind, fuel cells, and microturbines) the inverter is still an immature product that will result in reliability problems in fielded systems. Today, the PV inverter is a costly and complex component of PV systems that produce ac power. Inverter MTFF (mean time to first failure) is currently unacceptable. Low inverter reliability contributes to unreliable fielded systems and a loss of confidence in renewable technology. The low volume of PV inverters produced restricts the manufacturing to small suppliers without sophisticated research and reliability programs or manufacturing methods. Thus, the present approach to PV inverter supply has low probability of meeting DOE reliability goals.

Real-time physics-based 3D biped character animation using an inverted pendulum model.

Science.gov (United States)

Tsai, Yao-Yang; Lin, Wen-Chieh; Cheng, Kuangyou B; Lee, Jehee; Lee, Tong-Yee

2010-01-01

We present a physics-based approach to generate 3D biped character animation that can react to dynamical environments in real time. Our approach utilizes an inverted pendulum model to online adjust the desired motion trajectory from the input motion capture data. This online adjustment produces a physically plausible motion trajectory adapted to dynamic environments, which is then used as the desired motion for the motion controllers to track in dynamics simulation. Rather than using Proportional-Derivative controllers whose parameters usually cannot be easily set, our motion tracking adopts a velocity-driven method which computes joint torques based on the desired joint angular velocities. Physically correct full-body motion of the 3D character is computed in dynamics simulation using the computed torques and dynamical model of the character. Our experiments demonstrate that tracking motion capture data with real-time response animation can be achieved easily. In addition, physically plausible motion style editing, automatic motion transition, and motion adaptation to different limb sizes can also be generated without difficulty.

A single-phase multi-level D-STATCOM inverter using modular multi-level converter (MMC) topology for renewable energy sources

Science.gov (United States)

Sotoodeh, Pedram

This dissertation presents the design of a novel multi-level inverter with FACTS capability for small to mid-size (10-20kW) permanent-magnet wind installations using modular multi-level converter (MMC) topology. The aim of the work is to design a new type of inverter with D-STATCOM option to provide utilities with more control on active and reactive power transfer of distribution lines. The inverter is placed between the renewable energy source, specifically a wind turbine, and the distribution grid in order to fix the power factor of the grid at a target value, regardless of wind speed, by regulating active and reactive power required by the grid. The inverter is capable of controlling active and reactive power by controlling the phase angle and modulation index, respectively. The unique contribution of the proposed work is to combine the two concepts of inverter and D-STATCOM using a novel voltage source converter (VSC) multi-level topology in a single unit without additional cost. Simulations of the proposed inverter, with 5 and 11 levels, have been conducted in MATLAB/Simulink for two systems including 20 kW/kVAR and 250 W/VAR. To validate the simulation results, a scaled version (250 kW/kVAR) of the proposed inverter with 5 and 11 levels has been built and tested in the laboratory. Experimental results show that the reduced-scale 5- and 11-level inverter is able to fix PF of the grid as well as being compatible with IEEE standards. Furthermore, total cost of the prototype models, which is one of the major objectives of this research, is comparable with market prices.

Co-existence of mucin-producing urothelial-type adenocarcinoma of the prostate and inverted papilloma of the bladder

Directory of Open Access Journals (Sweden)

Xiao-Nan Mu

2017-06-01

Full Text Available Adenocarcinoma of prostate with mucinous differentiation arising in the male urethra is extremely rare, with only 21 cases reported in the previous literature. A diagnosis of mucin-producing urothelial carcinoma of the prostate is based on the pathology, immunohistochemistry, and clinical examination by excluding the secondary adenocarcinoma of the prostate. We present a case of unexpected mucinous urothelial carcinoma of prostate with co-existing inverted papilloma of bladder in a 57-year-old man. The patient underwent transurethral resection of the prostate (TURP and transurethral resection of a bladder tumour (TUR-Bt, and the pathologic result showed mucinous prostate carcinoma and bladder inverted papilloma. Immunohistological stain was negative for prostate-specific antigen (PSA, prostate-specific acid phosphatase (PSAP, and P63, but positive for cytokeratin 7 (CK 7, CK 20, clone 34E12 and P504S. A complete endoscopic examination was performed to exclude the secondary adenocarcinoma of prostate. This case illustrates the clinical and pathological features of a rare and unexpected mucin-producing urothelial carcinoma of prostate in a bladder neoplasm patient.

Suppression of Lateral Diffusion and Surface Leakage Currents in nBn Photodetectors Using an Inverted Design

Science.gov (United States)

Du, X.; Savich, G. R.; Marozas, B. T.; Wicks, G. W.

2018-02-01

Surface leakage and lateral diffusion currents in InAs-based nBn photodetectors have been investigated. Devices fabricated using a shallow etch processing scheme that etches through the top contact and stops at the barrier exhibited large lateral diffusion current but undetectably low surface leakage. Such large lateral diffusion current significantly increased the dark current, especially in small devices, and causes pixel-to-pixel crosstalk in detector arrays. To eliminate the lateral diffusion current, two different approaches were examined. The conventional solution utilized a deep etch process, which etches through the top contact, barrier, and absorber. This deep etch processing scheme eliminated lateral diffusion, but introduced high surface current along the device mesa sidewalls, increasing the dark current. High device failure rate was also observed in deep-etched nBn structures. An alternative approach to limit lateral diffusion used an inverted nBn structure that has its absorber grown above the barrier. Like the shallow etch process on conventional nBn structures, the inverted nBn devices were fabricated with a processing scheme that only etches the top layer (the absorber, in this case) but avoids etching through the barrier. The results show that inverted nBn devices have the advantage of eliminating the lateral diffusion current without introducing elevated surface current.

CT and MR findings of the inverted papilloma

International Nuclear Information System (INIS)

Lim, Seong Youb; Kim, Hak Jin; Lee, Jun Woo; Park, Jae Yeong; Lee, Sung Gap; Kim, Byung Soo; Roh, Hwan Jung; Baik, Seung Kook

1997-01-01

The purpose of this study is to describe the CT and MR findings of inverted papilloma and to determine the specific differential finding between inverted papilloma with and without coexisting malignancy. Twenty-two histopathologically proven inverted papillomas were included in this study ; in six patients there was coexisting malignancy. Twenty-two CT images and eight MR images were retrospectively reviewed. On CT images, the inverted papillomas were seen as unilateral sinonasal masses with bone remodeling (n=15) rather than bone destruction (n=1) and showed iso- or slightly high attenuation. Three of the six malignant cases showed aggressive bone destruction and widespread extension into the orbit, intracranial and buccal spaces, and pterygopalatine fossa. On MR images, the inverted papillomas (n=3) were iso- (n=2) or slightly high (n=1) in signal intensity in relation to muscle on T1-weighted images, and high (n=3) on T2-weighted images. Gadolinium enhanced images showed heterogenous moderate enhancement. In the cases of coexisting malignancy (n=5), the masses were iso- (n=5) on T1-weighted images, high (n=5) on T2-weighted images and also showed heterogenous moderate enhancement. Inverted papilloma should be considered in the differential diagnosis of a bulky unilateral nasal mass extending into the adjacent paranasal sinuses, especially in an elderly patient with chronic nasal obstruction. Although there were no specific differential findings in signal intensity and enhancement pattern on CT and MR images between benign and malignant inverted papilloma, aggressive bone destruction and widespread extension beyond the sinonasal cavity are findings which are highly suggestive of coexisting malignancy

Myocardial uptake of thallium-201 in rat with cardiac hypertrophy

International Nuclear Information System (INIS)

Torii, Yukio; Adachi, Haruhiko; Kizu, Akira; Nakagawa, Masao; Ijichi, Hamao

1985-01-01

The thallium-201 (TL) has been used in order to diagnose myocardial infarction and ischemia. Although it is well known that TL distributes in the myocardium in proportion to the distribution of coronary blood flow, the biological property of TL in the loaded myocardium remains unclear. We studied the myocardial uptake of TL in rat with cardiac hypertrophy. Experiments were performed in 30 anesthetized rats devided into 3 groups; control group (C,N=14), hypertrophy group (H,N=6) and diltiazem group (D, 0.3 mg/kg/min. IV. N=10). Cardiac hypertrophy was produced with the banding of the ascending aorta. Myocardial blood flow (MBF) was measured by microspheres labeled with Strontium-85. Cardiac weight was increased in H, and both MBF and TL uptake were proportionally increased. MBF was negatively correlated with the extraction fraction in C (r=-0.71), in H (r=-0.66) and in D (r=-0.85), and this relationship in H was significantly different from it in C (p<0.05), but not in D. From these results, we concluded that TL uptake in H is not always dependant on MBF and affected by the altered metabolism of hypertrophied myocardium. (author)

18 CFR 706.201 - Proscribed actions.

Science.gov (United States)

2010-04-01

... economy; (d) Losing complete independence or impartiality; (e) Making a Government decision outside....201 Section 706.201 Conservation of Power and Water Resources WATER RESOURCES COUNCIL EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.201 Proscribed actions. An employee...

Chemical recovery of thallium-203 following production and separation of lead-201

International Nuclear Information System (INIS)

Kayfus, G.P.; Boothe, T.E.; Campbell, J.A.; Finn, R.D.; Gilson, A.J.

1982-01-01

Because of the cost and limited availabilty of isotopically enriched thallium (>92% 203 Tl), its use in the 203 Tl(p, 3n) 201 Pb nuclear reaction necessitates chemical recovery. An adaptive method has been developed and evaluated. After the separation of 201 Pb, the 203 Tl(I) is oxidized to 203 Tl(III) by Cl 2 , Br 2 or [Fe(CN) 6 ] -2 , precipitated as Tl(OH) 3 with NaOH and subsequently converted to Tl 2 O 3 by heating. Due to potential loss during recovery, the solubilities of Tl(OH) 3 and Tl 2 O 3 in aqueous solution as a function of pH have been studied using the internal tracer 202 Tl(T=12.2 d), produced during cyclotron irradiation. Effective solubility product constants have been determined to be 5.4x10 -48 and 2.5x10 -47 for Tl(OH) 3 and Tl 2 O 3 , respectively. (author)

FET commutated current-FED inverter

Science.gov (United States)

Rippel, Wally E. (Inventor); Edwards, Dean B. (Inventor)

1983-01-01

A shunt switch comprised of a field-effect transistor (Q.sub.1) is employed to commutate a current-fed inverter (10) using thyristors (SCR1, SCR2) or bijunction transistors (Q.sub.2, Q.sub.3) in a full bridge (1, 2, 3, 4) or half bridge (5, 6) and transformer (T.sub.1) configuration. In the case of thyristors, a tapped inverter (12) is employed to couple the inverter to a dc source to back bias the thyristors during commutation. Alternatively, a commutation power supply (20) may be employed for that purpse. Diodes (D.sub.1, D.sub.2) in series with some voltage dropping element (resistor R.sub.12 or resistors R.sub.1, R.sub.2 or Zener diodes D.sub.4, D.sub.5) are connected in parallel with the thyristors in the half bridge and transformer configuration to assure sharing the back bias voltage. A clamp circuit comprised of a winding (18) negatively coupled to the inductor and a diode (D.sub.3) return stored energy from the inductor to the power supply for efficient operation with buck or boost mode.

Trans-Z-source Neutral Point Clamped inverter

DEFF Research Database (Denmark)

Mo, W.; Loh, P. C.; Li, D.

2012-01-01

Transformer based Z-source (trans-Z-source) inverters are recently proposed by extending the traditional Z-source inverter with higher buck-boost capability as well as reducing the passive components at the same time. Multi-Level Z-source inverters are single-stage topological solutions used...... for buck-boost energy conversion with all the favourable advantages of multi-level switching retained. This paper presents three-level trans-Z-source Neutral Point Clamped (NPC) inverter topology, which achieves both the advantages of trans-Z-source and three-level NPC inverter configuration. With proper...... modulation scheme, the three-level trans-Z-source inverter can function with minimum of six device commutations per half carrier cycle (same as the traditional buck NPC inverter), while maintaining to produce the designed volt-sec average and inductive voltage boosting at ac output terminals. The designed...

The influence of fusion-relevant D{sub 2}-0.1He plasma on Be-W mixed-materials

Energy Technology Data Exchange (ETDEWEB)

Jepu, I., E-mail: ionut.jepu@inflpr.ro [National Institute for Lasers, Plasma and Radiation Physics, NILPRP, Magurele (Romania); Baldwin, M.J.; Nishijima, D.; Doerner, R.P. [Center for Energy Research, University of California at San Diego, La Jolla, CA (United States); Porosnicu, C.; Lungu, C.P. [National Institute for Lasers, Plasma and Radiation Physics, NILPRP, Magurele (Romania); Dinca, P. [National Institute for Lasers, Plasma and Radiation Physics, NILPRP, Magurele (Romania); University of Bucharest, Faculty of Physics, Magurele, Bucharest (Romania); Marin, A. [Institute of Physical Chemistry, “Ilie Murgulescu”, Bucharest (Romania); Institute for Nuclear Research, Mioveni, Arges (Romania)

2017-02-15

Compositionally homogeneous mixed-material layers of Be and W, ∼2 μm thick, and of various W contents (spanning 0–100 at.% W), are produced by thermionic vacuum arc deposition. The layers are exposed to low energy (∼50 eV), high ion flux (6–8 × 10{sup 22} m{sup −2} s{sup −1}) D{sub 2}-0.1He (10% He) mixed species plasma at 473 K and 1073 K to simulate ITER-like first wall and divertor plasma-material interaction. Surface morphological and compositional analysis is conducted prior and subsequent to plasma exposure. The action of the plasma produces almost complete depletion of Be from the near surface, and this is found regardless of the exposure temperature or initial composition. In the exposure case of 473 K, thermal desorption spectrometry reveals decreased D retention in W rich compositions compared to similar exposure in D{sub 2} plasma without He, but no discernable difference is noted in Be rich compositions. At 1073 K, surface enrichment in W, by depletion of the Be, results in He induced W “fuzz” structures for all Be-W compositions explored.

(-201) β-Gallium oxide substrate for high quality GaN materials

KAUST Repository

Roqan, Iman S.; Mumthaz Muhammed, Mufasila

2015-01-01

(-201) oriented β-Ga2O3 has the potential to be used as a transparent and conductive substrate for GaN-growth. The key advantages of Ga2O3 are its small lattice mismatches (4.7%), appropriate structural, thermal and electrical properties and a

Inverting Coseismic TEC Disturbances for Neutral Atmosphere Pressure Wave

Science.gov (United States)

Lee, R. F.; Mikesell, D.; Rolland, L.

2017-12-01

Research from the past 20 years has shown that we can detect coseismic disturbances in the total electron content (TEC) using global navigation space systems (GNSS). In the near field, TEC disturbances are created by the direct wave from rupture on the surface. This pressure wave travels through the neutral atmosphere to the ionosphere within about 10 minutes. This provides the opportunity to almost immediately characterize the source of the acoustic disturbance on the surface using methods from seismology. In populated areas, this could provide valuable information to first responders. To retrieve the surface motion amplitude information we must account for changes in the waveform caused by the geomagnetic field, motion of the satellites and the geometry of the satellites and receivers. One method is to use a transfer function to invert for the neutral atmosphere pressure wave. Gómez et al (2015) first employed an analytical model to invert for acoustic waves produced by Rayleigh waves propagating along the Earth's surface. Here, we examine the same model in the near field using the TEC disturbances from the direct wave produced by rupture at the surface. We compare results from the forward model against a numerical model that has been shown to be in good agreement with observations from the 2011 Van (Turkey) earthquake. We show the forward model predictions using both methods for the Van earthquake. We then analyze results for hypothetical events at different latitudes and discuss the reliability of the analytical model in each scenario. Gómez, D., R. Jr. Smalley, C. A. Langston, T. J. Wilson, M. Bevis, I. W. D. Dalziel, E. C. Kendrick, S. A. Konfal, M. J. Willis, D. A. Piñón, et al. (2015), Virtual array beamforming of GPS TEC observations of coseismic ionospheric disturbances near the Geomagnetic South Pole triggered by teleseismic megathrusts, J. Geophys. Res. Space Physics, 120, 9087-9101, doi:10.1002/2015JA021725.

Measurement of the infarcted area by 201Tl myocardial emission CT

International Nuclear Information System (INIS)

Tamaki, Shunichi; Murakami, Tomoyuki; Kambara, Hirofumi

1982-01-01

201 Tl-ECT was performed in 28 cases 4 weeks after the onset of acute myocardial infarction to calculate the volume of infarction for comparison with the CK-MB infarction size obtained in the acute phase. The infarct area obtained by two-dimensional 201 Tl scintigraphy in 18 cases treated by the conventional method showed a positive correlation with the CK-MB infarct size, but the volume of infarction by 201 Tl-ECT produced a better correlation. In the group with successful thrombolysis, the serum CK-MB level reached a peak soon after the onset, accompanied by release of more CK-MB for a constant volume of infarction obtained by 201 Tl-ECT, as compared with the group with unsuccessful thrombolysis or conventional therapy. This suggests the involvement of washout phenomenon by reperfusion. Although there are some limitations, the three-dimensional detection of the distribution of myocardial blood flow by 201 Tl-ECT is useful, covering disadvantages of two-dimensional images. (Chiba, N.)

Reliability-Driven Assessment of GaN HEMTs and Si IGBTs in 3L-ANPC PV Inverters

DEFF Research Database (Denmark)

Gurpinar, Emre; Yang, Yongheng; Iannuzzo, Francesco

2016-01-01

In this paper, thermal loading of the state-of-the-art GaN HEMTs and traditional Si IGBTs in 3L-ANPC PV inverters is presented considering real-field long-term mission profiles (i.e., ambient temperature and solar irradiance). A comparison of Si IGBT against GaN HEMT with three different possibil......In this paper, thermal loading of the state-of-the-art GaN HEMTs and traditional Si IGBTs in 3L-ANPC PV inverters is presented considering real-field long-term mission profiles (i.e., ambient temperature and solar irradiance). A comparison of Si IGBT against GaN HEMT with three different...... be achieved without compromise of operating efficiency with GaN HEMTs. Both simulations and experimental tests are provided to demonstrate the thermal loading analysis approach. More important, the proposed analysis and comparison approach can be used for lifetime and reliability analysis of wide...

Captación de Talio-201 en pulmón y corazón con diferentes tipos de estrés. Estudio en voluntarios sanos

OpenAIRE

Maceira, A.M. (Alicia M.); Cabrera, A. (A.); Albaladejo, V.J. (V.J.); Garcia-Velloso, M.J. (María José); Richter, J.A. (José Ángel); Coma-Canella, I. (Isabel)

1999-01-01

Para comprobar si existen diferencias en la captación pulmonar y miocárdica de Talio-201 entre distintos tipos de estrés se estudiaron 40 voluntarios varones de edad 21,7 ± 0,9 años. A todos se les practicó una gammagrafía de perfusión miocárdica con Talio-201 mediante SPECT. Los 40 individuos fueron aleatorizados en 4 grupos de 10 sujetos cada uno, siendo cada grupo sometido a un tipo de estrés: ejercicio físico, dobutamina, dipiridamol y adenosina trifosfato (ATP). Se observaron diferencias...

Evolución normativa y progreso en construcción arquitectónica (A propósito de la renovación de la MV.201

Directory of Open Access Journals (Sweden)

González Moreno-Navarro, José Luis

1991-02-01

Full Text Available With the conversion of MV-201-72 into NBE-EL-90 various aspects related structural systems of brick walls have fallen in disuse because of questions foreign to their real possibilites for contributing solutions to buildings. Because it is the system according to which the nearly all the buildings built before 1970 were constructed, these considerations need to preferably encompass structural verification procedures of that which has already been constructed. The current state of knowledge and criteria at the international level with its concretion in regulations from countries of our cultural orbit, such as Italy is succintly expressed and may serve as a reference. The recent tendencies of Italian specialists, relegatin mathematical tools to a secondary plane and stressing qualitative knowledge based on a historical treatment furthermore entails a powerful reason for reflection on the bases of the science of construction. This content is developed in the post-graduate course "Diagnosi, reparació i manteniment d'edificis d'habitatge" (Diagnosis, repair and maintenance of housing buildings now being imparted at the Barcelona School of Architecture, especially that related to the verification of the degree of structural safety of existing buildings.

Con motivo de la conversión de la MV-201-72 en NBE-FL-90 es oportuno volver a incidir sobre diversos aspectos relacionados con los sistemas estructurales de muros de obra de fábrica, sistemas que han caído en desuso más bien por cuestiones ajenas a sus posibilidades reales de aportar soluciones a la edificación. Por ser el sistema con el que se ha construido la casi totalidad del parque edificado antes de la década de los sesenta, estas consideraciones han de abarcar preferentemente los procedimientos de verificación estructural de lo ya construido. Se expone sucintamente el estado del conocimiento actual y criterios a nivel internacional y su concreción en normativas en pa

A high-performance complementary inverter based on transition metal dichalcogenide field-effect transistors.

Science.gov (United States)

Cho, Ah-Jin; Park, Kee Chan; Kwon, Jang-Yeon

2015-01-01

For several years, graphene has been the focus of much attention due to its peculiar characteristics, and it is now considered to be a representative 2-dimensional (2D) material. Even though many research groups have studied on the graphene, its intrinsic nature of a zero band-gap, limits its use in practical applications, particularly in logic circuits. Recently, transition metal dichalcogenides (TMDs), which are another type of 2D material, have drawn attention due to the advantage of having a sizable band-gap and a high mobility. Here, we report on the design of a complementary inverter, one of the most basic logic elements, which is based on a MoS2 n-type transistor and a WSe2 p-type transistor. The advantages provided by the complementary metal-oxide-semiconductor (CMOS) configuration and the high-performance TMD channels allow us to fabricate a TMD complementary inverter that has a high-gain of 13.7. This work demonstrates the operation of the MoS2 n-FET and WSe2 p-FET on the same substrate, and the electrical performance of the CMOS inverter, which is based on a different driving current, is also measured.

Recent Advances in the Inverted Planar Structure of Perovskite Solar Cells.

Science.gov (United States)

Meng, Lei; You, Jingbi; Guo, Tzung-Fang; Yang, Yang

2016-01-19

Inorganic-organic hybrid perovskite solar cells research could be traced back to 2009, and initially showed 3.8% efficiency. After 6 years of efforts, the efficiency has been pushed to 20.1%. The pace of development was much faster than that of any type of solar cell technology. In addition to high efficiency, the device fabrication is a low-cost solution process. Due to these advantages, a large number of scientists have been immersed into this promising area. In the past 6 years, much of the research on perovskite solar cells has been focused on planar and mesoporous device structures employing an n-type TiO2 layer as the bottom electron transport layer. These architectures have achieved champion device efficiencies. However, they still possess unwanted features. Mesoporous structures require a high temperature (>450 °C) sintering process for the TiO2 scaffold, which will increase the cost and also not be compatible with flexible substrates. While the planar structures based on TiO2 (regular structure) usually suffer from a large degree of J-V hysteresis. Recently, another emerging structure, referred to as an "inverted" planar device structure (i.e., p-i-n), uses p-type and n-type materials as bottom and top charge transport layers, respectively. This structure derived from organic solar cells, and the charge transport layers used in organic photovoltaics were successfully transferred into perovskite solar cells. The p-i-n structure of perovskite solar cells has shown efficiencies as high as 18%, lower temperature processing, flexibility, and, furthermore, negligible J-V hysteresis effects. In this Account, we will provide a comprehensive comparison of the mesoporous and planar structures, and also the regular and inverted of planar structures. Later, we will focus the discussion on the development of the inverted planar structure of perovskite solar cells, including film growth, band alignment, stability, and hysteresis. In the film growth part, several

Fabrication and optical characterization of GaN waveguides on (−201)-oriented β-Ga_2O_3

KAUST Repository

Awan, Kashif M.; Muhammad, Mufasila M.; Sivan, Madhavi; Bonca, Spencer; Roqan, Iman S.; Dolgaleva, Ksenia

2017-01-01

Gallium nitride (GaN), a wide-bandgap III-V semiconductor material with a bandgap wavelength λ = 366 nm (for Wurtzite GaN) and transparency window covering the visible spectrum, has a large number of applications for photonics and optoelectronics. However, the optical quality of this material suffers from growth imperfections due to the lack of a suitable substrate. Recent studies have shown that GaN grown on (-201) β - GaO (gallium oxide) has better lattice matching and hence superior optical quality as compared to GaN grown traditionally on AlO (sapphire). In this work, we report on the fabrication of GaN waveguides on GaO substrate, followed by a wet-etch process aimed at the reduction of waveguide surface roughness and improvement of side-wall verticality in these waveguides. The propagation loss in the resulting waveguides has been experimentally determined to be 7.5 dB/cm.

Fabrication and optical characterization of GaN waveguides on (−201)-oriented β-Ga_2O_3

KAUST Repository

Awan, Kashif M.

2017-12-19

Gallium nitride (GaN), a wide-bandgap III-V semiconductor material with a bandgap wavelength λ = 366 nm (for Wurtzite GaN) and transparency window covering the visible spectrum, has a large number of applications for photonics and optoelectronics. However, the optical quality of this material suffers from growth imperfections due to the lack of a suitable substrate. Recent studies have shown that GaN grown on (-201) β - GaO (gallium oxide) has better lattice matching and hence superior optical quality as compared to GaN grown traditionally on AlO (sapphire). In this work, we report on the fabrication of GaN waveguides on GaO substrate, followed by a wet-etch process aimed at the reduction of waveguide surface roughness and improvement of side-wall verticality in these waveguides. The propagation loss in the resulting waveguides has been experimentally determined to be 7.5 dB/cm.

Myocardial thallium-201 kinetics during coronary occlusion and reperfusion: influence of method of reflow and timing of thallium-201 administration

International Nuclear Information System (INIS)

Granato, J.E.; Watson, D.D.; Flanagan, T.L.; Gascho, J.A.; Beller, G.A.

1986-01-01

Thallium-201 (201Tl) uptake and redistribution kinetics were examined in an open-chest canine preparation of occlusion and reperfusion. Seven dogs (group I) underwent 3 hr of sustained occlusion and received 1.5 mCi of 201Tl after 40 min of occlusion of the left anterior descending coronary artery (LAD). Group II (n = 18) underwent 60 min of LAD occlusion followed by sudden and total release of the ligature. Group IIa (n = 8) received intravenous 201Tl during occlusion of the LAD, whereas group IIb (n = 10) received intravenous 201Tl at the time of peak reflow. Group III dogs (n = 26) also underwent 60 min of LAD occlusion that was followed by gradual reflow through a residual critical stenosis. Animals in this group also received 201Tl either before (IIIa; n = 16) or after reflow was established (IIIb; n = 10). In group I, the relative 201Tl gradient (nonischemic minus ischemic activity) decreased from 88 +/- 8% (mean +/- SEM) to 59 +/- 6% during 3 hr of coronary occlusion (p = .034). After rapid and total reperfusion (group IIa), this gradient decreased from 71 +/- 6% during occlusion to 26 +/- 5% after reflow (p less than .001). After slow reperfusion through a residual stenosis (group IIIa), the gradient decreased from 81 +/- 5% to 31 +/- 5% (p less than .001) (p = .56 compared with group IIa). In rapidly reperfused dogs receiving intravenous thallium during peak reflow (IIb), initial 201Tl activity in the ischemic zone was 155 +/- 20% of initial normal activity and fell to 93 +/- 13% of normal after 2 hr of reperfusion. In dogs reperfused slowly through a critical stenosis (IIIb), which received 201Tl during reflow, 201Tl activity soon after reflow was 94 +/- 4% of initial normal and decreased to 80 +/- 6% at 2 hr of reperfusion (p = .10). There was histochemical evidence of necrosis in the biopsy region in 80% of the 20 dogs subjected to triphenyl tetrazolium chloride staining

Transformerless PV inverters. Final report

Energy Technology Data Exchange (ETDEWEB)

Borup, U.

2009-12-15

Since the start of the project the market for grid connected PV inverters have developed further. When the project started three - phase inverter were only available in high power systems. The technology developed within this project will enable three phase technology also to be implemented in string inverters for system down to 10 kW. We expect this to be very attractive due to the increased demand for symmetrical feed-in to the grid. The project relevance is therefore high and the sector continues to develop very much driven by technology. Especially the inverter technology is getting a lot of focus. The inverter systems are expected to take a much larger role in supporting the electrical grid in the future. The technology platform developed within the project is prepared to be extended with these utility functionalities. The main results of the project were: 1) A new technology concept for transformer-less inverters has been demonstrated with a number of prototypes. 2) Efficiency above 97,7% has been proven. 3) Efficiency and Maximum power point tracking has been optimized to ensure that almost all energy produced of the panels is transferred to the grid. 4) The platform is developed with a very fast control board, which enables extended functionality as demanding grid supporting functions in the future. Details about cost price and details about the control loop implementation is excluded from the report due to the competitive situation for Danfoss Solar Inverters A/S. (LN)

Grid Connection of Wave Power Farm Using an N-Level Cascaded H-Bridge Multilevel Inverter

Directory of Open Access Journals (Sweden)

Rickard Ekström

2013-01-01

Full Text Available An N-level cascaded H-bridge multilevel inverter is proposed for grid connection of large wave power farms. The point-absorber wave energy converters are individually rectified and used as isolated DC-sources. The variable power characteristics of the wave energy converters are discussed, and a method of mitigating this issue is demonstrated. The complete power control system is given in detail and has been experimentally verified for a single-phase setup of the 9-level inverter. Theoretical expressions of the power sharing between multilevel cells are derived and show good correspondence with the experimental results.

48 CFR 3019.201 - General policy.

Science.gov (United States)

2010-10-01

... Section 3019.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General policy. (d) DHS is committed to a unified team approach involving senior management, small business...

Monolithically Integrated Flexible Black Phosphorus Complementary Inverter Circuits.

Science.gov (United States)

Liu, Yuanda; Ang, Kah-Wee

2017-07-25

Two-dimensional (2D) inverters are a fundamental building block for flexible logic circuits which have previously been realized by heterogeneously wiring transistors with two discrete channel materials. Here, we demonstrate a monolithically integrated complementary inverter made using a homogeneous black phosphorus (BP) nanosheet on flexible substrates. The digital logic inverter circuit is demonstrated via effective threshold voltage tuning within a single BP material, which offers both electron and hole dominated conducting channels with nearly symmetric pinch-off and current saturation. Controllable electron concentration is achieved by accurately modulating the aluminum (Al) donor doping, which realizes BP n-FET with a room-temperature on/off ratio >10 3 . Simultaneously, work function engineering is employed to obtain a low Schottky barrier contact electrode that facilities hole injection, thus enhancing the current density of the BP p-FET by 9.4 times. The flexible inverter circuit shows a clear digital logic voltage inversion operation along with a larger-than-unity direct current voltage gain, while exhibits alternating current dynamic signal switching at a record high frequency up to 100 kHz and remarkable electrical stability upon mechanical bending with a radii as small as 4 mm. Our study demonstrates a practical monolithic integration strategy for achieving functional logic circuits on one material platform, paving the way for future high-density flexible electronic applications.

The vibration-rotation-tunneling levels of N2-H2O and N2-D2O

Science.gov (United States)

Wang, Xiao-Gang; Carrington, Tucker

2015-07-01

In this paper, we report vibration-rotation-tunneling levels of the van der Waals clusters N2-H2O and N2-D2O computed from an ab initio potential energy surface. The only dynamical approximation is that the monomers are rigid. We use a symmetry adapted Lanczos algorithm and an uncoupled product basis set. The pattern of the cluster's levels is complicated by splittings caused by H-H exchange tunneling (larger splitting) and N-N exchange tunneling (smaller splitting). An interesting result that emerges from our calculation is that whereas in N2-H2O, the symmetric H-H tunnelling state is below the anti-symmetric H-H tunnelling state for both K = 0 and K = 1, the order is reversed in N2-D2O for K = 1. The only experimental splitting measurements are the D-D exchange tunneling splittings reported by Zhu et al. [J. Chem. Phys. 139, 214309 (2013)] for N2-D2O in the v2 = 1 region of D2O. Due to the inverted order of the split levels, they measure the sum of the K = 0 and K = 1 tunneling splittings, which is in excellent agreement with our calculated result. Other splittings we predict, in particular those of N2-H2O, may guide future experiments.

21 CFR 201.21 - Declaration of presence of phenylalanine as a component of aspartame in over-the-counter and...

Science.gov (United States)

2010-04-01

... component of aspartame in over-the-counter and prescription drugs for human use. 201.21 Section 201.21 Food... component of aspartame in over-the-counter and prescription drugs for human use. (a) Aspartame is the... acids are so combined to form aspartame (1-methyl N-L-α-aspartyl-L-phenylalanine), they produce an...

An Optimal Current Controller Design for a Grid Connected Inverter to Improve Power Quality and Test Commercial PV Inverters.

Science.gov (United States)

Algaddafi, Ali; Altuwayjiri, Saud A; Ahmed, Oday A; Daho, Ibrahim

2017-01-01

Grid connected inverters play a crucial role in generating energy to be fed to the grid. A filter is commonly used to suppress the switching frequency harmonics produced by the inverter, this being passive, and either an L- or LCL-filter. The latter is smaller in size compared to the L-filter. But choosing the optimal values of the LCL-filter is challenging due to resonance, which can affect stability. This paper presents a simple inverter controller design with an L-filter. The control topology is simple and applied easily using traditional control theory. Fast Fourier Transform analysis is used to compare different grid connected inverter control topologies. The modelled grid connected inverter with the proposed controller complies with the IEEE-1547 standard, and total harmonic distortion of the output current of the modelled inverter has been just 0.25% with an improved output waveform. Experimental work on a commercial PV inverter is then presented, including the effect of strong and weak grid connection. Inverter effects on the resistive load connected at the point of common coupling are presented. Results show that the voltage and current of resistive load, when the grid is interrupted, are increased, which may cause failure or damage for connecting appliances.

Separate effects of ischemia, hypoxia, and contractility on thallium-201 kinetics in rabbit myocardium

International Nuclear Information System (INIS)

Leppo, J.A.; Macneil, P.B.; Moring, A.F.; Apstein, C.S.

1986-01-01

The effects of hypoxia and ischemia, as well as altered contractility, on thallium-201 ( 201 TI) kinetics were evaluated in 42 isolated isovolumetrically contracting rabbit hearts. In Group A, three subgroups (n = 7 each) were studied that had either normal flow and oxygenation, hypoxia and normal flow, or ischemic flow and normal perfusate oxygen content. In Group B, three subgroups (n = 7 each) were studied and all hearts had normal flow but the contractile state was either enhanced with isoproterenol or impaired by hypocalcemia. A hemoglobin-free buffer perfusate was used in all experiments and multiple timed collections of arterial and coronary sinus effluent were used to model myocardial isotope activity during 30 min of constant uptake followed by 30 min of tracer clearance. During ischemia, hypoxia and hypocalcemia peak developed pressure and peak positive and negative dP/dt were all significantly reduced when compared to normal hemodynamic parameters (p less than 0.01). As expected, isoproterenol significantly elevated these parameters (p less than 0.04). Myocardial 201 TI kinetics were adequately described utilizing a bi-exponential model having a fast and slow component. Only ischemic hearts had significantly lower rate constants for 201 TI uptake and clearance than normal hearts (p less than 0.001). The mean (+/- s.d.) myocardial uptake and clearance rates for 201 TI (%/min) varied between 4.86 +/- 0.87 and 7.18 +/- 1.45 for the remaining groups of hearts. Therefore, myocardial 201 TI kinetics appear to be dominated by coronary flow and may not reflect marked alterations in the metabolic and contractile state. These data suggest that normal 201 TI uptake in impaired or hypercontractile cells, receiving normal flow, may not represent normal cellular function

Commercial production of thallium-201 chloride

International Nuclear Information System (INIS)

Sokolov, S.V.; Volkova, N.M.; Skokov, V.S.

1989-01-01

Thallium-201 chloride pharmaceuticals production practice at the Medradiopreparat factory under USSR Ministry of Public Health is described. The factory is carried out series-produced supplies of the compound prepared according to a new practice from September, 1985. Thallium-201 extraction from cyclotron targets irradiated is carried out by the extraction method

Inverters for photovoltaics: quality assurance

International Nuclear Information System (INIS)

Graf, J.D.; Haeberlin, H.

2000-01-01

This project-overview published by the University of Applied Science in Burgdorf, Switzerland, looks back at the history of the university's testing laboratory for inverters for use in photovoltaic installations and discusses the work done there. After its move from Oberburg to Burgdorf in the early nineties, the laboratory was equipped to provide testing facilities for inverters up to 60 kW. Additions have been made to the infrastructure since then to facilitate the testing of various types of inverter produced in Switzerland and other countries. The measurements that can be carried out, including DC-AC conversion efficiency, harmonics, RF interference, islanding, sensitivity to tele-control signals, turn-on power and operating voltage range are described. The improvement in the quality of the inverters tested is discussed and the importance of continued testing as new manufacturers come onto the market is emphasised. The installation of further testing equipment, such as a 25 kW solar generator simulator and apparatus for the testing of maximum-power-tracking efficiency is discussed

Diode-Assisted Buck-Boost Voltage-Source Inverters

DEFF Research Database (Denmark)

Gao, Feng; Loh, Poh Chiang; Teodorescu, Remus

2009-01-01

, a number of diode-assisted inverter variants can be designed with each having its own operational principle and voltage gain expression. For controlling them, a generic modulation scheme that can be used for controlling all diode-assisted variants with minimized harmonic distortion and component stress......This paper proposes a number of diode-assisted buck-boost voltage-source inverters with a unique X-shaped diode-capacitor network inserted between the inverter circuitry and dc source for producing a voltage gain that is comparatively higher than those of other buck-boost conversion techniques....... Using the diode-assisted network, the proposed inverters can naturally configure themselves to perform capacitive charging in parallel and discharging in series to give a higher voltage multiplication factor without compromising waveform quality. In addition, by adopting different front-end circuitries...

Ultralow power complementary inverter circuits using axially doped p- and n-channel Si nanowire field effect transistors.

Science.gov (United States)

Van, Ngoc Huynh; Lee, Jae-Hyun; Whang, Dongmok; Kang, Dae Joon

2016-06-09

We have successfully synthesized axially doped p- and n-type regions on a single Si nanowire (NW). Diodes and complementary metal-oxide-semiconductor (CMOS) inverter devices using single axial p- and n-channel Si NW field-effect transistors (FETs) were fabricated. We show that the threshold voltages of both p- and n-channel Si NW FETs can be lowered to nearly zero by effectively controlling the doping concentration. Because of the high performance of the p- and n-type Si NW channel FETs, especially with regard to the low threshold voltage, the fabricated NW CMOS inverters have a low operating voltage (<3 V) while maintaining a high voltage gain (∼6) and ultralow static power dissipation (≤0.3 pW) at an input voltage of ±3 V. This result offers a viable way for the fabrication of a high-performance high-density logic circuit using a low-temperature fabrication process, which makes it suitable for flexible electronics.

A method for the production of thallium-201

International Nuclear Information System (INIS)

Ageev, V.A.; Kljuchnikov, A.A.; Linev, A.F.; Khalkin, V.A.; Zaitseva, N.G.

1987-01-01

For the production of thallium-201 a target of at least 95% enriched pure lead-206 is irradiated by a proton beam of an energy of between 50 and 70 MeV. During irradiation the reaction 206 Pb(p,6n) 201 Bi takes place. The target is kept sufficiently long for the transition 201 Bi- 201 Pb- 201 Tl to take place. The target is then dissolved in acid. The thallium-201 contained in the acid is oxidized to the trivalent state followed by precipitation of the lead. Lead traces remaining in solution are separated from the thallium-201 through cation exchange following which the thallium-201 is eluted using hydrochloric acid

Design and fabrication of ZnO/TiO2-based thin-film inverter circuits using solution processing techniques

International Nuclear Information System (INIS)

Liau, Leo Chau-Kuang; Kuo, Juo-Wei; Chiang, Hsin-Ni

2012-01-01

Novel and cost-effective ceramic-based thin-film inverter circuits, based on two layers of TiO 2 and ZnO films to construct junction field-effect transistors (FETs), were designed and fabricated by solution coating techniques. The double layers of the sol–gel ZnO and TiO 2 films were coated and characterized as a diode according to the current–voltage performance. Two types of FETs, the p-channel (p-FET) and the n-channel (n-FET) devices, were produced using different coating sequences of ZnO and TiO 2 layers. Both of the transistor performances were evaluated by analyzing the source–drain current versus voltage (I ds –V ds ) data with the control of the gate voltage (V g ). The ZnO/TiO 2 -based inverter circuits, such as the complementary-FET device, were further fabricated using the integration of the p-FET and the n-FET. The voltage transfer characteristics of the inverters were estimated by the tests of the input voltage (V in ) versus the output voltage (V out ) for the thin-film inverter circuits. (paper)

Serum inverts and improves the fluorescence response of an aptamer beacon to various vitamin D analytes.

Science.gov (United States)

Bruno, John G; Carrillo, Maria P; Phillips, Taylor; Edge, Allison

2012-01-01

A dominant aptamer loop structure from a library of nearly 100 candidate aptamer sequences developed against immobilized 25-hydroxyvitamin D(3) (calcidiol) was converted into a 5'-TYE 665 and 3'-Iowa black-labelled aptamer beacon. The aptamer beacon exhibited a mild 'lights on' reaction in buffer as a function of increasing concentrations of several vitamin D analogues and metabolites, with a limit of detection of approximately 200 ng/mL, and was not specific for any particular congener. In 10% or 50% human serum, the same aptamer beacon inverted its fluorescence behaviour to become a more intense 'lights off' reaction with an improved limit of detection in the range 4-16 ng/mL. We hypothesized that this drastic change in fluorescence behaviour was due to the presence of creatinine and urea in serum, which might destabilize the quenched beacon, causing an increase in fluorescence followed by decreasing fluorescence as a function of vitamin D concentrations that may bind and quench increasingly greater fractions of the denatured beacons. However, the results of several control experiments in the presence of physiological or greater concentrations of creatinine and urea, alone or combined in buffer, failed to produce the beacon fluorescence inversion. Other possible mechanistic hypotheses are also discussed. Copyright © 2011 John Wiley & Sons, Ltd.

A Coordinate Control Strategy for Circulating Current Suppression in Multiparalleled Three-Phase Inverters

DEFF Research Database (Denmark)

Zhang, Xueguang; Wang, Tianyi; Wang, Xiongfei

2017-01-01

This paper addresses the zero-sequence circulating current control in the multiparalleled three-phase voltage-source inverters. The model of the zero-sequence circulating current in the N-paralleled (N ≥ 3) inverters is derived. It is shown that the circulating current is not only susceptible...... to the mismatches of circuit parameters, but it is also influenced by the interactions of circulating current controllers used by other paralleled inverters. To eliminate these adverse effects on the circulating current control loop, a coordinate control strategy for the N-paralleled inverter is proposed based...... on the zero-vector feedforward method with the space-vector pulse width modulation. Moreover, a virtual inverter method is introduced to facilitate the implementation of the proposed controller, which decouples the interactions of circulating current controllers in the paralleled inverters. Finally...

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

Biped Robot Gait Planning Based on 3D Linear Inverted Pendulum Model

Science.gov (United States)

Yu, Guochen; Zhang, Jiapeng; Bo, Wu

2018-01-01

In order to optimize the biped robot’s gait, the biped robot’s walking motion is simplify to the 3D linear inverted pendulum motion mode. The Center of Mass (CoM) locus is determined from the relationship between CoM and the Zero Moment Point (ZMP) locus. The ZMP locus is planned in advance. Then, the forward gait and lateral gait are simplified as connecting rod structure. Swing leg trajectory using B-spline interpolation. And the stability of the walking process is discussed in conjunction with the ZMP equation. Finally the system simulation is carried out under the given conditions to verify the validity of the proposed planning method.

Design a 10 kJ IS Mather Type Plasma Focus for Solid Target Activation to Produce Short-Lived Radioisotopes 12C(d,n)13N

Science.gov (United States)

Sadat Kiai, S. M.; Adlparvar, S.; Sheibani, S.; Elahi, M.; Safarien, A.; Farhangi, S.; Zirak, A. R.; Alhooie, S.; Mortazavi, B. N.; Khalaj, M. M.; Khanchi, A. R.; Dabirzadeh, A. A.; Kashani, A.; Zahedi, F.

2010-10-01

A 10 kJ (15 kV, 88 μF) IS (Iranian Sun) Mather type plasma focus device has been studied to determine the activity of a compound exogenous carbon solid target through 12C(d,n)13N nuclear reaction. The produced 13N is a short-lived radioisotope with a half-life of 9.97 min and threshold energy of 0.28 MeV. The results indicate that energetic deuterons impinging on the solid target can produce yield of = 6.7 × 10-5 with an activity of A = 6.8 × 104 Bq for one plasma focus shut and A ν = 4 × 105 Bq for 6 shut per mint when the projectile maximum deuterons energy is E max = 3 MeV.

Study of the structure of 3D-ordered macroporous GaN-ZnS:Mn nanocomposite films

Energy Technology Data Exchange (ETDEWEB)

Kurdyukov, D. A., E-mail: kurd@gvg.ioffe.ru; Shishkin, I. I.; Grudinkin, S. A.; Sitnikova, A. A.; Zamoryanskaya, M. V.; Golubev, V. G. [Russian Academy of Sciences, Ioffe Physical-Technical Institute (Russian Federation)

2015-05-15

A film-type 3D-ordered macroporous GaN-ZnS:Mn nanocomposite with the structure of an inverted opal is fabricated. Structural studies of the nanocomposite are performed, and it is shown that GaN and ZnS:Mn introduced into the pores of the silica opal are nanocrystallites misoriented with respect to each other. It is shown that the nanocomposite is a structurally perfect 3D photonic crystal. The efficiency of using a buffer of GaN crystallites to preclude interaction between the surface of the spherical a-SiO{sub 2} particles forming the opal matrix and chemically active substances introduced into the pores is demonstrated.

Phase Angle Control of Three Level Inverter Based D-STATCOM Using Neuro-Fuzzy Controller

Directory of Open Access Journals (Sweden)

COTELI, R.

2012-02-01

Full Text Available Distribution Static Compensator (D-STATCOM is a shunt compensation device used to improve electric power quality in distribution systems. It is well-known that D-STATCOM is a nonlinear, semi-defined and time-varying system. Therefore, control of D-STATCOM by the conventional control techniques is very difficult task. In this paper, the control of D-STATCOM is carried out by the neuro-fuzzy controller (NFC which has non-linear and robust structure. For this aim, an experimental setup based on three-level H-bridge inverter is constructed. Phase angle control method is used for control of D-STATCOM's output reactive power. Control algorithm for this experimental setup is prepared in MATLAB/Simulink and downloaded to DS1103 controller card. A Mamdani type NFC is designed for control of D-STATCOM's reactive current. Output of NFC is integrated to increase tracking performance of controller in steady state. The performance of D-STATCOM is experimentally evaluated by changing reference reactive current as on-line. The experimental results show that the proposed controller gives very satisfactory performance under different loading conditions.

31 CFR 539.201 - Prohibited importation of goods, technology, or services.

Science.gov (United States)

2010-07-01

..., technology, or services. 539.201 Section 539.201 Money and Finance: Treasury Regulations Relating to Money... date, directly or indirectly, of any goods, technology, or services produced or provided by a... DESTRUCTION TRADE CONTROL REGULATIONS Prohibitions § 539.201 Prohibited importation of goods, technology, or...

Tunnel currents produced by defects in p-n junctions of GaAs grown on vapor phase

International Nuclear Information System (INIS)

Barrales Guadarrama, V R; Rodríguez Rodriguez, E M; Barrales Guadarrama, R; Reyes Ayala, N

2017-01-01

With the purpose of assessing if the epitaxy on vapor phase technique “Close Space Vapor Deposition (CSVT)” is capable of produce thin films with adequate properties in order to manufacture p-n junctions, a study of invert and direct current was developed, in a temperature range of 94K to 293K, to junctions p-n of GaAs grown through the technique CSVT. It is shown that the dominant current, within the range 10 -7 to 10 -2 A, is consistent with a currents model of the type of internal emission form field, which shows these currents are due to the presence of localized states in the band gap. (paper)

Disturbance estimator based predictive current control of grid-connected inverters

OpenAIRE

Al-Khafaji, Ahmed Samawi Ghthwan

2013-01-01

ABSTRACT: The work presented in my thesis considers one of the modern discrete-time control approaches based on digital signal processing methods, that have been developed to improve the performance control of grid-connected three-phase inverters. Disturbance estimator based predictive current control of grid-connected inverters is proposed. For inverter modeling with respect to the design of current controllers, we choose the d-q synchronous reference frame to make it easier to understand an...

Low-resistance gateless high electron mobility transistors using three-dimensional inverted pyramidal AlGaN/GaN surfaces

International Nuclear Information System (INIS)

So, Hongyun; Senesky, Debbie G.

2016-01-01

In this letter, three-dimensional gateless AlGaN/GaN high electron mobility transistors (HEMTs) were demonstrated with 54% reduction in electrical resistance and 73% increase in surface area compared with conventional gateless HEMTs on planar substrates. Inverted pyramidal AlGaN/GaN surfaces were microfabricated using potassium hydroxide etched silicon with exposed (111) surfaces and metal-organic chemical vapor deposition of coherent AlGaN/GaN thin films. In addition, electrical characterization of the devices showed that a combination of series and parallel connections of the highly conductive two-dimensional electron gas along the pyramidal geometry resulted in a significant reduction in electrical resistance at both room and high temperatures (up to 300 °C). This three-dimensional HEMT architecture can be leveraged to realize low-power and reliable power electronics, as well as harsh environment sensors with increased surface area

Low-resistance gateless high electron mobility transistors using three-dimensional inverted pyramidal AlGaN/GaN surfaces

Energy Technology Data Exchange (ETDEWEB)

So, Hongyun, E-mail: hyso@stanford.edu [Department of Aeronautics and Astronautics, Stanford University, Stanford, California 94305 (United States); Senesky, Debbie G. [Department of Aeronautics and Astronautics, Stanford University, Stanford, California 94305 (United States); Department of Electrical Engineering, Stanford University, Stanford, California 94305 (United States)

2016-01-04

In this letter, three-dimensional gateless AlGaN/GaN high electron mobility transistors (HEMTs) were demonstrated with 54% reduction in electrical resistance and 73% increase in surface area compared with conventional gateless HEMTs on planar substrates. Inverted pyramidal AlGaN/GaN surfaces were microfabricated using potassium hydroxide etched silicon with exposed (111) surfaces and metal-organic chemical vapor deposition of coherent AlGaN/GaN thin films. In addition, electrical characterization of the devices showed that a combination of series and parallel connections of the highly conductive two-dimensional electron gas along the pyramidal geometry resulted in a significant reduction in electrical resistance at both room and high temperatures (up to 300 °C). This three-dimensional HEMT architecture can be leveraged to realize low-power and reliable power electronics, as well as harsh environment sensors with increased surface area.

Approximate 2D inversion of airborne TEM data

DEFF Research Database (Denmark)

Christensen, N.B.; Wolfgram, Peter

2006-01-01

We propose an approximate two-dimensional inversion procedure for transient electromagnetic data. The method is a two-stage procedure, where data are first inverted with 1D multi-layer models. The 1D model section is then considered as data for the next inversion stage that produces the 2D model...... section. For moving platform data there is translational invariance and the second part of the inversion becomes a deconvolution. The convolution kernels are computed by perturbing one model element in an otherwise homogeneous 2D section and calculating full nonlinear responses. These responses...... are then inverted with 1D models to produce a 1D model section. This section is the convolution kernel for the deconvolution. Within its limitations, the approximate 2D inversion performs well. Theoretical modeling shows that it delivers model sections that are a definite improvement over 1D model sections...

ONC201 Demonstrates Antitumor Effects in Both Triple-Negative and Non-Triple-Negative Breast Cancers through TRAIL-Dependent and TRAIL-Independent Mechanisms.

Science.gov (United States)

Ralff, Marie D; Kline, Christina L B; Küçükkase, Ozan C; Wagner, Jessica; Lim, Bora; Dicker, David T; Prabhu, Varun V; Oster, Wolfgang; El-Deiry, Wafik S

2017-07-01

Breast cancer is a major cause of cancer-related death. TNF-related apoptosis-inducing ligand (TRAIL) has been of interest as a cancer therapeutic, but only a subset of triple-negative breast cancers (TNBC) is sensitive to TRAIL. The small-molecule ONC201 induces expression of TRAIL and its receptor DR5. ONC201 has entered clinical trials in advanced cancers. Here, we show that ONC201 is efficacious against both TNBC and non-TNBC cells ( n = 13). A subset of TNBC and non-TNBC cells succumbs to ONC201-induced cell death. In 2 of 8 TNBC cell lines, ONC201 treatment induces caspase-8 cleavage and cell death that is blocked by TRAIL-neutralizing antibody RIK2. The proapoptotic effect of ONC201 translates to in vivo efficacy in the MDA-MB-468 xenograft model. In most TNBC lines tested (6/8), ONC201 has an antiproliferative effect but does not induce apoptosis. ONC201 decreases cyclin D1 expression and causes an accumulation of cells in the G 1 phase of the cell cycle. pRb expression is associated with sensitivity to the antiproliferative effects of ONC201, and the compound synergizes with taxanes in less sensitive cells. All non-TNBC cells ( n = 5) are growth inhibited following ONC201 treatment, and unlike what has been observed with TRAIL, a subset ( n = 2) shows PARP cleavage. In these cells, cell death induced by ONC201 is TRAIL independent. Our data demonstrate that ONC201 has potent antiproliferative and proapoptotic effects in a broad range of breast cancer subtypes, through TRAIL-dependent and TRAIL-independent mechanisms. These findings develop a preclinical rationale for developing ONC201 as a single agent and/or in combination with approved therapies in breast cancer. Mol Cancer Ther; 16(7); 1290-8. ©2017 AACR . ©2017 American Association for Cancer Research.

A 3D-Space Vector Modulation Algorithm for Three Phase Four Wire Neutral Point Clamped Inverter Systems as Power Quality Compensator

Directory of Open Access Journals (Sweden)

Palanisamy Ramasamy

2017-11-01

Full Text Available A Unified Power Quality Conditioner (UPQC is designed using a Neutral Point Clamped (NPC multilevel inverter to improve the power quality. When designed for high/medium voltage and power applications, the voltage stress across the switches and harmonic content in the output voltage are increased. A 3-phase 4-wire NPC inverter system is developed as Power Quality Conditioner using an effectual three dimensional Space Vector Modulation (3D-SVM technique. The proposed system behaves like a UPQC with shunt and series active filter under balanced and unbalanced loading conditions. In addition to the improvement of the power quality issues, it also balances the neutral point voltage and voltage balancing across the capacitors under unbalanced condition. The hardware and simulation results of proposed system are compared with 2D-SVM and 3D-SVM. The proposed system is stimulated using MATLAB and the hardware is designed using FPGA. From the results it is evident that effectual 3D-SVM technique gives better performance compared to other control methods.

Improved Layout of Inverter for EMC Analysis

OpenAIRE

Yade , Ousseynou; Martin , Christian; Vollaire , Christian; Bréard , Arnaud; Ali , Marwan; Meuret , Régis; Hervé , Morel

2017-01-01

International audience; This paper details EMC (electromagnetic compatibility) analysis on an inverter application. The work deals with the whole power chain (±270Vdc input voltage to 3-phase 115 Vac output voltage). This inverter is composed by modular parts (power module and EMC filters) that supply motors in more electrical aircraft. Through our analysis an approach is defined to design a detailed lumped circuit model of the power module layout by using Q3D extractor and SABER software. Fr...

Improved control strategy for the three-phase grid-connected inverter

DEFF Research Database (Denmark)

Yao, Zhilei; Xiao, Lan; Guerrero, Josep M.

2015-01-01

An improved control strategy for the three-phase grid-connected inverter with space vector pulse width modulation (SVPWM) is proposed. When the grid current contains harmonics, the d- and q-axis grid currents will be interacted, and then the waveform quality of the grid current will be poorer....... As the reference output voltage cannot directly reflect the change of the reference grid current, the dynamic response of the grid-connected inverter is slow. In order to solve the aforementioned problems, the d- and q-axis grid currents in the decoupled components of the grid current controller can be substituted...... by the d- and q-axis reference grid currents, respectively. The operating principles of the traditional and proposed control methods are illustrated. Experimental results for a 15-kVA three-phase grid-connected inverter with SVPWM verify the theoretical analysis. Compared with the traditional control...

Classification and Construction of Invertible Linear Differential Operators on a One-Dimensional Manifold

Directory of Open Access Journals (Sweden)

V. N. Chetverikov

2014-01-01

Full Text Available Invertible linear differential operators with one independent variable are investigated. The problem of description of such operators is important, because it is connected with transformations and the classification of control systems, in particular, with the flatness problem.Each invertible linear differential operator represents a square matrix of scalar differential operators. Its product with an operator-column is an operator-column whose order does not exceed the sum of orders of initial operators. The operators-columns, the product with which leads to order fall, i.e. the order of the product is less than sum of orders of factors, are interesting for the description of invertible operators. In this paper the classification of invertible operators is based on dimensions dk,p of intersections of modules Gp and Fk for various k and p, where Gp is the module of all operators-columns of order not above p, and Fk is the module of compositions of the invertible operator with all operators-columns of order not above k. The invertible operators that have identical sets of numbers dk,p form one class.In the paper the general properties of tables of numbers dk,p for invertible operators are investigated. A correspondence between invertible operators and elementary-geometrical models which in the paper are named by d-schemes of squares is constructed. The invertible operator is ambiguously defined by its d-scheme of squares. The mathematical structure that must be set for its unique definition and an algorithm for the construction of the invertible operator are offered.In the proof of the main result, methods of the theory of chain complexes and their spectral sequences are used. In the paper all necessary concepts of this theory are formulated and the corresponding facts are proved.Results of the paper can be used for solving problems in which invertible linear differential operators are arisen. Namely, it is necessary to formulate the conditions on

Preclinical pharmacological study of 99mTcN(NOET)2 and comparison with 201Tl in redistribution of ischemia myocardium

International Nuclear Information System (INIS)

Wang, J.C.; Zhang, J.B.; Wang, Q.; Mi, H.Z.; Wang, X.B.

2002-01-01

Aim: To study the biological properties of the myocardial imaging agent 99m TcN(NOET) 2 and compare with 201 Tl in redistribution of ischemia myocardium. Materials and Methods: To prepared the 99m TcN(NOET) 2 complex, the intermediate [ 99m TcN] 2+ and ligand NOET were synthesized. In the presence of reducer and the doner of N, the [ 99m Tc=N] 2+ could be synthesized at 100, then NOET was added, 99m TcN(NOET) 2 was formed at room temperature. 201 Tl was provided by the Department of Isotope, China Institute of Atomic Energy. Five dogs were from the Fu Wai experimental animal feeding center, two of them were made into ischemia myocardium models by ligating some coronary artery branches were demonstrated by X-ray coronary angiography, the extent of stenosis of those blood vessels was over 90%. Dynamic imaging of rest was performed respectively in three normal dogs after injecting a dose of 555MBq (15mCi) of 99m TcN(NOET) 2 complex up to two hours. The whole body imaging planar and tomography imaging was carried out respectively at fixed time intervals during two hours in order to obtain the time-activity curves of heart, lung and liver, in vivo biodistribution and quality analysis of myocardial images. Moreover, intravenous blood samples were collected at different times to gain the kinetics of blood clearance. Stress and redistribution imaging underwent in two dogs with ischemia myocardium. Dipyridamol was given intravenously at a dose of 0.6mg/Kg in 4 mins. Stress :9 9m TcN(NOET) 2 myocardial SPECT imaging was performed at 30, 70 and 110 min after injection of 99m TcN(NOET) 2 complex, stress 201 Tl myocardial SPECT imaging was carried out 10 min and redistribution imaging 4 hr after injection of 55.5MBq (1.5mCi) 201 Tl chloride. The tests of 99m TcN(NOET) 2 and 201 Tl were performed respectively in the same dog within 10 days, in order to obtain a comparison between two myocardial redistribution imaging. Results: Radiochemical purity of 99m TcN(NOET) 2 was 98.41%�

ONC201 demonstrates anti-tumor effects in both triple negative and non-triple negative breast cancers through TRAIL-dependent and TRAIL-independent mechanisms

Science.gov (United States)

Ralff, Marie D.; Kline, Christina L.B.; Küçükkase, Ozan C; Wagner, Jessica; Lim, Bora; Dicker, David T.; Prabhu, Varun V.; Oster, Wolfgang; El-Deiry, Wafik S.

2017-01-01

Breast cancer is a major cause of cancer-related death. TRAIL has been of interest as a cancer therapeutic, but only a subset of triple negative breast cancers (TNBC) is sensitive to TRAIL. The small molecule ONC201 induces expression of TRAIL and its receptor DR5. ONC201 has entered clinical trials in advanced cancers. Here we show that ONC201 is efficacious against both TNBC and non-TNBC cells (n=13). A subset of TNBC and non-TNBC cells succumb to ONC201-induced cell death. In 2/8 TNBC cell lines, ONC201 treatment induces caspase-8 cleavage and cell death that is blocked by TRAIL-neutralizing antibody RIK2. The pro-apoptotic effect of ONC201 translates to in vivo efficacy in the MDA-MB-468 xenograft model. In most TNBC lines tested (6/8) ONC201 has an anti-proliferative effect but does not induce apoptosis. ONC201 decreases cyclin D1 expression and causes an accumulation of cells in the G1 phase of the cell cycle. pRb expression is associated with sensitivity to the anti-proliferative effects of ONC201, and the compound synergizes with taxanes in less sensitive cells. All non-TNBC cells (n=5) are growth inhibited following ONC201 treatment, and unlike what has been observed with TRAIL, a subset (n=2) show PARP cleavage. In these cells, cell death induced by ONC201 is TRAIL-independent. Our data demonstrate that ONC201 has potent anti-proliferative and pro-apoptotic effects in a broad range of breast cancer subtypes, through TRAIL-dependent and TRAIL-independent mechanisms. These findings develop a pre-clinical rationale for developing ONC201 as a single agent and/or in combination with approved therapies in breast cancer. PMID:28424227

The angular structure of ONC201, a TRAIL pathway-inducing compound, determines its potent anti-cancer activity.

Science.gov (United States)

Wagner, Jessica; Kline, Christina Leah; Pottorf, Richard S; Nallaganchu, Bhaskara Rao; Olson, Gary L; Dicker, David T; Allen, Joshua E; El-Deiry, Wafik S

2014-12-30

We previously identified TRAIL-inducing compound 10 (TIC10), also known as NSC350625 or ONC201, from a NCI chemical library screen as a small molecule that has potent anti-tumor efficacy and a benign safety profile in preclinical cancer models. The chemical structure that was originally published by Stahle, et. al. in the patent literature was described as an imidazo[1,2-a]pyrido[4,3-d]pyrimidine derivative. The NCI and others generally accepted this as the correct structure, which was consistent with the mass spectrometry analysis outlined in the publication by Allen et. al. that first reported the molecule's anticancer properties. A recent publication demonstrated that the chemical structure of ONC201 material from the NCI is an angular [3,4-e] isomer of the originally disclosed, linear [4,3-d] structure. Here we confirm by NMR and X-ray structural analysis of the dihydrochloride salt form that the ONC201 material produced by Oncoceutics is the angular [3,4-e] structure and not the linear structure originally depicted in the patent literature and by the NCI. Similarly, in accordance with our biological evaluation, the previously disclosed anti-cancer activity is associated with the angular structure and not the linear isomer. Together these studies confirm that ONC201, produced by Oncoceutics or obtained from the NCI, possesses an angular [3,4-e] structure that represents the highly active anti-cancer compound utilized in prior preclinical studies and now entering clinical trials in advanced cancers.

Prognostic significance of normal quantitative Tl-201 stress scintigraphy in relation to pretest likelihood of coronary artery disease

International Nuclear Information System (INIS)

Russo, D.J.; Russo, D.; Clements, J.; Wackers, F.

1984-01-01

A previous study reported an excellent prognosis and low cardiac event rate in patients(pts) with chest pain and normal quantitative T1-201 scintigraphy(SC). Such result would not be unexpected if the population under study had a predominance of pts with low pre-T1-201 likelihood(L) of significant coronary artery disease (CAD). Hence, the authors undertook telephone follow-up in pts with chest pain syndrome and normal quantitative T1-201 exercise SC, and related outcome to pretest L of CAD. Pretest L was determined by serial L analysis on the basis of: symptoms, age, sex, and exercise ECG. All pts had T1-201 SC immediately post exercise and 2 hrs later. After interpolative background correction, circumferential count and washout profiles were generated. All pts had unequivocally normal studies. Of a total of 96 pts studied in 1981-82, 20 pts were lost to follow-up. Of the remaining 76 pts, 45 were males and 31 females. The pretest L of CAD had an inverted Gaussian distribution: thirty-four pts(47%) had 66% L of CAD. Mean follow-up was 22+- 3 months. No deaths occurred. Two pts(3%) (with pretest L of 54% and 94%) had myocardial infarctions, 8 and 22 months respectively after T1-201 stress SC. One pt underwent percutaneous transluminal coronary angioplasty (PTCA) 16 months after T1-201 stress SC. These findings confirm excellent prognostic significance of normal quantitative T1-201 stress scintigraphy

Inverter for Interchangeable Use as Current Source Inverter and Voltage Source Inverter for Interconnecting to Grid

Science.gov (United States)

Teruya, Daisuke; Masukawa, Shigeo; Iida, Shoji

We propose a novel inverter that can be operated either as a Current Source Inverter (CSI) or as a Voltage Source Inverter (VSI) by changing only the control signals. It is proper to apply it to the interconnecting system with renewal energy, such as photovoltaic cells or wind generation systems, to a grid. This inverter is usually operated as the CSI connected to the grid. Even if the energy source has a lower voltage than the grid, the energy can be supplied to the grid through the proposed inverter. The power factor can be briefly maintained at almost unity. When power supply from the grid is interrupted, the proposed circuit should be operated as the VSI in the stand-alone operation mode. In this way, the circuit can maintain a constant output voltage to the loads. In this paper, the proposed circuit configuration and the control schemes for both the CSI and the VSI are described. Further, the circuit characteristics for both are discussed experimentally.

State-space-based harmonic stability analysis for paralleled grid-connected inverters

DEFF Research Database (Denmark)

Wang, Yanbo; Wang, Xiongfei; Chen, Zhe

2016-01-01

This paper addresses a state-space-based harmonic stability analysis of paralleled grid-connected inverters system. A small signal model of individual inverter is developed, where LCL filter, the equivalent delay of control system, and current controller are modeled. Then, the overall small signal...... model of paralleled grid-connected inverters is built. Finally, the state space-based stability analysis approach is developed to explain the harmonic resonance phenomenon. The eigenvalue traces associated with time delay and coupled grid impedance are obtained, which accounts for how the unstable...... inverter produces the harmonic resonance and leads to the instability of whole paralleled system. The proposed approach reveals the contributions of the grid impedance as well as the coupled effect on other grid-connected inverters under different grid conditions. Simulation and experimental results...

Highly Flexible Hybrid CMOS Inverter Based on Si Nanomembrane and Molybdenum Disulfide.

Science.gov (United States)

Das, Tanmoy; Chen, Xiang; Jang, Houk; Oh, Il-Kwon; Kim, Hyungjun; Ahn, Jong-Hyun

2016-11-01

2D semiconductor materials are being considered for next generation electronic device application such as thin-film transistors and complementary metal-oxide-semiconductor (CMOS) circuit due to their unique structural and superior electronics properties. Various approaches have already been taken to fabricate 2D complementary logics circuits. However, those CMOS devices mostly demonstrated based on exfoliated 2D materials show the performance of a single device. In this work, the design and fabrication of a complementary inverter is experimentally reported, based on a chemical vapor deposition MoS 2 n-type transistor and a Si nanomembrane p-type transistor on the same substrate. The advantages offered by such CMOS configuration allow to fabricate large area wafer scale integration of high performance Si technology with transition-metal dichalcogenide materials. The fabricated hetero-CMOS inverters which are composed of two isolated transistors exhibit a novel high performance air-stable voltage transfer characteristic with different supply voltages, with a maximum voltage gain of ≈16, and sub-nano watt power consumption. Moreover, the logic gates have been integrated on a plastic substrate and displayed reliable electrical properties paving a realistic path for the fabrication of flexible/transparent CMOS circuits in 2D electronics. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)

Science.gov (United States)

Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.

2010-01-01

There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).

Complementary p- and n-type polymer doping for ambient stable graphene inverter.

Science.gov (United States)

Yun, Je Moon; Park, Seokhan; Hwang, Young Hwan; Lee, Eui-Sup; Maiti, Uday; Moon, Hanul; Kim, Bo-Hyun; Bae, Byeong-Soo; Kim, Yong-Hyun; Kim, Sang Ouk

2014-01-28

Graphene offers great promise to complement the inherent limitations of silicon electronics. To date, considerable research efforts have been devoted to complementary p- and n-type doping of graphene as a fundamental requirement for graphene-based electronics. Unfortunately, previous efforts suffer from undesired defect formation, poor controllability of doping level, and subtle environmental sensitivity. Here we present that graphene can be complementary p- and n-doped by simple polymer coating with different dipolar characteristics. Significantly, spontaneous vertical ordering of dipolar pyridine side groups of poly(4-vinylpyridine) at graphene surface can stabilize n-type doping at room-temperature ambient condition. The dipole field also enhances and balances the charge mobility by screening the impurity charge effect from the bottom substrate. We successfully demonstrate ambient stable inverters by integrating p- and n-type graphene transistors, which demonstrated clear voltage inversion with a gain of 0.17 at a 3.3 V input voltage. This straightforward polymer doping offers diverse opportunities for graphene-based electronics, including logic circuits, particularly in mechanically flexible form.

Y-source inverter

DEFF Research Database (Denmark)

Siwakoti, Yam P.; Town, Graham; Loh, Poh Chiang

2014-01-01

This paper introduces a new 3-phase Y-source inverter whose gain is presently not matched by classical impedance-network-based inverters operating at the same duty ratio. The proposed network uses a tightly coupled transformer with three windings. By squeezing the shoot-through range while keeping...... higher boost, the inverter can operate at a higher modulation index, thereby minimizing switching device stress and providing better output power quality. In addition, the inverter has more degrees of freedom for setting the voltage gain and modulation index than other classical impedance-source networks...

A new inverter topology using GTO commutation. [Gate Turn Off thyristor

Science.gov (United States)

Rippel, W. E.

1983-01-01

A new N-phase, forced commutated bridge inverter topology has been developed wherein a single Gate Turn Off Thyristor (GTO) is used to commutate each of 2N main Thyristors (SCRs). Since, for most applications, the primary loss mechanism is the SCR forward drop, very high efficiencies are possible. Compared with conventional pure SCR and pure GTO inverters, cost per kW is lower - in the former case due to the large cost differential between GTOs and SCRs. Other advantages of the new inverter include high power density, low switching losses and stresses, modulation flexibility and amenability to high voltage and high frequency operation.

Development and Evaluation of a 2KVA Inverter

Directory of Open Access Journals (Sweden)

Ajayi Adedayo

2013-09-01

Full Text Available A 2KV inverter was designed, developed and tested for household applications. It consists of a heavy duty (24 V, 80 AH, oscillator unit, PWM (Pulse-width modulation controller unit, driver unit, amplifier unit, center-tap step up transformer and battery charger unit. The battery powered the circuitry and the oscillator section generates the drive signal that is amplified and set up the transformer to produce 240 V supply at the secondary winding connected to the output socket of inverter. The feedback control circuit uses discrete components such as: full wave rectifier, pulse width modulator (IC, diodes and other components to sense the output voltage (or load current. When the feedback senses that the load on the inverter output has increased, the inverter control circuitry acts by increasing the width of the switching pulse in the oscillator section which turn on the MOSFETS. MOSFETS turns on for longer time each cycle, automatically correcting the R.M.S value of the output to compensate for any drop in peak-peak output voltage as well as continuous charging of battery, consequently, maintaining a steady output voltage level in inverter irrespective of the load characteristics. The outputs of the tests carried on the unit shows that that instrument performs satisfactory well.

Closed Loop Fuzzy Logic Controlled PV Based Cascaded Boost Five-Level Inverter System

Science.gov (United States)

Revana, Guruswamy; Kota, Venkata Reddy

2018-04-01

Recent developments in intelligent control methods and power electronics have produced PV based DC to AC converters related to AC drives. Cascaded boost converter and inverter find their way in interconnecting PV and Induction Motor. This paper deals with digital simulation and implementation of closed loop controlled five-level inverter based Photo-Voltaic (PV) system. The objective of this work is to reduce the harmonics using Multi Level Inverter based system. The DC output from the PV panel is boosted using cascaded-boost-converters. The DC output of these cascaded boost converters is applied to the bridges of the cascaded inverter. The AC output voltage is obtained by the series cascading of the output voltage of the two inverters. The investigations are done with Induction motor load. Cascaded boost-converter is proposed in the present work to produce the required DC Voltage at the input of the bridge inverter. A simple FLC is applied to CBFLIIM system. The FLC is proposed to reduce the steady state error. The simulation results are compared with the hardware results. The results of the comparison are made to show the improvement in dynamic response in terms of settling time and steady state error. Design procedure and control strategy are presented in detail.

Ultra-low-loss inverted taper coupler for silicon-on-insulator ridge waveguide

DEFF Research Database (Denmark)

Pu, Minhao; Liu, Liu; Ou, Haiyan

2010-01-01

An ultra-low-loss coupler for interfacing a silicon-on-insulator ridge waveguide and a single-mode fiber in both polarizations is presented. The inverted taper coupler, embedded in a polymer waveguide, is optimized for both the transverse-magnetic and transverse-electric modes through tapering...... the width of the silicon-on-insulator waveguide from 450 nm down to less than 15 nm applying a thermal oxidation process. Two inverted taper couplers are integrated with a 3-mm long silicon-on-insulator ridge waveguide in the fabricated sample. The measured coupling losses of the inverted taper coupler...... for transverse-magnetic and transverse-electric modes are ~0.36 dB and ~0.66 dB per connection, respectively....

Membrane fusion and inverted phases

International Nuclear Information System (INIS)

Ellens, H.; Siegel, D.P.; Alford, D.; Yeagle, P.L.; Boni, L.; Lis, L.J.; Quinn, P.J.; Bentz, J.

1989-01-01

We have found a correlation between liposome fusion kinetics and lipid phase behavior for several inverted phase forming lipids. N-Methylated dioleoylphosphatidylethanolamine (DOPE-Me), or mixtures of dioleoylphosphatidylethanolamine (DOPE) and dioleoylphosphatidylcholine (DOPC), will form an inverted hexagonal phase (HII) at high temperatures (above TH), a lamellar phase (L alpha) at low temperatures, and an isotropic/inverted cubic phase at intermediate temperatures, which is defined by the appearance of narrow isotropic 31 P NMR resonances. The phase behavior has been verified by using high-sensitivity DSC, 31 P NMR, freeze-fracture electron microscopy, and X-ray diffraction. The temperature range over which the narrow isotropic resonances occur is defined as delta TI, and the range ends at TH. Extruded liposomes (approximately 0.2 microns in diameter) composed of these lipids show fusion and leakage kinetics which are strongly correlated with the temperatures of these phase transitions. At temperatures below delta TI, where the lipid phase is L alpha, there is little or no fusion, i.e., mixing of aqueous contents, or leakage. However, as the temperature reaches delta TI, there is a rapid increase in both fusion and leakage rates. At temperatures above TH, the liposomes show aggregation-dependent lysis, as the rapid formation of HII phase precursors disrupts the membranes. We show that the correspondence between the fusion and leakage kinetics and the observed phase behavior is easily rationalized in terms of a recent kinetic theory of L alpha/inverted phase transitions. In particular, it is likely that membrane fusion and the L alpha/inverted cubic phase transition proceed via a common set of intermembrane intermediates

Modular inverter system

Science.gov (United States)

Ma, Mingyao; Hu, Haibing; Kutkut, Nasser; Batarseh, Issa; Shen, John; , Bkayrat, Raed

2017-08-01

A system connected to an AC power grid having an AC phase signal includes an inverter module including a first inverter coupled to a DC voltage, actuated based on the AC phase signal. The first inverter provides a first voltage signal having predetermined harmonic components. A second inverter includes second switch elements coupled to the DC voltage and actuated by a second set of control signals phase delayed with respect to the first control signals. A transformer module has first and second primary windings coupled to the first and second inverters. The transformer module further includes a secondary winding coupled to first primary winding, the second primary winding, and the AC power grid. The secondary winding is configured to provide a secondary output voltage to the AC power grid by combining the first voltage signal and the second voltage signal such that the predetermined harmonic components are substantially cancelled.

Performance analysis of new type grid-tied inverter-Aalborg Inverter

DEFF Research Database (Denmark)

Wu, Weimin; Wang, Zhen; Ji, Junhao

2014-01-01

Aalborg Inverter is a grid-tied DC/AC inverter. In order to optimize the design, its power losses are analyzed in detail, combined with a description of the single-phase operating principle and the modulation strategy. A 2 kW / 220 V experimental prototype is constructed to verify the theoretical...... analysis. It is concluded that a minimize inductance in the power loop does help the inverter to achieve the high efficiency with the good dynamic performance....

Modified Dual Three-Pulse Modulation technique for single-phase inverter topology

Science.gov (United States)

Sree Harsha, N. R.; Anitha, G. S.; Sreedevi, A.

2016-01-01

In a recent paper, a new modulation technique called Dual Three Pulse Modulation (DTPM) was proposed to improve the efficiency of the power converters of the Electric/Hybrid/Fuel-cell vehicles. It was simulated in PSIM 9.0.4 and uses analog multiplexers to generate the modulating signals for the DC/DC converter and inverter. The circuit used is complex and many other simulation softwares do not support the analog multiplexers as well. Also, the DTPM technique produces modulating signals for the converter, which are essentially needed to produce the modulating signals for the inverter. Hence, it cannot be used efficiently to switch the valves of a stand-alone inverter. We propose a new method to generate the modulating signals to switch MOSFETs of a single phase Dual-Three pulse Modulation based stand-alone inverter. The circuits proposed are simulated in Multisim 12.0. We also show an alternate way to switch a DC/DC converter in a way depicted by DTPM technique both in simulation (MATLAB/Simulink) and hardware. The circuitry is relatively simple and can be used for the further investigations of DTPM technique.

Carrier dynamics of InxGa1-xN/GaN multiple quantum wells grown on (−201) β-Ga2O3 for bright vertical light emitting diodes

KAUST Repository

Mumthaz Muhammed, Mufasila; Xu, Jian; Wehbe, Nimer; Roqan, Iman S.

2018-01-01

High-quality InxGa1-xN/GaN multi-quantum well (MQW) structures (0.05≤x≤0.13), are successfully grown on transparent and conductive (−201)-oriented β-Ga2O3 substrate. Scanning-transmission electron microscopy and secondary ion mass spectrometry (SIMS) show well-defined high quality MQWs, while the In and Ga compositions in the wells and the barriers are estimated by SIMS. Temperature-dependant Photoluminescence (PL) confirms high optical quality with a strong bandedge emission and negligble yellow band. time-resolved PL measurements (via above/below-GaN bandgap excitations) explain carrier dynamics, showing that the radiative recombination is predominant. Our results demonstrate that (−201)-oriented β-Ga2O3 is a strong candidate as a substrate for III-nitride-based vertical- emitting devices.

Carrier dynamics of InxGa1-xN/GaN multiple quantum wells grown on (−201) β-Ga2O3 for bright vertical light emitting diodes

KAUST Repository

Mumthaz Muhammed, Mufasila

2018-05-30

High-quality InxGa1-xN/GaN multi-quantum well (MQW) structures (0.05≤x≤0.13), are successfully grown on transparent and conductive (−201)-oriented β-Ga2O3 substrate. Scanning-transmission electron microscopy and secondary ion mass spectrometry (SIMS) show well-defined high quality MQWs, while the In and Ga compositions in the wells and the barriers are estimated by SIMS. Temperature-dependant Photoluminescence (PL) confirms high optical quality with a strong bandedge emission and negligble yellow band. time-resolved PL measurements (via above/below-GaN bandgap excitations) explain carrier dynamics, showing that the radiative recombination is predominant. Our results demonstrate that (−201)-oriented β-Ga2O3 is a strong candidate as a substrate for III-nitride-based vertical- emitting devices.

Quasi-Y-source inverter

DEFF Research Database (Denmark)

Siwakoti, Yam Prasad; Blaabjerg, Frede; Loh, Poh Chiang

2015-01-01

This paper introduces a new inverter topology called a “quasi-Y-source inverter”. The proposed inverter inherits all the advantages of the original Y-source inverter. In addition, the new topology draws continuous current from the source which is required for many renewable sources. It also has dc......-current-blocking capacitors, which avoids saturation in the transformer core. Simulations and experimental results have proved the validity of the proposed inverter....

A Sub-µW Tuneable Switched-Capacitor Amplifier-Filter for Neural Recording Using a Class-C Inverter

Directory of Open Access Journals (Sweden)

A Ghorbani-Nejad

2013-12-01

Full Text Available A two stage sub-µW Inverter-based switched-capacitor amplifier-filter is presented which is capable of amplifying both spikes and local field potentials (LFP signals. Here we employ a switched capacitor technique for frequency tuning and reducing of 1/f noise of two stages. The reduction of power consumption is very necessary for neural recording devices however, in switched capacitor (SC circuits OTA is a major building block that consumes most of the power. Therefore an OTA-less technique utilizing a class-C inverter is employed that significantly reduces the power consumption. A detailed analysis of noise performance for the inverter-based SC circuits is presented. A mathematical model useful for analysis of such SC integrators is derived and a good comparison is obtained between simulation and analytical technique. With a supply voltage of 0.7V and using 0.18 µm CMOS technology, this design can achieves a power consumption of about 538 nW. The designed amplifier-filter has the gains 18.6 dB and 28.2 dB for low pass only and cascaded filter, respectively. By applying different sampling frequencies, the filter attains a reconfigurable bandwidth.

Selective Harmonic Elimination in Asymmetric Cascaded Multilevel Inverters Using a New Low-frequency Strategy for Photovoltaic Applications

DEFF Research Database (Denmark)

Dowlatabadi, Mohammadkazem Bakhshizadeh; Iman-Eini, Hossein; Blaabjerg, Frede

2015-01-01

Asymmetric multilevel inverters with a main and auxiliary power circuit can yield maximum number of voltage levels against the number of semiconductor devices. Most of the output power will be produced by the main inverter, which works at low frequency and the auxiliary inverters only improve the...

Synthesis and in vivo evaluation of 201Tl(III)-DOTA complexes for applications in SPECT imaging

NARCIS (Netherlands)

Hijnen, N.M.; Vries, de A.; Blange, R.; Burdinski, D.; Grüll, H.

2010-01-01

Introduction The aim of this study was to assess the use of 201thallium3+ (201Tl3+) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N¿,N'¿ tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with 201Tl3+ were

Comparative study of 201Tl reinjection tomography and combined use of 13N-ammonia and 18F-fluorodeoxyglucose positron emission tomography for detection of viable myocardium

International Nuclear Information System (INIS)

Wang Lijuan; Qi Guoxian; Hu Jian

2001-01-01

Objective: To compare the clinical value of 201 Tl reinjection tomography and combined use of 13 N-ammonia (NH 3 ) regional myocardial perfusion and 18 F-fluorodeoxyglucose (FDG) positron emission tomography transfer function and for the myocardium. Methods: The authors performed exercise 201 Tl SPECT (Tl SPECT) on 20 patients with myocardial infarction and obtained standard 201 Tl exercise-redistribution images. 201 Tl was reinjected immediately after redistribution study, and the images were then acquired as also. The 20 patients also underwent PET imaging with 13 N-NH 3 and 18 F-FDG (NH 3 -FDG PET) within one week of the above study. Vertical and horizontal long axis cuts were divided into nine segments, and uptakes of radioisotope were evaluated into four classes visually (Defect score, DS) (0:normal uptake, 3:severely reduced). Quantitative evaluation was performed on the vertical and horizontal long axis cuts of 201 Tl redistribution, reinjection and FDG PET images using regions of interest. The relative myocardial 201 Tl uptake and 18 F-FDG uptake (% ID) were expressed as the percentage of this reference region accounted for of the maximal counts. Results: In 48 segments identified as viable by the NH 3 -FDG PET images, 45 (93.8%) segments were also identified as viable by the 201 Tl redistribution imaging. Of 24 segments with severe irreversible defects on the 201 Tl redistribution imaging, 87.5% of the segments were concordantly confirmed by 201 Tl reinjection and NH 3 -FDG PET images with 37.5% identified as viable and 50% identified as scar. There was no significant difference in the average % ID, furthermore, regression analysis revealed a high positive correlation in the segmental % ID between 201 Tl reinjection and FDG PET images in the 61 segments with myocardial infarction (r = 0.722). Conclusions: The results show that 201 Tl reinjection tomography is of similar accuracy with NH 3 -FDG PET for detection of viable myocardium and possess important

Procedures of ASME code case N-201 for KALIMER. Reactor internal structures

International Nuclear Information System (INIS)

Koo, Gyeong Hoi; Yoo, B.

2001-02-01

The main objective of this report is to describe the design procedure of ASME Boiler and Pressure Vessel Code, Code Case N-201-4, which is an elevated temperature structural design code of the Nuclear reactor internal structures, checking the criteria of stress limit, accumulated inelastic strain and deformation, creep-fatigue damage, and buckling limit. As one of examples, the creep-fatigue damage evaluations are carried out for the KALIMER reactor internal structures of baffle annulus. This report is expected to be very useful in evaluating the structural integrity of the liquid metal reactor operating under an elevated temperature

A Comparison Study of Sinusoidal PWM and Space Vector PWM Techniques for Voltage Source Inverter

Directory of Open Access Journals (Sweden)

Ömer Türksoy

2017-06-01

Full Text Available In this paper, the methods used to control voltage source inverters which have been intensively investigated in recent years are compared. Although the most efficient result is obtained with the least number of switching elements in the inverter topologies, the method used in the switching is at least as effective as the topology. Besides, the selected switching method to control the inverter will play an effective role in suppressing harmonic components while producing the ideal output voltage. There are many derivatives of pulse width modulation techniques that are commonly used to control voltage source inverters. Some of widespread methods are sinusoidal pulse width modulation and space vector pulse width modulation techniques. These modulation techniques used for generating variable frequency and amplitude output voltage in voltage source inverters, have been simulated by using MATLAB/SIMULINK. And, the total harmonic distortions of the output voltages are compared. As a result of simulation studies, sinusoidal pulse width modulation has been found to have more total harmonic distortion in output voltages of voltage source inverters in the simulation. Space vector pulse width modulation has been shown to produce a more efficient output voltage with less total harmonic distortion.

Simulation of push-pull inverter using wide bandgap devices

Science.gov (United States)

Al-badri, Mustafa; Matin, Mohammed A.

2016-09-01

This paper discusses the use of wide bandgap devices (SiC-MOSFET) in the design of a push-pull inverter which provides inexpensive low power dc-ac inverters. The parameters used were 1200V SiC MOSFET(C2M0040120D) made by power company ROHM. This modeling was created using parameters that were provided from a device datasheet. The spice model is provided by this company to study the effect of adding this component on push-pull inverter ordinary circuit and compared results between SiC MOSFET and silicon MOSFET (IRFP260M). The results focused on Vout and Vmos stability as well as on output power and MOSFET power loss because it is a very crucial aspect on DC-AC inverter design. These results are done using the National Instrument simulation program (Multisim 14). It was found that power loss is better in the 12 and 15 vdc inverter. The Vout in the SIC MOSFET circuit shows more stability in the high current low resistance load in comparison to the Silicon MOSFET circuit and this will improve the overall performance of the circuit.

Studies on the preparation of thallium-201 by irradiating mercury with protons using extraction chromatography technique to separate thallium from mercury

International Nuclear Information System (INIS)

Fernandes, L.

1990-01-01

Radionuclide sup(201)Tl is used in Nuclear Medicine to identify myocardial ischemia or myocardial infarct. It is a cyclotron-produced radioisotope, obtained indirectly from the decay of sup(202)Pb or directly by irradiating mercury with deuterons or protons. The usual technique to prepare sup(201)Tl makes use of the nuclear reaction: sup(203)(p,3n) → sup(201)Tl, which requires proton energy of around 28 MeV. Due to the limited proton energy of IPEN'S CV-28 cyclotron, studies on the irradiating conditions of natural mercury oxide pellets and drops of natural mercury metal were made in the range of 19 - 24 MeV. At the end of the bombardment of a 6 MeV thickness target of natural mercury metal with 19 MeV protons around 10 MBq sup(201)Tl/μ A h was obtained. (author)

Addressable Inverter Matrix Tests Integrated-Circuit Wafer

Science.gov (United States)

Buehler, Martin G.

1988-01-01

Addressing elements indirectly through shift register reduces number of test probes. With aid of new technique, complex test structure on silicon wafer tested with relatively small number of test probes. Conserves silicon area by reduction of area devoted to pads. Allows thorough evaluation of test structure characteristics and of manufacturing process parameters. Test structure consists of shift register and matrix of inverter/transmission-gate cells connected to two-by-ten array of probe pads. Entire pattern contained in square area having only 1.6-millimeter sides. Shift register is conventional static CMOS device using inverters and transmission gates in master/slave D flip-flop configuration.

Origin-Dependent Inverted-Repeat Amplification: Tests of a Model for Inverted DNA Amplification.

Directory of Open Access Journals (Sweden)

Bonita J Brewer

2015-12-01

Full Text Available DNA replication errors are a major driver of evolution--from single nucleotide polymorphisms to large-scale copy number variations (CNVs. Here we test a specific replication-based model to explain the generation of interstitial, inverted triplications. While no genetic information is lost, the novel inversion junctions and increased copy number of the included sequences create the potential for adaptive phenotypes. The model--Origin-Dependent Inverted-Repeat Amplification (ODIRA-proposes that a replication error at pre-existing short, interrupted, inverted repeats in genomic sequences generates an extrachromosomal, inverted dimeric, autonomously replicating intermediate; subsequent genomic integration of the dimer yields this class of CNV without loss of distal chromosomal sequences. We used a combination of in vitro and in vivo approaches to test the feasibility of the proposed replication error and its downstream consequences on chromosome structure in the yeast Saccharomyces cerevisiae. We show that the proposed replication error-the ligation of leading and lagging nascent strands to create "closed" forks-can occur in vitro at short, interrupted inverted repeats. The removal of molecules with two closed forks results in a hairpin-capped linear duplex that we show replicates in vivo to create an inverted, dimeric plasmid that subsequently integrates into the genome by homologous recombination, creating an inverted triplication. While other models have been proposed to explain inverted triplications and their derivatives, our model can also explain the generation of human, de novo, inverted amplicons that have a 2:1 mixture of sequences from both homologues of a single parent--a feature readily explained by a plasmid intermediate that arises from one homologue and integrates into the other homologue prior to meiosis. Our tests of key features of ODIRA lend support to this mechanism and suggest further avenues of enquiry to unravel the origins

Origin-Dependent Inverted-Repeat Amplification: Tests of a Model for Inverted DNA Amplification.

Science.gov (United States)

Brewer, Bonita J; Payen, Celia; Di Rienzi, Sara C; Higgins, Megan M; Ong, Giang; Dunham, Maitreya J; Raghuraman, M K

2015-12-01

DNA replication errors are a major driver of evolution--from single nucleotide polymorphisms to large-scale copy number variations (CNVs). Here we test a specific replication-based model to explain the generation of interstitial, inverted triplications. While no genetic information is lost, the novel inversion junctions and increased copy number of the included sequences create the potential for adaptive phenotypes. The model--Origin-Dependent Inverted-Repeat Amplification (ODIRA)-proposes that a replication error at pre-existing short, interrupted, inverted repeats in genomic sequences generates an extrachromosomal, inverted dimeric, autonomously replicating intermediate; subsequent genomic integration of the dimer yields this class of CNV without loss of distal chromosomal sequences. We used a combination of in vitro and in vivo approaches to test the feasibility of the proposed replication error and its downstream consequences on chromosome structure in the yeast Saccharomyces cerevisiae. We show that the proposed replication error-the ligation of leading and lagging nascent strands to create "closed" forks-can occur in vitro at short, interrupted inverted repeats. The removal of molecules with two closed forks results in a hairpin-capped linear duplex that we show replicates in vivo to create an inverted, dimeric plasmid that subsequently integrates into the genome by homologous recombination, creating an inverted triplication. While other models have been proposed to explain inverted triplications and their derivatives, our model can also explain the generation of human, de novo, inverted amplicons that have a 2:1 mixture of sequences from both homologues of a single parent--a feature readily explained by a plasmid intermediate that arises from one homologue and integrates into the other homologue prior to meiosis. Our tests of key features of ODIRA lend support to this mechanism and suggest further avenues of enquiry to unravel the origins of interstitial

Fault-tolerant three-level inverter

Science.gov (United States)

Edwards, John; Xu, Longya; Bhargava, Brij B.

2006-12-05

A method for driving a neutral point clamped three-level inverter is provided. In one exemplary embodiment, DC current is received at a neutral point-clamped three-level inverter. The inverter has a plurality of nodes including first, second and third output nodes. The inverter also has a plurality of switches. Faults are checked for in the inverter and predetermined switches are automatically activated responsive to a detected fault such that three-phase electrical power is provided at the output nodes.

Probabilistic n-normed spaces, D-n-compact sets and D-n-bounded sets

International Nuclear Information System (INIS)

Pourmoslemi, A.; Salimi, M.

2009-01-01

In this paper, first we define and study the probabilistic n-normed spaces and D-n-compactness, also we prove some theorems and inequalities. In the next section we define D-n-boundedness and prove some results in relation between D-n-compact and D-n-bounded sets in these spaces.

Analisis Harmonisa Inverter PWM Satu Fasa

OpenAIRE

Rejeki Simanjorang

2008-01-01

Pada tesis ini dianalisis harmonisa inverter PWM satu fasa. Inverter PWM satu fasa yang akan ditinjau adalah inverter satu fasa jembatan penuh (konvensional) dan inverter komposit. Analisis difokuskan pada penentuan pola penyaklaran yang optimum agar pembangkitan harmonisa dan switching losses inverter rendah. Untuk menentukan pola penyaklaran optimum maka dilakukan analisis yang berbasis pada rangkaian ekivalen harmonisa inverter satu fasa. Dengan menggunakan pola penyaklaran optimum, kedua ...

2015 Inverter Workshop | Photovoltaic Research | NREL

Science.gov (United States)

Inverter Workshop 2015 Inverter Workshop Wednesday, February 25, 2015 Chair: Jack Flicker In about inverters. This workshop represented a follow-on to the inverter workshops that Sandia National conversations between module and inverter experts. Agenda For a detailed schedule of the day's events, access

Quenching mechanism of exciplex fluorescence by inverted micelles

International Nuclear Information System (INIS)

Sato, Chika; Kikuchi, Koichi

1992-01-01

Using an emission-absorption laser photolysis method, the quenching mechanism of the pyrene-N,N-dimethylaniline exciplex fluorscence by inverted micelles is studied. The rate of enhanced intersystem crossing depends upon water pool size and is reduced by external magnetic fields. 15 refs., 3 figs., 2 tabs

Updating of ASME Nuclear Code Case N-201 to Accommodate the Needs of Metallic Core Support Structures for High Temperature Gas Cooled Reactors Currently in Development

International Nuclear Information System (INIS)

Basol, Mit; Kielb, John F.; MuHooly, John F.; Smit, Kobus

2007-01-01

On September 29, 2005, ASME Standards Technology, LLC (ASME ST-LLC) executed a multi-year, cooperative agreement with the United States DOE for the Generation IV Reactor Materials project. The project's objective is to update and expand appropriate materials, construction, and design codes for application in future Generation IV nuclear reactor systems that operate at elevated temperatures. Task 4 was embarked upon in recognition of the large quantity of ongoing reactor designs utilizing high temperature technology. Since Code Case N-201 had not seen a significant revision (except for a minor revision in September, 2006 to change the SA-336 forging reference for 304SS and 316SS to SA-965 in Tables 1.2(a) and 1.2(b), and some minor editorial changes) since December 1994, identifying recommended updates to support the current high temperature Core Support Structure (CSS) designs and potential new designs was important. As anticipated, the Task 4 effort identified a number of Code Case N-201 issues. Items requiring further consideration range from addressing apparent inconsistencies in definitions and certain material properties between CC-N-201 and Subsection NH, to inclusion of additional materials to provide the designer more flexibility of design. Task 4 developed a design parameter survey that requested input from the CSS designers of ongoing high temperature gas cooled reactor metallic core support designs. The responses to the survey provided Task 4 valuable input to identify the design operating parameters and future needs of the CSS designers. Types of materials, metal temperature, time of exposure, design pressure, design life, and fluence levels were included in the Task 4 survey responses. The results of the survey are included in this report. This research proves that additional work must be done to update Code Case N-201. Task 4 activities provide the framework for the Code Case N-201 update and future work to provide input on materials. Candidate

Factorization method and new potentials from the inverted oscillator

International Nuclear Information System (INIS)

Bermudez, David; Fernández C, David J.

2013-01-01

In this article we will apply the first- and second-order supersymmetric quantum mechanics to obtain new exactly-solvable real potentials departing from the inverted oscillator potential. This system has some special properties; in particular, only very specific second-order transformations produce non-singular real potentials. It will be shown that these transformations turn out to be the so-called complex ones. Moreover, we will study the factorization method applied to the inverted oscillator and the algebraic structure of the new Hamiltonians. -- Highlights: •We apply supersymmetric quantum mechanics to the inverted oscillator potential. •The complex second-order transformations allow us to build new non-singular potentials. •The algebraic structure of the initial and final potentials is analyzed. •The initial potential is described by a complex-deformed Heisenberg–Weyl algebra. •The final potentials are described by polynomial Heisenberg algebras

Milliwatt dc/dc Inverter

Science.gov (United States)

Mclyman, C. W.

1983-01-01

Compact dc/dc inverter uses single integrated-circuit package containing six inverter gates that generate and amplify 100-kHz square-wave switching signal. Square-wave switching inverts 10-volt local power to isolated voltage at another desired level. Relatively high operating frequency reduces size of filter capacitors required, resulting in small package unit.

A novel circuit topology of modified switched boost hybrid resonant inverter fitted induction heating equipment

Directory of Open Access Journals (Sweden)

Bhattacharya Ananyo

2016-12-01

Full Text Available A novel circuit topology of modified switched boost high frequency hybrid resonant inverter fitted induction heating equipment is presented in this paper for efficient induction heating. Recently, induction heating technique is becoming very popular for both domestic and industrial purposes because of its high energy efficiency and controllability. Generally in induction heating, a high frequency alternating magnetic field is required to induce the eddy currents in the work piece. High frequency resonant inverters are incorporated in induction heating equipment which produce a high frequency alternating magnetic field surrounding the coil. Previously this high frequency alternating magnetic field was produced by voltage source inverters. But VSIs have several demerits. So, in this paper, a new scheme of modified switched boost high frequency hybrid resonant inverter fitted induction heating equipment has been depicted which enhances the energy efficiency and controllability and the same is validated by PSIM.

Motion Analysis Based on Invertible Rapid Transform

Directory of Open Access Journals (Sweden)

J. Turan

1999-06-01

Full Text Available This paper presents the results of a study on the use of invertible rapid transform (IRT for the motion estimation in a sequence of images. Motion estimation algorithms based on the analysis of the matrix of states (produced in the IRT calculation are described. The new method was used experimentally to estimate crowd and traffic motion from the image data sequences captured at railway stations and at high ways in large cities. The motion vectors may be used to devise a polar plot (showing velocity magnitude and direction for moving objects where the dominant motion tendency can be seen. The experimental results of comparison of the new motion estimation methods with other well known block matching methods (full search, 2D-log, method based on conventional (cross correlation (CC function or phase correlation (PC function for application of crowd motion estimation are also presented.

Overload protection system for power inverter

Science.gov (United States)

Nagano, S. (Inventor)

1977-01-01

An overload protection system for a power inverter utilized a first circuit for monitoring current to the load from the power inverter to detect an overload and a control circuit to shut off the power inverter, when an overload condition was detected. At the same time, a monitoring current inverter was turned on to deliver current to the load at a very low power level. A second circuit monitored current to the load, from the monitoring current inverter, to hold the power inverter off through the control circuit, until the overload condition was cleared so that the control circuit may be deactivated in order for the power inverter to be restored after the monitoring current inverter is turned off completely.

Large-Signal Lyapunov-Based Stability Analysis of DC/AC Inverters and Inverter-Based Microgrids

Science.gov (United States)

Kabalan, Mahmoud

study. This will enable future studies to save computational effort and produce the most accurate results according to the needs of the study being performed. Moreover, the effect of grid (line) impedance on the accuracy of droop control is explored using the 5th order model. Simulation results show that traditional droop control is valid up to R/X line impedance value of 2. Furthermore, the 3rd order nonlinear model improves the currently available inverter-infinite bus models by accounting for grid impedance, active power-frequency droop and reactive power-voltage droop. Results show the 3rd order model's ability to account for voltage and reactive power changes during a transient event. Finally, the large-signal Lyapunov-based stability analysis is completed for a 3 bus microgrid system (made up of 2 inverters and 1 linear load). The thesis provides a systematic state space large-signal nonlinear mathematical modeling method of inverter-based microgrids. The inverters include the dc-side dynamics associated with dc sources. The mathematical model is then used to estimate the domain of asymptotic stability of the 3 bus microgrid. The three bus microgrid system was used as a case study to highlight the design and optimization capability of a large-signal-based approach. The study explores the effect of system component sizing, load transient and generation variations on the asymptotic stability of the microgrid. Essentially, this advancement gives microgrid designers and engineers the ability to manipulate the domain of asymptotic stability depending on performance requirements. Especially important, this research was able to couple the domain of asymptotic stability of the ac microgrid with that of the dc side voltage source. Time domain simulations were used to demonstrate the mathematical nonlinear analysis results.

Alternative strategy for converting an inverting glycoside hydrolase into a glycosynthase.

Science.gov (United States)

Honda, Yuji; Fushinobu, Shinya; Hidaka, Masafumi; Wakagi, Takayoshi; Shoun, Hirofumi; Taniguchi, Hajime; Kitaoka, Motomitsu

2008-04-01

The tyrosine residue Y198 is known to support a nucleophilic water molecule with the general base residue, D263, in the reducing-end xylose-releasing exo-oligoxylanase (Rex). A mutation in the tyrosine residue changing it into phenylalanine caused a drastic decrease in the hydrolytic activity and a small increase in the F(-) releasing activity from alpha-xylobiosyl fluoride in the presence of xylose. In contrast, mutations at D263 resulted in the decreased F(-) releasing activity. As a result of the high F(-) releasing activity and low hydrolytic activity, Y198F of Rex accumulates a large amount of product during the glycosynthase reaction. We propose a novel method for producing a glycosynthase from an inverting glycoside hydrolase by mutating a residue that holds the nucleophilic water molecule with the general base residue while keeping the general base residue intact.

Complementary analyses on the local polarity in lateral polarity-inverted GaN heterostructure on sapphire (0001) substrate

International Nuclear Information System (INIS)

Katayama, Ryuji; Kuge, Yoshihiro; Onabe, Kentaro; Matsushita, Tomonori; Kondo, Takashi

2006-01-01

The fabrication of the lateral polarity-inverted GaN heterostructure on sapphire (0001) using a radio-frequency-plasma-enhanced molecular beam epitaxy is demonstrated. Its microscopic properties such as surface potentials, piezoelectric polarizations, and residual carrier densities were investigated by Kelvin force microscopy and micro-Raman scattering. The inversion from Ga polarity to N polarity in a specific domain and its higher crystal perfection had been unambiguously confirmed by these complementary analyses. The results were also fairly consistent with that of KOH etching, which suggests the applicability of these processes to the fabrication of photonic nanostructures

48 CFR 201.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Statutory acquisition-related dollar thresholds-adjustment for inflation. 201.109 Section 201.109 Federal Acquisition...-adjustment for inflation. (d) A matrix showing the most recent escalation adjustments of statutory...

Hybrid PV/wind system with quinary asymmetric inverter without increasing DC-link number

Directory of Open Access Journals (Sweden)

Aida Baghbany Oskouei

2016-06-01

Full Text Available This paper suggests quinary asymmetric inverter with coupled inductors and transformer, and uses it in hybrid system including photovoltaic (PV and wind. This inverter produces twenty-five-level voltage in addition to merits of multilevel inverter, has only one DC source. Then, it is adequate for hybrid systems, which prevents increasing DC-link and makes control of system easy. Proposed structure also provides isolation in the system and the switch numbers are reduced in this topology compared with other multilevel structures. In this system, battery is used as backup, where PV and wind have complementary nature. The performance of proposed inverter and hybrid system is validated with simulation results using MATLAB/SIMULINK software and experimental results based PCI-1716 data acquisition system.

Three-Phase Cascaded Multilevel Inverter Using Power Cells With Two Inverter Legs in Series

NARCIS (Netherlands)

Waltrich, G.; Barbi, I.

2010-01-01

In this paper, a modular three-phase multilevel inverter specially suited for electrical drive applications is proposed. Unlike the cascaded H-bridge inverter, this topology is based on power cells connected in cascade using two inverter legs in series. A detailed analysis of the structure and the

Role of Dopamine Receptors in the Anticancer Activity of ONC201.

Science.gov (United States)

Kline, Christina Leah B; Ralff, Marie D; Lulla, Amriti R; Wagner, Jessica M; Abbosh, Phillip H; Dicker, David T; Allen, Joshua E; El-Deiry, Wafik S

2018-01-01

ONC201/TIC10 is a first-in-class small molecule inducer of TRAIL that causes early activation of the integrated stress response. Its promising safety profile and broad-spectrum efficacy in vitro have been confirmed in Phase I/II trials in several advanced malignancies. Binding and reporter assays have shown that ONC201 is a selective antagonist of the dopamine D2-like receptors, specifically, DRD2 and DRD3. We hypothesized that ONC201's interaction with DRD2 plays a role in ONC201's anticancer effects. Using cBioportal and quantitative reverse-transcription polymerase chain reaction analyses, we confirmed that DRD2 is expressed in different cancer cell types in a cell type-specific manner. On the other hand, DRD3 was generally not detectable. Overexpressing DRD2 in cells with low DRD2 levels increased ONC201-induced PARP cleavage, which was preceded and correlated with an increase in ONC201-induced CHOP mRNA expression. On the other hand, knocking out DRD2 using CRISPR/Cas9 in three cancer cell lines was not sufficient to abrogate ONC201's anticancer effects. Although ONC201's anticancer activity was not dependent on DRD2 expression in the cancer cell types tested, we assessed the cytotoxic potential of DRD2 blockade. Transient DRD2 knockdown in HCT116 cells activated the integrated stress response and reduced cell number. Pharmacological antagonism of DRD2 significantly reduced cell viability. Thus, we demonstrate in this study that disrupting dopamine receptor expression and activity can have cytotoxic effects that may at least be in part due to the activation of the integrated stress response. On the other hand, ONC201's anticancer activity goes beyond its ability to antagonize DRD2, potentially due to ONC201's ability to activate other pathways that are independent of DRD2. Nevertheless, blocking the dopamine D1-like receptor DRD5 via siRNA or the use of a pharmacological antagonist promoted ONC201-induced anticancer activity. Copyright © 2018 The Authors

Role of Dopamine Receptors in the Anticancer Activity of ONC201

Directory of Open Access Journals (Sweden)

Christina Leah B. Kline

2018-01-01

Full Text Available ONC201/TIC10 is a first-in-class small molecule inducer of TRAIL that causes early activation of the integrated stress response. Its promising safety profile and broad-spectrum efficacy in vitro have been confirmed in Phase I/II trials in several advanced malignancies. Binding and reporter assays have shown that ONC201 is a selective antagonist of the dopamine D2-like receptors, specifically, DRD2 and DRD3. We hypothesized that ONC201’s interaction with DRD2 plays a role in ONC201’s anticancer effects. Using cBioportal and quantitative reverse-transcription polymerase chain reaction analyses, we confirmed that DRD2 is expressed in different cancer cell types in a cell type–specific manner. On the other hand, DRD3 was generally not detectable. Overexpressing DRD2 in cells with low DRD2 levels increased ONC201-induced PARP cleavage, which was preceded and correlated with an increase in ONC201-induced CHOP mRNA expression. On the other hand, knocking out DRD2 using CRISPR/Cas9 in three cancer cell lines was not sufficient to abrogate ONC201’s anticancer effects. Although ONC201’s anticancer activity was not dependent on DRD2 expression in the cancer cell types tested, we assessed the cytotoxic potential of DRD2 blockade. Transient DRD2 knockdown in HCT116 cells activated the integrated stress response and reduced cell number. Pharmacological antagonism of DRD2 significantly reduced cell viability. Thus, we demonstrate in this study that disrupting dopamine receptor expression and activity can have cytotoxic effects that may at least be in part due to the activation of the integrated stress response. On the other hand, ONC201’s anticancer activity goes beyond its ability to antagonize DRD2, potentially due to ONC201’s ability to activate other pathways that are independent of DRD2. Nevertheless, blocking the dopamine D1-like receptor DRD5 via siRNA or the use of a pharmacological antagonist promoted ONC201-induced anticancer activity.

Validation of the A&D UM-201 device for office blood pressure measurement according to the European Society of Hypertension International Protocol Revision 2010.

Science.gov (United States)

Fania, Claudio; Albertini, Federica; Palatini, Paolo

2017-08-01

The aim of this study was to determine the accuracy of the A&D UM-201 device coupled to several cuffs for different arm sizes for office blood pressure (BP) measurement according to the International Protocol of the European Society of Hypertension. Evaluation was carried out in 33 individuals. The mean age of the individuals was 59.3±13.2 years, systolic BP was 145.4±20.6 mmHg (range: 109-186 mmHg), diastolic BP was 87.3±18.0 mmHg (range: 50-124 mmHg), and arm circumference was 30.4±4.2 cm (range: 23-39 cm). The protocol requirements were followed precisely. The UM-201 monitor passed all requirements, fulfilling the standards of the protocol. On average, the device overestimated systolic BP by 3.0±2.1 mmHg and diastolic BP by 2.6±2.0 mmHg. These data show that the A&D UM-201 device coupled to several cuffs for different ranges of arm circumference fulfilled the requirements for validation by the International Protocol and can be recommended for clinical use in the adult population.

Identification of residues important for the activity of Haloferax volcanii AglD, a component of the archaeal N-glycosylation pathway.

Science.gov (United States)

Kaminski, Lina; Eichler, Jerry

2010-05-06

In Haloferax volcanii, AglD adds the final hexose to the N-linked pentasaccharide decorating the S-layer glycoprotein. Not knowing the natural substrate of the glycosyltransferase, together with the challenge of designing assays compatible with hypersalinity, has frustrated efforts at biochemical characterization of AglD activity. To circumvent these obstacles, an in vivo assay designed to identify amino acid residues important for AglD activity is described. In the assay, restoration of AglD function in an Hfx. volcanii aglD deletion strain transformed to express plasmid-encoded versions of AglD, generated through site-directed mutagenesis at positions encoding residues conserved in archaeal homologues of AglD, is reflected in the behavior of a readily detectable reporter of N-glycosylation. As such Asp110 and Asp112 were designated as elements of the DXD motif of AglD, a motif that interacts with metal cations associated with nucleotide-activated sugar donors, while Asp201 was predicted to be the catalytic base of the enzyme.

Γ-source Neutral Point Clamped Inverter

DEFF Research Database (Denmark)

Mo, Wei; Loh, Poh Chiang; Blaabjerg, Frede

Transformer based Z-source inverters are recently proposed to achieve promising buck-boost capability. They have improved higher buck-boost capability, smaller size and less components count over Z-source inverters. On the other hand, neutral point clamped inverters have less switching stress...... and better output performance comparing with traditional two-level inverters. Integrating these two types of configurations can help neutral point inverters achieve enhanced votlage buck-boost capability....

48 CFR 2419.201 - General policy.

Science.gov (United States)

2010-10-01

...-owned small businesses. (d) Each head of a contracting activity shall designate a small business...; (6) Advise such businesses with respect to the financial assistance available under existing laws and... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 2419.201 General policy. (c) The Director, Office of...

Estudio teórico y experimental sobre los morteros para muros resistentes de fábrica de ladrillo para la actualización de la Norma Básica MV 201-1972

Directory of Open Access Journals (Sweden)

Monterde Comba, Guillermo J.

1984-12-01

Full Text Available This theoretical and experimental study on cement or lime and cement mortars brings up to date the contents of Chapter 3: MORTARS, of Norm MV 201-1972 "Resistant brick-work walls" which lost its validity when disappeared portland cement P-250, substituted by portland cement PA-350 with active additions, prescribed in the new Standard RC-75 "Standard of general technical prescriptions for cements acceptance" being obligatory its fulfilment.

El presente estudio teórico y experimental sobre morteros, de cemento o de cal y cemento, constituye la puesta al día del contenido del Capítulo 3º MORTEROS, de la Norma MV 201-1972 "Muros resistentes de fábrica de ladrillo'', que perdió su vigencia con la desaparición del cemento portland P-250, sustituido por el cemento portland PA-350 con adiciones activas prescrito en el nuevo Pliego RC-75 "Pliego de prescripciones técnicas generales para la recepción de cementos" de obligado cumplimiento.

Simultaneous Tc-99m/Tl-201 imaging using energy-based estimation of the spatial distributions of contaminant photons

International Nuclear Information System (INIS)

Moore, S.C.; Tow, D.E.; English, R.J.; Syravanh, C.; Zimmerman, R.E.; Chan, K.H.; Kijewski, M.F.; Brigham and Women's Hospital, Boston, MA

1995-01-01

The advantages of simultaneous acquisition of TC-99m and Tl-201 myocardial perfusion SPECT images can be fully realized only if the effects of the Tc-99m agent can be accurately removed from the Tl-201 image. The authors and others have previously reported simultaneous dual-isotope techniques for cardiac studies which make use of a third energy-window to estimate the Tc-99m scatter to be subtracted from the Tl-201 window. The authors have recently demonstrated, however, using a Monte Carlo program which simulates all details of the photon transport, that lead x-rays produced in the collimator may also contribute significantly to contamination in the Tl-201 window. The spatial distribution of the Tc-99m scattered photons differs from that of the lead x-rays. Therefore, the authors modified their correction technique so that, at each projection angle, the contaminant image to be subtracted from the image in the Tl-201 window was estimated as a linear combination of a scatter-window (90--110 keV) image, blurred by a 2D Gaussian filter, and the Tc-99m photopeak image, blurred by a different Gaussian filter. For simulated data which included 'liver' activity and non-uniform 'lung' attenuation, the improved dual-window subtraction technique provided a more accurate estimate of the true Tl-201 image, with less image noise, than did the single-window correction

SEEPAGE/INVERT INTERACTIONS

International Nuclear Information System (INIS)

P.S. Domski

2000-01-01

As directed by a written development plan (CRWMS M andO 1999a), a conceptual model for water entering the drift and reacting with the invert materials is to be developed. The purpose of this conceptual model is to assist Performance Assessment Operations (PAO) and its Engineered Barrier Performance Department in modeling the geochemical environment within a repository drift, thus allowing PAO to provide a more detailed and complete in-drift geochemical model abstraction, and to answer the key technical issues (KTI) raised in the NRC Issue Resolution Status Report (IRSR) for the Evolution of the Near-Field Environment (NFE), Revision 2 (NRC 1999). This AMR also seeks to: (1) Develop a logical conceptual model for physical/chemical interactions between seepage and the invert materials; (2) screen potential processes and reactions that may occur between seepage and invert to evaluate the potential consequences of the interactions; and (3) outline how seepage/invert processes may be quantified. This document provides the conceptual framework for screening out insignificant processes and for identifying and evaluating those seepage/invert interactions that have the potential to be important to subsequent PAO analyses including the Engineered Barrier System (EBS) physical and chemical model abstraction effort. This model has been developed to serve as a basis for the in-drift geochemical analyses performed by PAO. Additionally, the concepts discussed within this report may also apply to certain near and far-field geochemical processes and may have conceptual application within the unsaturated zone (UZ) and saturated zone (SZ) transport modeling efforts. The seepage/invert interactions will not directly affect any principal factors

Silicon controlled rectifier polyphase bridge inverter commutated with gate-turn-off thyristor

Science.gov (United States)

Edwards, Dean B. (Inventor); Rippel, Wally E. (Inventor)

1986-01-01

A polyphase SCR inverter (10) having N switching poles, each comprised of two SCR switches (1A, 1B; 2A, 2B . . . NA, NB) and two diodes (D1B; D1B; D2A, D2B . . . DNA, DNB) in series opposition with saturable reactors (L1A, L1B; L2A, L2B . . . LNA, LNB) connecting the junctions between the SCR switches and diodes to an output terminal (1, 2 . . . 3) is commutated with only one GTO thyristor (16) connected between the common negative terminal of a dc source and a tap of a series inductor (14) connected to the positive terminal of the dc source. A clamp winding (22) and diode (24) are provided, as is a snubber (18) which may have its capacitance (c) sized for maximum load current divided into a plurality of capacitors (C.sub.1, C.sub.2 . . . C.sub.N), each in series with an SCR switch S.sub.1, S.sub.2 . . . S.sub.N). The total capacitance may be selected by activating selected switches as a function of load current. A resistor 28 and SCR switch 26 shunt reverse current when the load acts as a generator, such as a motor while braking.

Crystal structure of the enzyme-product complex reveals sugar ring distortion during catalysis by family 63 inverting α-glycosidase.

Science.gov (United States)

Miyazaki, Takatsugu; Nishikawa, Atsushi; Tonozuka, Takashi

2016-12-01

Glycoside hydrolases are divided into two groups, known as inverting and retaining enzymes, based on their hydrolytic mechanisms. Glycoside hydrolase family 63 (GH63) is composed of inverting α-glycosidases, which act mainly on α-glucosides. We previously found that Escherichia coli GH63 enzyme, YgjK, can hydrolyze 2-O-α-d-glucosyl-d-galactose. Two constructed glycosynthase mutants, D324N and E727A, which catalyze the transfer of a β-glucosyl fluoride donor to galactose, lactose, and melibiose. Here, we determined the crystal structures of D324N and E727A soaked with a mixture of glucose and lactose at 1.8- and 2.1-Å resolutions, respectively. Because glucose and lactose molecules are found at the active sites in both structures, it is possible that these structures mimic the enzyme-product complex of YgjK. A glucose molecule found at subsite -1 in both structures adopts an unusual 1 S 3 skew-boat conformation. Comparison between these structures and the previously determined enzyme-substrate complex structure reveals that the glucose pyranose ring might be distorted immediately after nucleophilic attack by a water molecule. These structures represent the first enzyme-product complex for the GH63 family, as well as the structurally-related glycosidases, and it may provide insight into the catalytic mechanism of these enzymes. Copyright © 2016 Elsevier Inc. All rights reserved.

Shootthrough fault protection system for bipolar transistors in a voltage source transistor inverter

International Nuclear Information System (INIS)

Wirth, W.F.

1982-01-01

Faulted bipolar transistors in a voltage source transistor inverter are protected against shootthrough fault current, from the filter capacitor of the d-c voltage source which drives the inverter over the d-c bus, by interposing a small choke in series with the filter capacitor to limit the rate of rise of that fault current while at the same time causing the d-c bus voltage to instantly drop to essentially zero volts at the beginning of a shootthrough fault. In this way, the load lines of the faulted transistors are effectively shaped so that they do not enter the second breakdown area, thereby preventing second breakdown destruction of the transistors

El tipo de cambio renminbi-dólar y su impacto sobre las exportaciones e Inversión Extranjera Directa en México

OpenAIRE

Vásquez Galán, Belem Iliana; Calderón Villarreal, Cuauhtémoc

2017-01-01

Resumen Este es un análisis del efecto que tiene una fluctuación del tipo de cambio renminbi-dólar sobre las exportaciones mexicanas dirigidas al mercado estadounidense y sobre la inversión extranjera directa procedente de ese país. Las estimaciones de un vector de corrección de error, con datos de 1995 a 2015, indican que una depreciación del renminbi reduce el crecimiento de las exportaciones mexicanas en 2.01 por ciento, pero no tiene efecto sobre la IED. Esto implica que, al ser competido...

Collision-induced absorption by D2 pairs in the first overtone band at 77, 201 and 298 K

International Nuclear Information System (INIS)

Abu-Kharma, M.; Gillard, P.G.; Reddy, S.P.

2006-01-01

Collision induced absorption (CIA) spectra of pure D 2 in the first overtone region from 5250 to 7250 cm -1 , recorded at 77, 201 and 298 K, have been analyzed. The observed spectra at 77, 201 and 298 K were modelled by a total of 92, 214 and 267 components respectively of double vibrational transitions at room temperature of the type X 2 (J) +X 0 (J) and X 1 (J) + X 1 (J), where X is O, Q or S transitions. Profile analyses of the spectra were carried out using the Birnbaum-Cohen line-shape function for the individual components of the band, and characteristic line shape parameters were determined from the analysis. The observed and calculated profiles agree well over the whole overtone band, and the agreement is better than 97% in the three cases studied. Binary and ternary absorption coefficients were determined from the integrated absorption of the band. (authors)

Inverter communications using output signal

Science.gov (United States)

Chapman, Patrick L.

2017-02-07

Technologies for communicating information from an inverter configured for the conversion of direct current (DC) power generated from an alternative source to alternating current (AC) power are disclosed. The technologies include determining information to be transmitted from the inverter over a power line cable connected to the inverter and controlling the operation of an output converter of the inverter as a function of the information to be transmitted to cause the output converter to generate an output waveform having the information modulated thereon.

24 CFR 100.201 - Definitions.

Science.gov (United States)

2010-04-01

... at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992... (incorporated by reference at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO... (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992 (incorporated by reference at § 100.201a), ANSI...

Thallium-201 infusion imaging

International Nuclear Information System (INIS)

Alazraki, N.; Kralios, A.; Wooten, W.W.

1988-01-01

To test the accuracy of Thallium-201 coronary artery infusion imaging of the earth during rapid changes in blood flow through a major coronary artery, the author performed a study in dogs correlating electromagnetic flow probe recordings with 201 Tl scintillation camera acquisitions. Hyperemic vascular response was produced experimentally in a major coronary artery by occlusion and release interventions which altered flow from baseline to zero during occlusion (20 seconds), followed by rapid flow increases approaching three times baseline immediately upon release of the occlusion. Flow returned to the baseline level within 60 seconds following release. Flow was also altered in a controlled fashion by other interventions. Recordings of Thallium uptake in the myocardium were displayed as a time histogram (counts per second squared vs time) which correlated very closely with electromagnetic flow probe recordings of flow (R=o.82-0.97). These experiments demonstrate a high degree of accuracy in Thallium infusion imaging to detect rapid changes in flow through a major coronary artery

Multilevel DC link inverter

Science.gov (United States)

Su, Gui-Jia

2003-06-10

A multilevel DC link inverter and method for improving torque response and current regulation in permanent magnet motors and switched reluctance motors having a low inductance includes a plurality of voltage controlled cells connected in series for applying a resulting dc voltage comprised of one or more incremental dc voltages. The cells are provided with switches for increasing the resulting applied dc voltage as speed and back EMF increase, while limiting the voltage that is applied to the commutation switches to perform PWM or dc voltage stepping functions, so as to limit current ripple in the stator windings below an acceptable level, typically 5%. Several embodiments are disclosed including inverters using IGBT's, inverters using thyristors. All of the inverters are operable in both motoring and regenerating modes.

Development of high-power inverter supply for current drive of FRC plasma

International Nuclear Information System (INIS)

Kitano, Katsuhisa; Higashikozono, Takamitsu; Okada, Shigefumi; Goto, Seiichi

2003-01-01

High-Power RF supply is developed for the current drive of FRC (Field Reversed Configuration) plasma. The rotating magnetic field is produced by the four antennas set in the parallel direction to the geometrical axis of the FRC and faced each other. The sinusoidal currents with shifted phases by 90 degree each other should be supplied to the antennas. The two power supplies are necessary if a pair of the antennas faced oppositely are connected. Considering the plasma parameters, the rotating field of 50-100kHz and 50G at the center axis is expected to be required. We develop the adequate RF power supply for the purpose. The power supply consists of the inverter circuit, the step-up transformer and the LC tank ciruit. For the switching device of the inverter circuit, the IGBT (Insulated Gate Bipolar Transistor) is adopted. The inverter circuit is full bridge type. To operate it at high voltages, its arm consists of the 3 IGBTs arranged series. The output of the inverter is connected to the tank circuit by way of the step-up transformer with air core. The tank circuit is the parallel circuit of the antenna and the capacitor. By the adjustment of the frequency of the inverter output to the resonance frequency of the tank circuit, the large sinusoidal waveform current is obtained. The developed power supply can produce the current of 5kA at 10kV to the dummy antenna with almost the same inductance of the antenna. (author)

Resonant snubber inverter

Science.gov (United States)

Lai, Jih-Sheng; Young, Sr., Robert W.; Chen, Daoshen; Scudiere, Matthew B.; Ott, Jr., George W.; White, Clifford P.; McKeever, John W.

1997-01-01

A resonant, snubber-based, soft switching, inverter circuit achieves lossless switching during dc-to-ac power conversion and power conditioning with minimum component count and size. Current is supplied to the resonant snubber branches solely by the main inverter switches. Component count and size are reduced by use of a single semiconductor switch in the resonant snubber branches. Component count is also reduced by maximizing the use of stray capacitances of the main switches as parallel resonant capacitors. Resonance charging and discharging of the parallel capacitances allows lossless, zero voltage switching. In one embodiment, circuit component size and count are minimized while achieving lossless, zero voltage switching within a three-phase inverter.

Mode tunable p-type Si nanowire transistor based zero drive load logic inverter.

Science.gov (United States)

Moon, Kyeong-Ju; Lee, Tae-Il; Lee, Sang-Hoon; Han, Young-Uk; Ham, Moon-Ho; Myoung, Jae-Min

2012-07-25

A design platform for a zero drive load logic inverter consisting of p-channel Si nanowire based transistors, which controlled their operating mode through an implantation into a gate dielectric layer was demonstrated. As a result, a nanowire based class D inverter having a 4.6 gain value at V(DD) of -20 V was successfully fabricated on a substrate.

Harmonic elimination in diode-clamped multilevel inverter using evolutionary algorithms

Energy Technology Data Exchange (ETDEWEB)

Barkati, Said [Laboratoire d' analyse des Signaux et Systemes (LASS), Universite de M' sila, BP. 166, rue Ichbilia 28000 M' sila (Algeria); Baghli, Lotfi [Groupe de Recherche en Electrotechnique et Electronique de Nancy (GREEN), CNRS UMR 7030, Universite Henri Poincare Nancy 1, BP. 239, 54506 Vandoeuvre-les-Nancy (France); Berkouk, El Madjid; Boucherit, Mohamed-Seghir [Laboratoire de Commande des Processus (LCP), Ecole Nationale Polytechnique, BP. 182, 10 Avenue Hassen Badi, 16200 El Harrach, Alger (Algeria)

2008-10-15

This paper describes two evolutionary algorithms for the optimized harmonic stepped-waveform technique. Genetic algorithms and particle swarm optimization are applied to compute the switching angles in a three-phase seven-level inverter to produce the required fundamental voltage while, at the same time, specified harmonics are eliminated. Furthermore, these algorithms are also used to solve the starting point problem of the Newton-Raphson conventional method. This combination provides a very effective method for the harmonic elimination technique. This strategy is useful for different structures of seven-level inverters. The diode-clamped topology is considered in this study. (author)

Next Generation Inverter

Energy Technology Data Exchange (ETDEWEB)

Zhao, Zilai [General Motors LLC, Detroit, MI (United States); Gough, Charles [General Motors LLC, Detroit, MI (United States)

2016-04-22

The goal of this Cooperative Agreement was the development of a Next Generation Inverter for General Motors’ electrified vehicles, including battery electric vehicles, range extended electric vehicles, plug-in hybrid electric vehicles and hybrid electric vehicles. The inverter is a critical electronics component that converts battery power (DC) to and from the electric power for the motor (AC).

Inverting the Linear Algebra Classroom

Science.gov (United States)

Talbert, Robert

2014-01-01

The inverted classroom is a course design model in which students' initial contact with new information takes place outside of class meetings, and students spend class time on high-level sense-making activities. The inverted classroom model is so called because it inverts or "flips" the usual classroom design where typically class…

Analysis of Extended Z-source Inverter for Photovoltaic System

Science.gov (United States)

Prakash, G.; Subramani, C.; Dhineshkumar, K.; Rayavel, P.

2018-04-01

The Z-source inverter has picked up prominence as a solitary stage buck-support inverter topology among numerous specialists. Notwithstanding, its boosting capacity could be constrained, and in this manner, it may not be reasonable for a few applications requiring high lift request of falling other dc-dc help converters. The Z-source inverter is a recent converter topology that exhibits both voltage-buck and voltage-boost capability This could lose the effectiveness and request all the more detecting for controlling the additional new stages. This paper is proposing another group of broadened help semi Z - source inverter (ZSI) to fill the exploration hole left in the improvement of ZSI. These new topologies can be worked with same regulation strategies that were produced for unique ZSI. Likewise, they have a similar number of dynamic switches as unique ZSI saving the single-organize nature of ZSI. Proposed topologies are dissected in the enduring state and their exhibitions are approved utilizing recreated comes about acquired in MATLAB/Simulink. Besides, they are tentatively approved with comes about acquired from a model created in the research facility. The trend of fast increase of the PV energy use is related to the increasing efficiency of solar cells as well as the improvements of manufacturing technology of solar panels.

48 CFR 1052.201-70 - Contracting Officer's Technical Representative (COTR) Designation and Authority.

Science.gov (United States)

2010-10-01

... in writing. The term “technical direction” includes, without limitation, direction to the contractor... the actions of the contractor's employees. (d) Technical direction may be oral or in writing. The COTR... Technical Representative (COTR) Designation and Authority. 1052.201-70 Section 1052.201-70 Federal...

Effects of dipyridamole-induced vasodilation on myocardial uptake and clearance kinetics of thallium-201

International Nuclear Information System (INIS)

Beller, G.A.; Holzgrefe, H.H.; Watson, D.D.

1983-01-01

Myocardial thallium-201 (201Tl) uptake and clearance after intravenous administration of dipyridamole (150 micrograms/kg) were determined in 12 open-chest anesthetized dogs with a partial coronary artery stenosis. 201Tl (1.5 mCi) was injected intravenously and myocardial biopsy specimens were obtained 10 min, 60 min, and 2 hr after injection. Serial changes in 201Tl activity in the normal zone and in the zone of partial stenosis were correlated with microsphere-determined regional blood flow and distal coronary pressure. Another nine dogs with equivalent stenosis not given dipyridamole before 201Tl served as controls. Data indicate that dipyridamole-induced vasodilation in the presence of a partial stenosis results in diminished uptake and delayed clearance compared with increased uptake and more rapid clearance in normally perfused myocardium producing an initial 201Tl defect with delayed redistribution

Experimental Evaluation of PV Inverter Anti-Islanding with Grid Support Functions in Multi-Inverter Island Scenarios

Energy Technology Data Exchange (ETDEWEB)

Hoke, Anderson [National Renewable Energy Lab. (NREL), Golden, CO (United States); Nelson, Austin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Miller, Brian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chakraborty, Sudipta [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bell, Frances [SolarCity, San Mateo, CA (United States); McCarty, Michael [SolarCity, San Mateo, CA (United States)

2016-07-01

As PV and other DER systems are connected to the grid at increased penetration levels, island detection may become more challenging for two reasons: 1.) In islands containing many DERs, active inverter-based anti-islanding methods may have more difficulty detecting islands because each individual inverter's efforts to detect the island may be interfered with by the other inverters in the island. 2.) The increasing numbers of DERs are leading to new requirements that DERs ride through grid disturbances and even actively try to regulate grid voltage and frequency back towards nominal operating conditions. These new grid support requirements may directly or indirectly interfere with anti-islanding controls. This report describes a series of tests designed to examine the impacts of both grid support functions and multi-inverter islands on anti-islanding effectiveness. Crucially, the multi-inverter anti-islanding tests described in this report examine scenarios with multiple inverters connected to multiple different points on the grid. While this so-called 'solar subdivision' scenario has been examined to some extent through simulation, this is the first known work to test it using hardware inverters. This was accomplished through the use of power hardware-in-the-loop (PHIL) simulation, which allows the hardware inverters to be connected to a real-time transient simulation of an electric power system that can be easily reconfigured to test various distribution circuit scenarios. The anti-islanding test design was a modified version of the unintentional islanding test in IEEE Standard 1547.1, which creates a balanced, resonant island with the intent of creating a highly challenging condition for island detection. Three common, commercially available single-phase PV inverters from three different manufacturers were tested. The first part of this work examined each inverter individually using a series of pure hardware resistive-inductive-capacitive (RLC

48 CFR 201.404 - Class deviations.

Science.gov (United States)

2010-10-01

..., and the Defense Logistics Agency, may approve any class deviation, other than those described in 201...) Diminish any preference given small business concerns by the FAR or DFARS; or (D) Extend to requirements imposed by statute or by regulations of other agencies such as the Small Business Administration and the...

Hydrodynamic stability of inverted annular flow in an adiabatic simulation

International Nuclear Information System (INIS)

De Jarlais, G.; Ishii, M.; Linehan, J.

1986-01-01

Inverted annular flow was simulated adiabatically with turbulent water jets, issuing downward from large aspect ratio nozzles, enclosed in gas annuli. Velocities, diameters, and gas species were varied, and core jet length, shape, breakup mode, and dispersed core droplet sizes were recorded at approximately 750 data points. Inverted annular flow destabilization led to inverted slug flow at low relative velocities, and to dispersed droplet flow, core breakup length correlations were developed by extending work on free liquid jets to include this coaxial, jet disintegration phenomenon. The results show length dependence upon D/sub J/, Re/sub J/, We/sub J/, α, and We/sub G/,rel. Correlations for core shape, breakup mechanisms, and dispersed core droplet size were also developed, by extending the results of free jet stability, roll wave entrainment, and churn turbulent droplet stability studies

A glycosynthase derived from an inverting GH19 chitinase from the moss Bryum coronatum.

Science.gov (United States)

Ohnuma, Takayuki; Fukuda, Tatsuya; Dozen, Satoshi; Honda, Yuji; Kitaoka, Motomitsu; Fukamizo, Tamo

2012-06-15

BcChi-A, a GH19 chitinase from the moss Bryum coronatum, is an endo-acting enzyme that hydrolyses the glycosidic bonds of chitin, (GlcNAc)(n) [a β-1,4-linked polysaccharide of GlcNAc (N-acetylglucosamine) with a polymerization degree of n], through an inverting mechanism. When the wild-type enzyme was incubated with α-(GlcNAc)2-F [α-(GlcNAc)(2) fluoride] in the absence or presence of (GlcNAc)(2), (GlcNAc)(2) and hydrogen fluoride were found to be produced through the Hehre resynthesis-hydrolysis mechanism. To convert BcChi-A into a glycosynthase, we employed the strategy reported by Honda et al. [(2006) J. Biol. Chem. 281, 1426-1431; (2008) Glycobiology 18, 325-330] of mutating Ser(102), which holds a nucleophilic water molecule, and Glu(70), which acts as a catalytic base, producing S102A, S102C, S102D, S102G, S102H, S102T, E70G and E70Q. In all of the mutated enzymes, except S102T, hydrolytic activity towards (GlcNAc)(6) was not detected under the conditions we used. Among the inactive BcChi-A mutants, S102A, S102C, S102G and E70G were found to successfully synthesize (GlcNAc)(4) as a major product from α-(GlcNAc)(2)-F in the presence of (GlcNAc)(2). The S102A mutant showed the greatest glycosynthase activity owing to its enhanced F(-) releasing activity and its suppressed hydrolytic activity. This is the first report on a glycosynthase that employs amino sugar fluoride as a donor substrate.

Chemical effects of 13N produced by recoil protons and deuterons in pile-irradiated methanol and methanol-d4

International Nuclear Information System (INIS)

Sensui, Y.; Tomura, K.; Matsuura, T.

1982-01-01

The stabilized chemical forms of 13 N resulting from the reactions 13 C(p,n) 13 N by a recoil proton and 12 C(d,n) 13 N by a recoil deuteron, were studied in pile-irradiated methanol and methanol-d 4 in the temperature range from 77 to 295 K. Contrary to the target of benzene, cyclohexane, acetone and diethyl ether previously studied, the relative yield of 13 N-compounds did not depend on the irradiation temperature in the present media. In the yield of 13 N-compounds no marked change was observed between methanol and methanol-d 4 , differing from the results between benzene and benzene-d 6 . A mechanism is proposed to explain the results. (author)

Collision-induced absorption by D{sub 2} pairs in the first overtone band at 77, 201 and 298 K

Energy Technology Data Exchange (ETDEWEB)

Abu-Kharma, M.; Gillard, P.G.; Reddy, S.P. [Memorial University of Newfoundland, Dept. of Physics and Physical Oceanography, Newfoundland (Canada)

2006-01-15

Collision induced absorption (CIA) spectra of pure D{sub 2} in the first overtone region from 5250 to 7250 cm{sup -1}, recorded at 77, 201 and 298 K, have been analyzed. The observed spectra at 77, 201 and 298 K were modelled by a total of 92, 214 and 267 components respectively of double vibrational transitions at room temperature of the type X{sub 2}(J) +X{sub 0}(J) and X{sub 1}(J) + X{sub 1}(J), where X is O, Q or S transitions. Profile analyses of the spectra were carried out using the Birnbaum-Cohen line-shape function for the individual components of the band, and characteristic line shape parameters were determined from the analysis. The observed and calculated profiles agree well over the whole overtone band, and the agreement is better than 97% in the three cases studied. Binary and ternary absorption coefficients were determined from the integrated absorption of the band. (authors)

EXAMINING A SERIES RESONANT INVERTER CIRCUIT TO USE IN THE PHOTOVOLTAIC ENERGY CONVERSION SYSTEMS

Directory of Open Access Journals (Sweden)

Engin ÇETİN

2004-03-01

Full Text Available As we know, solar energy is the energy source which is environment friendly, renewable, and can be found easily. Particularly, in the recent years, interest on producing electrical energy by alternative energy sources increased because of the fact that underground sources are not enough to produce energy in the future and also these sources cause enviromental pollution. The solar energy is one of the most popular one among the alternative energy sources. Photovoltaic systems produce the electrical energy from the sunlight. In this study, a series resonant inverter circuit which is used in the photovoltaic energy conversion systems has been examined.Effects of the series resonant inverter circuit on the photovoltaic energy conversion system have been investigated and examined

A complementary organic inverter of porphyrazine thin films: low-voltage operation using ionic liquid gate dielectrics.

Science.gov (United States)

Fujimoto, Takuya; Miyoshi, Yasuhito; Matsushita, Michio M; Awaga, Kunio

2011-05-28

We studied a complementary organic inverter consisting of a p-type semiconductor, metal-free phthalocyanine (H(2)Pc), and an n-type semiconductor, tetrakis(thiadiazole)porphyrazine (H(2)TTDPz), operated through the ionic-liquid gate dielectrics of N,N-diethyl-N-methyl(2-methoxyethyl)ammonium bis(trifluoromethylsulfonyl)imide (DEME-TFSI). This organic inverter exhibits high performance with a very low operation voltage below 1.0 V and a dynamic response up to 20 Hz. © The Royal Society of Chemistry 2011

Charging capacitors of multilevel inverter from dc intermediate circuit

Czech Academy of Sciences Publication Activity Database

Bejvl, Martin

2011-01-01

Roč. 56, č. 2 (2011), s. 159-170 ISSN 0001-7043 R&D Projects: GA MPO FT-TA4/077 Institutional research plan: CEZ:AV0Z20570509 Keywords : electric drive * multilevel inverter * modulation and demodulation Subject RIV: JA - Electronics ; Optoelectronics, Electric al Engineering

Addressable inverter matrix for process and device characterization

Science.gov (United States)

Buehler, M. G.; Sayah, H. R.

1985-01-01

The addressable inverter matrix consists of 222 inverters each accessible with the aid of a shift register. The structure has proven useful in characterizing the variability of inverter transfer curves and in diagnosing processing faults. For good 3-micron CMOS bulk inverters investigated, the percent standard deviation of the inverter threshold voltage was less than one percent and the inverter gain (the slope of the inverter transfer curve at the inverter threshold vltage) was less than 3 percent. The average noise margin for the inverters was near 2 volts for a power supply voltage of 5 volts. The specific faults studied included undersize pull-down transistor widths and various open contacts in the matrix.

Identification of Residues Important for the Activity of Haloferax volcanii AglD, a Component of the Archaeal N-Glycosylation Pathway

Directory of Open Access Journals (Sweden)

Lina Kaminski

2010-01-01

Full Text Available In Haloferax volcanii, AglD adds the final hexose to the N-linked pentasaccharide decorating the S-layer glycoprotein. Not knowing the natural substrate of the glycosyltransferase, together with the challenge of designing assays compatible with hypersalinity, has frustrated efforts at biochemical characterization of AglD activity. To circumvent these obstacles, an in vivo assay designed to identify amino acid residues important for AglD activity is described. In the assay, restoration of AglD function in an Hfx. volcanii aglD deletion strain transformed to express plasmid-encoded versions of AglD, generated through site-directed mutagenesis at positions encoding residues conserved in archaeal homologues of AglD, is reflected in the behavior of a readily detectable reporter of N-glycosylation. As such Asp110 and Asp112 were designated as elements of the DXD motif of AglD, a motif that interacts with metal cations associated with nucleotide-activated sugar donors, while Asp201 was predicted to be the catalytic base of the enzyme.

Inverted Polarity Thunderstorms Linked with Elevated Cloud Base Height

Science.gov (United States)

Cummins, K. L.; Williams, E.

2016-12-01

The great majority of thunderstorms worldwide exhibit gross positive dipole structure, produce intracloud lightning that reduces this positive dipole (positive intracloud flashes), and produce negative cloud-to-ground lightning from the lower negative end of this dipole. During the STEPS experiment in 2000 much new evidence for thunderstorms (or cells within multi-cellular storms) with inverted polarity came to light, both from balloon soundings of electric field and from LMA analysis. Many of the storms with inverted polarity cells developed in eastern Colorado. Fleenor et al. (2009) followed up after STEPS to document a dominance of positive polarity CG lightning in many of these cases. In the present study, surface thermodynamic observations (temperature and dew point temperature) have been used to estimate the cloud base heights and temperatures at the time of the Fleenor et al. lightning observations. It was found that when more than 90% of the observed CG lightning polarity within a storm is negative, the cloud base heights were low (2000 m AGL or lower, and warmer, with T>10 C), and when more than 90% of the observed CG lightning within a storm was positive, the cloud base heights were high (3000 m AGL or higher, and colder, with Tmixed polarity were generally associated with intermediate cloud base heights. These findings on inverted polarity thunderstorms are remarkably consistent with results in other parts of the world where strong instability prevails in the presence of high cloud base height: the plateau regions of China (Liu et al., 1989; Qie et al., 2005), and in pre-monsoon India (Pawar et al., 2016), particularly when mixed polarity cases are excluded. Calculations of adiabatic cloud water content for lifting from near 0 oC cast some doubt on earlier speculation (Williams et al., 2005) that the graupel particles in these inverted polarity storms attain a wet growth condition, and so exhibit positive charging following laboratory experiments. This

Power Loss Calculation and Thermal Modelling for a Three Phase Inverter Drive System

Directory of Open Access Journals (Sweden)

Z. Zhou

2005-12-01

Full Text Available Power losses calculation and thermal modelling for a three-phase inverter power system is presented in this paper. Aiming a long real time thermal simulation, an accurate average power losses calculation based on PWM reconstruction technique is proposed. For carrying out the thermal simulation, a compact thermal model for a three-phase inverter power module is built. The thermal interference of adjacent heat sources is analysed using 3D thermal simulation. The proposed model can provide accurate power losses with a large simulation time-step and suitable for a long real time thermal simulation for a three phase inverter drive system for hybrid vehicle applications.

Importance of the inverted control in measuring holistic face processing with the composite effect and part-whole effect.

Directory of Open Access Journals (Sweden)

Elinor eMcKone

2013-02-01

Full Text Available Holistic coding for faces is shown in several illusions that demonstrate integration of the percept across the entire face. The illusions occur upright but, crucially, not inverted. Converting the illusions into experimental tasks that measure their strength – and thus index degree of holistic coding – is often considered straightforward yet in fact relies on a hidden assumption, namely that there is no contribution to the experimental measure from secondary cognitive factors. For the composite effect, a relevant secondary factor is size of the "spotlight" of visuospatial attention. The composite task assumes this spotlight can be easily restricted to the target half (e.g., top half of the compound face stimulus. Yet, if this assumption were not true then a large spotlight, in the absence of holistic perception, could produce a false composite effect, present even for inverted faces and contributing partially to the score for upright faces. We review evidence that various factors can influence spotlight size: race/culture (Asians often prefer a more global distribution of attention than Caucasians; sex (females can be more global; appearance of the join or gap between face halves; and location of the eyes, which typically attract attention. Results from 5 experiments then show inverted faces can sometimes produce large false composite effects, and imply that whether this happens or not depends on complex interactions between causal factors. We also report, for both identity and expression, that only top-half-face targets (containing eyes produce valid composite measures. A sixth experiment demonstrates an example of a false inverted part-whole effect, where encoding-specificity is the secondary cognitive factor. We conclude the inverted face control should be tested in all composite and part-whole studies, and an effect for upright faces should be interpreted as a pure measure of holistic processing only when the experimental design produces

Importance of the Inverted Control in Measuring Holistic Face Processing with the Composite Effect and Part-Whole Effect

Science.gov (United States)

McKone, Elinor; Davies, Anne Aimola; Darke, Hayley; Crookes, Kate; Wickramariyaratne, Tushara; Zappia, Stephanie; Fiorentini, Chiara; Favelle, Simone; Broughton, Mary; Fernando, Dinusha

2013-01-01

Holistic coding for faces is shown in several illusions that demonstrate integration of the percept across the entire face. The illusions occur upright but, crucially, not inverted. Converting the illusions into experimental tasks that measure their strength – and thus index degree of holistic coding – is often considered straightforward yet in fact relies on a hidden assumption, namely that there is no contribution to the experimental measure from secondary cognitive factors. For the composite effect, a relevant secondary factor is size of the “spotlight” of visuospatial attention. The composite task assumes this spotlight can be easily restricted to the target half (e.g., top-half) of the compound face stimulus. Yet, if this assumption were not true then a large spotlight, in the absence of holistic perception, could produce a false composite effect, present even for inverted faces and contributing partially to the score for upright faces. We review evidence that various factors can influence spotlight size: race/culture (Asians often prefer a more global distribution of attention than Caucasians); sex (females can be more global); appearance of the join or gap between face halves; and location of the eyes, which typically attract attention. Results from five experiments then show inverted faces can sometimes produce large false composite effects, and imply that whether this happens or not depends on complex interactions between causal factors. We also report, for both identity and expression, that only top-half face targets (containing eyes) produce valid composite measures. A sixth experiment demonstrates an example of a false inverted part-whole effect, where encoding-specificity is the secondary cognitive factor. We conclude the inverted face control should be tested in all composite and part-whole studies, and an effect for upright faces should be interpreted as a pure measure of holistic processing only when the experimental design produces no

Activation mechanism of ammonium ions on sulfidation of malachite (-201) surface by DFT study

Science.gov (United States)

Wu, Dandan; Mao, Yingbo; Deng, Jiushuai; Wen, Shuming

2017-07-01

The activation mechanism of ammonium ions on the sulfidation of malachite (-201) was determined by density functional theory (DFT) calculations. Results of DFT calculations indicated that interlayer sulfidation occurs during the sulfidation process of malachite (-201). The absorption of both the ammonium ion and sulfide ion on the malachite (-201) surface is stronger than that of sulfur ion. After sulfidation was activated with ammonium ion, the Cu 3d orbital peak is closer to the Fermi level and characterized by a stronger peak value. Therefore, the addition of ammonium ions activated the sulfidation of malachite (-201), thereby improving the flotation performance.

Inverter design for high frequency power distribution

Science.gov (United States)

King, R. J.

1985-01-01

A class of simple resonantly commutated inverters are investigated for use in a high power (100 KW - 1000 KW) high frequency (10 KHz - 20 KHz) AC power distribution system. The Mapham inverter is found to provide a unique combination of large thyristor turn-off angle and good utilization factor, much better than an alternate 'current-fed' inverter. The effects of loading the Mapham inverter entirely with rectifier loads are investigated by simulation and with an experimental 3 KW 20 KHz inverter. This inverter is found to be well suited to a power system with heavy rectifier loading.

Characteristics of GaAs MESFET inverters exposed to high energy neutrons

International Nuclear Information System (INIS)

Bloss, W.L.; Yamada, W.E.; Young, A.M.; Janousek, B.K.

1988-01-01

GaAs MESFET circuits have been exposed to high energy neutrons with fluences ranging from 1x10/sup 14/ n/cm/sup 2/ to 2x10/sup 15/ m/cm/sup 2/. Discrete transistors, inverters, and ring oscillators were characterized at each fluence. While the MESFETs exhibit significant threshold voltage shifts and transconductance and saturation current degradation over this range of neutron fluences, the authors have observed improvement in the DC characteristics of Schottky Diode FET Logic (SDFL) inverters. This unusual result has been successfully simulated using device parameters extracted from FETs damaged by exposure to high energy neutrons. Although the decrease in device transconductance results in an increase in inverter gate delay, as reflected in ring oscillator frequency measurements, the authors conclude that GaAs ICs fabricated from this logic family will remain functional after exposure to extreme neutron fluences. This is a consequence of the observed improvement in inverter noise margin evident in both measured and simulated circuit performance

Characterization of Pu-contaminated soils from Nuclear Site 201 at the Nevada Test Site

International Nuclear Information System (INIS)

Lee, S.Y.; Tamura, T.; Larsen, I.L.

1983-01-01

Distribution and characteristics of Pu-bearing radioactive particles throughout five soil profiles from Nuclear Site (NS) 201 were investigated. Concentrations of 239 240 Pu and 241 Am decreased with depth and most of the contamination was contained in the top 5 cm except in profile 4 where it extended to 10 cm. The mean activity ratio of 239 240 Pu to 241 Am and its standard error were 5.8 +- 0.3 (N=42). Most of the total radioactivity of the soils was contributed by 0.25 to 2 mm sand size fraction which comprised 20 to 50% by weight of the soils. The radioactive particles in the 0.25 to 2 mm size fraction occurred as spherical glass particles or as glass coatings on sand particles. The glass coatings had gas voids in the matrix but were not as porous as the radioactive particles from NS 219. After impact grinding the >0.25-mm size fractions for one hour, 85% of the initial activity in a NS 201 sample remained with the particles on the 0.25 mm sieve, whereas in the NS 219 sample only 10% remained. The results show that the radioactive particles from NS 201 were much more stable against the impact grinding force than those from NS 219. Therefore, the NS 201 soils would be expected to have a lower probability of producing respirable-size radioactive particles by saltation during wind erosion. 19 references, 3 figures, 3 tables

Multilevel Inverter by Cascading Industrial VSI

DEFF Research Database (Denmark)

Teodorescu, Remus; Blaabjerg, Frede; Pedersen, John Kim

2002-01-01

In this paper the modularity concept applied to medium-voltage adjustable speed drives is addressed. First, the single-phase cascaded voltage-source inverter that uses series connection of IGBT H-bridge modules with isolated dc-buses is presented. Next, a novel three-phase cascaded voltage......-source inverter that uses three IGBT triphase inverter modules along with an output transformer to obtain a 3 p.u. multilevel output voltage is introduced. The system yields in high-quality multistep voltage with up to 4 levels and low dv/dt, balanced operation of the inverter modules, each supplying a third...... of the motor rated kVA. The concept of using cascaded inverters is further extended to a new modular motor-modular inverter system where the motor winding connections are reconnected into several three-phase groups, either six-lead or 12-lead connection according to the voltage level, each powered...

Gas cooled traction drive inverter

Science.gov (United States)

Chinthavali, Madhu Sudhan

2013-10-08

The present invention provides a modular circuit card configuration for distributing heat among a plurality of circuit cards. Each circuit card includes a housing adapted to dissipate heat in response to gas flow over the housing. In one aspect, a gas-cooled inverter includes a plurality of inverter circuit cards, and a plurality of circuit card housings, each of which encloses one of the plurality of inverter cards.

A charge inverter for III-nitride light-emitting diodes

Energy Technology Data Exchange (ETDEWEB)

Zhang, Zi-Hui, E-mail: zh.zhang@hebut.edu.cn, E-mail: wbi@hebut.edu.cn, E-mail: volkan@stanfordalumni.org, E-mail: sunxw@sustc.edu.cn; Zhang, Yonghui; Bi, Wengang, E-mail: zh.zhang@hebut.edu.cn, E-mail: wbi@hebut.edu.cn, E-mail: volkan@stanfordalumni.org, E-mail: sunxw@sustc.edu.cn; Geng, Chong; Xu, Shu [Key Laboratory of Electronic Materials and Devices of Tianjin, School of Electronics and Information Engineering, Hebei University of Technology, 5340 Xiping Road, Beichen District, Tianjin 300401 (China); Demir, Hilmi Volkan, E-mail: zh.zhang@hebut.edu.cn, E-mail: wbi@hebut.edu.cn, E-mail: volkan@stanfordalumni.org, E-mail: sunxw@sustc.edu.cn [LUMINOUS Centre of Excellence for Semiconductor Lighting and Displays, School of Electrical and Electronic Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 Singapore (Singapore); Department of Electrical and Electronics, Department of Physics, and UNAM-Institute of Material Science and Nanotechnology, Bilkent University, TR-06800 Ankara (Turkey); Sun, Xiao Wei, E-mail: zh.zhang@hebut.edu.cn, E-mail: wbi@hebut.edu.cn, E-mail: volkan@stanfordalumni.org, E-mail: sunxw@sustc.edu.cn [LUMINOUS Centre of Excellence for Semiconductor Lighting and Displays, School of Electrical and Electronic Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 Singapore (Singapore); Department of Electrical and Electronic Engineering, College of Engineering, South University of Science and Technology, 1088 Xue-Yuan Road, Nanshan, Shenzhen, Guangdong 518055 (China)

2016-03-28

In this work, we propose a charge inverter that substantially increases the hole injection efficiency for InGaN/GaN light-emitting diodes (LEDs). The charge inverter consists of a metal/electrode, an insulator, and a semiconductor, making an Electrode-Insulator-Semiconductor (EIS) structure, which is formed by depositing an extremely thin SiO{sub 2} insulator layer on the p{sup +}-GaN surface of a LED structure before growing the p-electrode. When the LED is forward-biased, a weak inversion layer can be obtained at the interface between the p{sup +}-GaN and SiO{sub 2} insulator. The weak inversion region can shorten the carrier tunnel distance. Meanwhile, the smaller dielectric constant of the thin SiO{sub 2} layer increases the local electric field within the tunnel region, and this is effective in promoting the hole transport from the p-electrode into the p{sup +}-GaN layer. Due to the improved hole injection, the external quantum efficiency is increased by 20% at 20 mA for the 350 × 350 μm{sup 2} LED chip. Thus, the proposed EIS holds great promise for high efficiency LEDs.

A charge inverter for III-nitride light-emitting diodes

International Nuclear Information System (INIS)

Zhang, Zi-Hui; Zhang, Yonghui; Bi, Wengang; Geng, Chong; Xu, Shu; Demir, Hilmi Volkan; Sun, Xiao Wei

2016-01-01

In this work, we propose a charge inverter that substantially increases the hole injection efficiency for InGaN/GaN light-emitting diodes (LEDs). The charge inverter consists of a metal/electrode, an insulator, and a semiconductor, making an Electrode-Insulator-Semiconductor (EIS) structure, which is formed by depositing an extremely thin SiO 2 insulator layer on the p + -GaN surface of a LED structure before growing the p-electrode. When the LED is forward-biased, a weak inversion layer can be obtained at the interface between the p + -GaN and SiO 2 insulator. The weak inversion region can shorten the carrier tunnel distance. Meanwhile, the smaller dielectric constant of the thin SiO 2 layer increases the local electric field within the tunnel region, and this is effective in promoting the hole transport from the p-electrode into the p + -GaN layer. Due to the improved hole injection, the external quantum efficiency is increased by 20% at 20 mA for the 350 × 350 μm 2 LED chip. Thus, the proposed EIS holds great promise for high efficiency LEDs.

Embedded EZ-Source Inverters

DEFF Research Database (Denmark)

Chiang Loh, Poh; Gao, Feng; Blaabjerg, Frede

2010-01-01

overvoltage oscillations to the system. Therefore, Z-source inverters are, in effect, safer and less complex and can be implemented using only passive elements with no additional active semiconductor needed. Believing in the prospects of Z-source inverters, this paper contributes by introducing a new family...

A molybdenum disulfide/carbon nanotube heterogeneous complementary inverter.

Science.gov (United States)

Huang, Jun; Somu, Sivasubramanian; Busnaina, Ahmed

2012-08-24

We report a simple, bottom-up/top-down approach for integrating drastically different nanoscale building blocks to form a heterogeneous complementary inverter circuit based on layered molybdenum disulfide and carbon nanotube (CNT) bundles. The fabricated CNT/MoS(2) inverter is composed of n-type molybdenum disulfide (MOS(2)) and p-type CNT transistors, with a high voltage gain of 1.3. The CNT channels are fabricated using directed assembly while the layered molybdenum disulfide channels are fabricated by mechanical exfoliation. This bottom-up fabrication approach for integrating various nanoscale elements with unique characteristics provides an alternative cost-effective methodology to complementary metal-oxide-semiconductors, laying the foundation for the realization of high performance logic circuits.

30 CFR 243.201 - How will MMS determine if I am financially solvent?

Science.gov (United States)

2010-07-01

... Section by one of the methods in § 243.200(a): (1) A written request asking us to consult a business... active appeals. (d) If you request that we consult a business-information or credit-reporting service or... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...

High performance Si nanowire field-effect-transistors based on a CMOS inverter with tunable threshold voltage.

Science.gov (United States)

Van, Ngoc Huynh; Lee, Jae-Hyun; Sohn, Jung Inn; Cha, Seung Nam; Whang, Dongmok; Kim, Jong Min; Kang, Dae Joon

2014-05-21

We successfully fabricated nanowire-based complementary metal-oxide semiconductor (NWCMOS) inverter devices by utilizing n- and p-type Si nanowire field-effect-transistors (NWFETs) via a low-temperature fabrication processing technique. We demonstrate that NWCMOS inverter devices can be operated at less than 1 V, a significantly lower voltage than that of typical thin-film based complementary metal-oxide semiconductor (CMOS) inverter devices. This low-voltage operation was accomplished by controlling the threshold voltage of the n-type Si NWFETs through effective management of the nanowire (NW) doping concentration, while realizing high voltage gain (>10) and ultra-low static power dissipation (≤3 pW) for high-performance digital inverter devices. This result offers a viable means of fabricating high-performance, low-operation voltage, and high-density digital logic circuits using a low-temperature fabrication processing technique suitable for next-generation flexible electronics.

Pion-transfer (n,d) and (d, 3He) reactions leading to deeply bound pionic atoms

International Nuclear Information System (INIS)

Toki, H.; Hirenzaki, S.; Yamazaki, T.

1990-11-01

Theoretical studies are given on the (n,d) and (d, 3 He) reactions leading to deeply bound pionic atoms in heavy nuclei of configuration [(nl) π ·j n -1 ]J. The cross sections for various pionic and neutron-hole configurations in the case of a 208 Pb target are calculated at incident energies 300-1000 MeV/u by using the effective number approach and the eikonal approximation for distortion. The effective number with a pion in the 1s or 2p state and a neutron hole in the i 13/2 orbit peaks around the same incident energy (T n =600 MeV) as the elementary cross section n+n→d+π - , where the momentum transfer matches the angular-momentum transfer of L=5∼7. The DWIA cross section for (n,d) producing a pion in the 1s or 2p orbit at T n =600 MeV is found to be around 42 or 75 μb/sr, respectively. At T n =350 MeV, where the momentum transfer is small, quasi-substitutional states of configurations [(2p) π (3p 1/2 ) n -1 ]L=0 and [(2p) π (3p 3/2 ) n -1 ]L=0 are preferentially populated with cross sections of 190 and 380 μb/sr, respectively. The (d, 3 He) cross sections are estimated to be an order of magnitude smaller than the (n,d) cross sections. Thus, the (n,d) and (d, 3 He) reactions are found to be suited for the production of deeply bound pionic atoms. (author)

Recovery of 201Tl by ion exchange chromatography from proton bombarded thallium cyclotron targets

International Nuclear Information System (INIS)

Walt, T.N. van der; Naidoo, C.

2000-01-01

A method based on ion exchange chromatography is presented for the recovery of 201 Tl and its precursor 201 Pb from proton bombarded natural thallium cyclotron targets. After bombardment the target is dissolved in diluted nitric acid. Water, hydrazine and ammonium acetate are added to the solution and the lead radioisotopes separated from the thallium by cation exchange chromatography on a Bio-Rex 70 column. The sorbed lead radioisotopes are eluted with dilute nitric acid and the separation repeated on a second Bio-Rex 70 column. After elution of the remaining thallium the column is left for 32 hours and the 201 Tl formed by decay of 201 Pb is eluted with an ammonium acetate solution. The 201 Tl eluate is acidified with a HNO 3 -HBr-Br 2 mixture and the resulting solution is passed through an AG MP-1 anion exchanger column to remove any remaining lead isotopes. The 201 Tl is eluted with a hydrazine solution, the eluate evaporated to dryness and the 201 Tl finally dissolved in an appropriate solution to produce a 201 TlCl solution suitable for medical use. A high quality 201 Tl product is obtained containing ≤ 0.1 μg of Tl/mCi (37 MBq) 201 Tl. The radionuclidic impurities are less than the maximum values specified by the US Pharmacopoeia and the British Pharmacopoeia. (orig.)

Embedded EZ-Source Inverters

DEFF Research Database (Denmark)

Blaabjerg, Frede; Loh, Poh Chiang; Gao, F.

2008-01-01

-voltage oscillations to the system. Therefore, Z-source inverters are in effect safer and less complex, and can be implemented using only passive elements with no additional active semiconductor needed. Believing in the prospects of Z-source inverters, this paper contributes by introducing a new family of embedded EZ...

Efficient Color-Stable Inverted White Organic Light-Emitting Diodes with Outcoupling-Enhanced ZnO Layer.

Science.gov (United States)

Zhao, Xin-Dong; Li, Yan-Qing; Xiang, Heng-Yang; Zhang, Yi-Bo; Chen, Jing-De; Xu, Lu-Hai; Tang, Jian-Xin

2017-01-25

Inverted organic light-emitting diode (OLED) has attracted extensive attention due to the demand in active-matrix OLED display panels as its geometry enables the direct connection with n-channel transistor backplane on the substrate. One key challenge of high-performance inverted OLED is an efficient electron-injection layer with superior electrical and optical properties to match the indium tin oxide cathode on substrate. We here propose a synergistic electron-injection architecture using surface modification of ZnO layer to simultaneously promote electron injection into organic emitter and enhance out-coupling of waveguided light. An efficient inverted white OLED is realized by introducing the nanoimprinted aperiodic nanostructure of ZnO for broadband and angle-independent light out-coupling and inserting an n-type doped interlayer for energy level tuning and injection barrier lowering. As a result, the optimized inverted white OLEDs have an external quantum efficiency of 42.4% and a power efficiency of 85.4 lm W 1- , which are accompanied by the superiority of angular color stability over the visible wavelength range. Our results may inspire a promising approach to fabricate high-efficiency inverted OLEDs for large-scale display panels.

Enhanced Buck–Boost Neutral-Point-Clamped Inverters With Simple Capacitive-Voltage Balancing

DEFF Research Database (Denmark)

Tan, Kuan Khoon; Gao, Feng; Loh, Poh Chiang

2010-01-01

introduced for extending the inverters’ variation range to include voltageboost operation, but they generally require the inclusion of large passive components or have not yet been optimized in terms of waveform quality. The balancing of their capacitive voltages using a simple technique has also not yet...... simultaneously, two new buck–boost NPC inverters with simple capacitive-voltage-balancing capability are proposed. Both inverters are demonstrated to exhibit a doubling of voltage gain, with one of them also shown to produce a better output waveform quality. Simulation and experimental results are provided...

Toplumun Devrik Cümle Hakkındaki Düşüncesi ve Nesirde Devrik Cümlenin Yeri / Opinion of Society on the Inverted Sentence and the Place of the Inverted Sentence in Prose

Directory of Open Access Journals (Sweden)

Serhat Küçük

2017-12-01

Full Text Available Abstract This study aims to analyse the usage of inverted sentences which we have been witnessing in daily life, language and literature as well as show public perception about the inverted sentences. In the research, eight proses by eight different Turkish writers have been analysed according six factors. The observed data showed that inverted sentences more likely to be used by so-called left-wing writers who wrote about social subjects. To collect data about public opinion, a survey, consisting of 12 questions and answered by 500 people, conducted by the researchers. Regarding the last question, which serves most for the work, 772 connotations have been indicated by 448 people and these connotations have been associated with 267 different terms. According to data gathered by the open-ended questions, it could be said that society is in a dilemma as well as linguists. That we have come across different terms in addition to positive and negative answers shows the wealthy world of thought in Turkish society. ÖZ Bu araştırma, son yıllarda günlük hayatımızda gerek iletişimimizde gerek okuyup yazdıklarımızda sık sık karşılaştığımız devrik cümle kullanımını ve bunun toplum tarafından algılanış biçimini incelemeyi amaçlamaktadır. Araştırmada, sekiz Türk yazarın nesirlerinde devrik cümle kullanımları 6 faktör açısından incelenerek elde edilen veriler ışığında devrik cümleyle ilgili düşünce tarzları ortaya konulmaya çalışılmıştır. Elde edilen bulgular, toplumsal konularda yazılar yazan ve solcu olarak nitelendirilen yazarların devrik cümle kullanım oranlarının daha yüksek olduğunu göstermiştir. Araştırmada, devrik cümle yapısı ile ilgili toplum algısını ölçmek amacıyla 500 katılımcının cevapladığı 12 soruluk bir anket çalışmasının sonuçlarına da yer verilmiştir.  Çalışmanın amacına en çok hizmet eden son soruya; 448 katılımcıdan 772 �

Bacteria as source of diglycosidase activity: Actinoplanes missouriensis produces 6-O-alpha-l-rhamnosyl-beta-d-glucosidase active on flavonoids

Czech Academy of Sciences Publication Activity Database

Neher, B.D.; Mazzaferro, L.S.; Kotík, Michael; Oyhenart, J.; Halada, Petr; Křen, Vladimír; Breccia, J.D.

2016-01-01

Roč. 100, č. 7 (2016), s. 3061-3070 ISSN 0175-7598 R&D Projects: GA MŠk(CZ) LD13042; GA MŠk(CZ) LD15085; GA MŠk 7AMB13AR005 Institutional support: RVO:61388971 Keywords : alpha-L-rhamnosidase * beta-D-glucosidase * Inverting glycosidase Subject RIV: CE - Biochemistry Impact factor: 3.420, year: 2016

Pre-inverted SESAME data table construction enhancements to correct unexpected inverse interpolation pathologies in EOSPAC 6

Energy Technology Data Exchange (ETDEWEB)

Pimentel, David A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sheppard, Daniel G. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2018-02-01

It was recently demonstrated that EOSPAC 6 continued to incorrectly create and interpolate pre-inverted SESAME data tables after the release of version 6.3.2beta.2. Significant interpolation pathologies were discovered to occur when EOSPAC 6's host software enabled pre-inversion with the EOS_INVERT_AT_SETUP option. This document describes a solution that uses data transformations found in EOSPAC 5 and its predecessors. The numerical results and performance characteristics of both the default and pre-inverted interpolation modes in both EOSPAC 6.3.2beta.2 and the fixed logic of EOSPAC 6.4.0beta.1 are presented herein, and the latter software release is shown to produce significantly-improved numerical results for the pre-inverted interpolation mode.

Correlation between auroral kilometric radiation and inverted v electron precipitation

International Nuclear Information System (INIS)

Green, J.L.; Gurnfti, D.A.; Hoffmans, R.A.

1979-01-01

Simultaneous observations of energetic electron precipitations and auroral kilometric radiation (AKR) were obtained from the polar orbiting satellites AE-D and Hawkeye. The Hawkeye observations were restricted to periods when the satellite was in the AKR emission cone in the northern hemisphere an at radial distances > or approx. =7 R/sub E/ to avoid local propagation cutoff effects. In addition, the AE-D measurements were restricted to complete passes across the auroral oval in the evening to midnight local time sector (from 20 to 01 hours magnetic local time). This is the local time region where the most intense bursts of AKR are believed to originate. A qualitative survey of AKR and electron precipitation than with plasma sheet precipitation. Quantitatively, a good correlation is found between the AKR intensity and the peak energy of inverted V events. In addition, in the tail of the most field-aligned portion (approx.O 0 pitch angle) of the distribution functions of the inverted V events,systematic changes are indicated as the associated AKR intensity increases. When the AKR power flux is weak ( -17 W/(m 2 Hz)). From a determination of the simultaneous power in the inverted V events and the AKR bursts, the efficiency of converting the charge particle energy into EM radiation increases to a maximum of about 1% for the most intense AKR bursts. However, conversion efficiencies as low as 10 -5 % are also found. There is some evidence which suggests that the tail temperature, T in F (V) of the inverted V events, may play an important role in the efficient generation or amplification of auroral kilometric radiation

Effects of ischemic-like insult on myocardial 201Tl accumulation

International Nuclear Information System (INIS)

Goldhaber, S.Z.; Newell, J.B.; Alpert, N.M.; Andrews, E.; Pohost, G.M.; Ingwall, J.S.

1983-01-01

Despite extensive clinical use of thallium-201 ( 201 Tl) for myocardial imaging, the effect of ischemia on myocardial accumulation and release of 201 Tl independent of flow has not been fully defined. Therefore, myocardial accumulation of 201 Tl in response to ischemic-like myocardial injury was assessed in vitro using the cultured fetal mouse heart preparation. Cultured fetal mouse hearts (n . 311) were subjected to injury simulating ischemia by deprivation of oxygen and oxidizable substrates for periods ranging from 15 minutes to 10 hours. The extent of irreversible injury was determined by the percentage of lactic dehydrogenase (LDH) lost from the hearts to the culture medium during recovery from injury. Injury was essentially reversible at 1 hour of insult. The fraction of 201 Tl content in injured compared with control hearts was not significantly lower after 1 hour of insult. By 3 hours of insult, irreversible injury as assessed by loss of LDH was detectable and the extent of injury increased progressively through 10 hours. During the 3-10-hour period of irreversible injury, 201 Tl accumulation within injured hearts compared with controls was related in a monotonically decreasing fashion to the loss of LDH as described by a mathematical kinetic model that fit the observations closely (R2 greater than 0.99). These results indicate that in this organ culture preparation, in which there is effectively an unlimited reservoir of 201 Tl and no confounding effects of perfusion, the time-dependent 201 Tl accumulation is determined by the extent of irreversible injury

Five-level Z-source diode-clamped inverter

DEFF Research Database (Denmark)

Gao, F.; Loh, Poh Chiang; Blaabjerg, Frede

2010-01-01

This study proposes a five-level Z-source diode-clamped inverter designed with two intermediate Z-source networks connected between the dc input sources and rear-end inverter circuitry. By partially shorting the Z-source networks, new operating states not previously reported for two-level Z......-source inverter are introduced here for operating the proposed inverter with voltage buck–boost energy conversion ability and five-level phase voltage switching. These characteristic features are in fact always ensured at the inverter terminal output by simply adopting a properly designed carrier modulation...

Component-Minimized Buck-Boost Voltage Source Inverters

DEFF Research Database (Denmark)

Gao, F.; Loh, P.C.; Blaabjerg, Frede

2007-01-01

This paper presents the design of buck-boost B4 inverters that can be derived from either Ćuk- or SEPIC-derived buck-boost B6 inverters. Unlike traditional inverters, the integration of front-end voltage boost circuitry and inverter circuitry allows it to perform buck-boost voltage inversion...... between capacitors. Modulation wise, the proposed buck-boost B4 inverters can be controlled using a carefully designed carrier-based pulse-width modulation (PWM) scheme that will always ensure balanced threephase outputs as desired, while simultaneously achieving minimal voltage stress across...

Verification of RESRAD-RDD. (Version 2.01)

Energy Technology Data Exchange (ETDEWEB)

Cheng, Jing-Jy [Argonne National Lab. (ANL), Argonne, IL (United States); Flood, Paul E. [Argonne National Lab. (ANL), Argonne, IL (United States); LePoire, David [Argonne National Lab. (ANL), Argonne, IL (United States); Kamboj, Sunita [Argonne National Lab. (ANL), Argonne, IL (United States); Yu, Charley [Argonne National Lab. (ANL), Argonne, IL (United States)

2015-09-01

In this report, the results generated by RESRAD-RDD version 2.01 are compared with those produced by RESRAD-RDD version 1.7 for different scenarios with different sets of input parameters. RESRAD-RDD version 1.7 is spreadsheet-driven, performing calculations with Microsoft Excel spreadsheets. RESRAD-RDD version 2.01 revamped version 1.7 by using command-driven programs designed with Visual Basic.NET to direct calculations with data saved in Microsoft Access database, and re-facing the graphical user interface (GUI) to provide more flexibility and choices in guideline derivation. Because version 1.7 and version 2.01 perform the same calculations, the comparison of their results serves as verification of both versions. The verification covered calculation results for 11 radionuclides included in both versions: Am-241, Cf-252, Cm-244, Co-60, Cs-137, Ir-192, Po-210, Pu-238, Pu-239, Ra-226, and Sr-90. At first, all nuclidespecific data used in both versions were compared to ensure that they are identical. Then generic operational guidelines and measurement-based radiation doses or stay times associated with a specific operational guideline group were calculated with both versions using different sets of input parameters, and the results obtained with the same set of input parameters were compared. A total of 12 sets of input parameters were used for the verification, and the comparison was performed for each operational guideline group, from A to G, sequentially. The verification shows that RESRAD-RDD version 1.7 and RESRAD-RDD version 2.01 generate almost identical results; the slight differences could be attributed to differences in numerical precision with Microsoft Excel and Visual Basic.NET. RESRAD-RDD version 2.01 allows the selection of different units for use in reporting calculation results. The results of SI units were obtained and compared with the base results (in traditional units) used for comparison with version 1.7. The comparison shows that RESRAD

On Invertible Sampling and Adaptive Security

DEFF Research Database (Denmark)

Ishai, Yuval; Kumarasubramanian, Abishek; Orlandi, Claudio

2011-01-01

functionalities was left open. We provide the first convincing evidence that the answer to this question is negative, namely that some (randomized) functionalities cannot be realized with adaptive security. We obtain this result by studying the following related invertible sampling problem: given an efficient...... sampling algorithm A, obtain another sampling algorithm B such that the output of B is computationally indistinguishable from the output of A, but B can be efficiently inverted (even if A cannot). This invertible sampling problem is independently motivated by other cryptographic applications. We show......, under strong but well studied assumptions, that there exist efficient sampling algorithms A for which invertible sampling as above is impossible. At the same time, we show that a general feasibility result for adaptively secure MPC implies that invertible sampling is possible for every A, thereby...

Preparation of inverted medium and processing in the inverted medium

International Nuclear Information System (INIS)

Zafarullah, Ijaz; Tian Minghzen; Chang Tiejun; Randall Babbitt, W.

2007-01-01

The processing of weak optical signals in spatial-spectral holographic (SSH) materials coherently inverted with optical frequency chirped pulses were investigated. Simulations and experimental studies in Tm 3+ :YAG were conducted to characterize the parameters of the frequency chirped laser pulse used to invert the SSH material in order to obtain high photon echo efficiency for SSH lidar processing. Collinear and angled beam geometries and single shot and accumulated processes were investigated. Echo efficiencies as high as 450% were measured, significantly higher than the typical stimulated photon echo efficiency of 10%

Preparation of inverted medium and processing in the inverted medium

Energy Technology Data Exchange (ETDEWEB)

Zafarullah, Ijaz [Department of Physics, Montana State University, Bozeman, MT 59717 (United States)]. E-mail: ijaz@montana.edu; Tian Minghzen [Department of Physics, Montana State University, Bozeman, MT 59717 (United States); Chang Tiejun [The Spectrum Laboratory, Montana State University, Bozeman, MT 59717 (United States); Randall Babbitt, W. [Department of Physics, Montana State University, Bozeman, MT 59717 (United States)

2007-11-15

The processing of weak optical signals in spatial-spectral holographic (SSH) materials coherently inverted with optical frequency chirped pulses were investigated. Simulations and experimental studies in Tm{sup 3+}:YAG were conducted to characterize the parameters of the frequency chirped laser pulse used to invert the SSH material in order to obtain high photon echo efficiency for SSH lidar processing. Collinear and angled beam geometries and single shot and accumulated processes were investigated. Echo efficiencies as high as 450% were measured, significantly higher than the typical stimulated photon echo efficiency of 10%.

Solar Charged Stand Alone Inverter

OpenAIRE

M.Vasugi; Prof R.Jayaraman

2014-01-01

This paper deals with solar powered stand alone inverter which converts the variable dc output of a photovoltaic solar panel into ac that can be fed to loads. Stand alone inverters are used in systems where the inverter get its energy from batteries charged by photo voltaic arrays. A charge controller limits the rate at which electric current is added to or drawn from electric batteries. This charge discharge controller is needed to prevent the battery from being overcharged o...

40 CFR 243.201 - Safety.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

21 CFR 184.1859 - Invert sugar.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Invert sugar. 184.1859 Section 184.1859 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1859 Invert sugar. (a) Invert sugar (CAS Reg. No. 8013-17-0) is an aqueous...

Simplified High-Power Inverter

Science.gov (United States)

Edwards, D. B.; Rippel, W. E.

1984-01-01

Solid-state inverter simplified by use of single gate-turnoff device (GTO) to commutate multiple silicon controlled rectifiers (SCR's). By eliminating conventional commutation circuitry, GTO reduces cost, size and weight. GTO commutation applicable to inverters of greater than 1-kilowatt capacity. Applications include emergency power, load leveling, drives for traction and stationary polyphase motors, and photovoltaic-power conditioning.

Fabricating an organic complementary inverter by integrating two transistors on a single substrate

International Nuclear Information System (INIS)

Wang Jun; Wei Bin; Zhang Jianhua

2008-01-01

Organic complementary inverters were fabricated by integrating two transistors of different electric type on a single substrate. One is a p-type organic heterojunction transistor with a depletion–accumulation mode that acts as a load element. The other is an n-type transistor with an accumulation mode that acts as a drive element. Typical inverter characteristics with a voltage gain of 12 were obtained. Compared with conventional devices, our organic complementary inverter used only one-step patterning of an organic semiconductor, and simultaneously suppressed the leakage current between supply voltage and ground. Therefore, current studies provide a simpler path to fabrication of organic complementary circuits

Aalborg Inverter - A New Type of “Buck in Buck, Boost in Boost” Grid-Tied Inverter

DEFF Research Database (Denmark)

Wu, Weimin; Ji, Junhao; Blaabjerg, Frede

2015-01-01

This paper presents a new family of high efficiency dc/ac grid-tied inverter with a wide variation of input dc voltage. It is a “boost in boost, buck in buck” inverter, meaning that only one power stage works at high frequency in order to achieve minimum switching loss. The minimum voltage drop...... of the filtering inductor in the power loop is achieved to reduce the conduction power loss in both “boost” and “buck” mode. The principle of operation is demonstrated through the analysis on the equivalent circuits of a “half-bridge” single-phase inverter. The theoretical analysis shows that when input dc voltage...... is larger than the magnitude of the ac voltage, it is a voltage-source inverter, and on the contrary it is current-source inverter in the other mode. A 220 V/50 Hz/ 2000 W prototype has been constructed. Simulations and experiments show that it has a good control and system performance....

Current control loop of 3-phase grid-connected inverter

International Nuclear Information System (INIS)

Jabbar, A F; Mansor, M

2013-01-01

This paper presents a comparative study of current control loop in 3-phase inverter which is used to control the active and reactive output power. Generally, current control loop, power control loop and phase lock-loop are the conventional parameters that can be found in an inverter system controlled by the conventional linear control type, for instance proportional (P), integral (I) and derivative (D). If the grid remains stable throughout the day, PID control can be use. However variation of magnitude, frequency, voltage dips, transient, and other related power quality issues occur in a 3-phase grid often affects the control loop. This paper aims to provide an overall review on the available current control techniques used in grid connected system.

Multilevel DC Link Inverter for Brushless Permanent Magnet Motors with Very Low Inductance

International Nuclear Information System (INIS)

Su, G.J.

2001-01-01

Due to their long effective air gaps, permanent magnet motors tend to have low inductance. The use of ironless stator structure in present high power PM motors (several tens of kWs) reduces the inductance even further ( and lt; 100(micro)H). This low inductance imposes stringent current regulation demands for the inverter to obtain acceptable current ripple. An analysis of the current ripple for these low inductance brushless PM motors shows that a standard inverter with the most commonly used IGBT switching devices cannot meet the current regulation demands and will produce unacceptable current ripples due to the IGBT's limited switching frequency. This paper introduces a new multilevel dc link inverter, which can dramatically reduce the current ripple for brushless PM motor drives. The operating principle and design guidelines are included

Performance Evaluation of Three Different Inverter Configurations of DVR for Mitigation of Voltage Events

Directory of Open Access Journals (Sweden)

Miska Prasad

2016-12-01

Full Text Available The voltage events namely voltage sags and voltage swells represent the most common, frequent and important power quality events in today’s power system. Dynamic voltage restorer (DVR is one of the key components used to mitigate the supply voltage quality disturbances in terms of voltage sags and swells in the distribution system. It consists of an energy storage unit, a voltage source inverter, a filter, a coupling transformer and the control system. This paper presents three different inverter configurations of dynamic voltage restorer (DVR for mitigation of voltage events such as voltage sags and swells with sudden addition or removal of the nonlinear load. These three configurations are voltage source inverter based DVR (VSI-DVR, current source inverter based DVR (CSI-DVR and impedance or Z-source inverter based DVR (ZSI-DVR. The d-q control technique is used to control the operation of the DVR. The response of ZSI-DVR for mitigation of voltage sags and swells are investigated and compared with VSI-DVR and CSI-DVR using MATLAB/SIMULINK environment.

Analysis of noise properties of a class of exact methods of inverting the 2-D exponential radon transform

International Nuclear Information System (INIS)

Pan, X.; Metz, C.E.

1995-01-01

A general approach that the authors proposed elsewhere reveals the intrinsic relationship among methods for inversion of the 2-D exponential Radon transform described by Bellini et al., by Tretiak and Metz, by Hawkins et al., and by Inouye et al. Moreover, the approach provides an infinite class of linear methods for inverting the 2-D exponential Radon transform. In the work reported here, they systematically investigated the noise characteristics of the methods in this class, obtaining analytical forms for the autocovariance and the variance of the images reconstructed by use of various methods. The noise properties of a new quasi-optimal method were then compared theoretically to those of other methods of the class. The analysis demonstrates that the quasi-optimal method achieves smaller global variance in the reconstructed images than do the other methods of the class. Extensive numerical simulation studies confirm this prediction

Methane hydrate dissociation using inverted five-spot water flooding method in cubic hydrate simulator

International Nuclear Information System (INIS)

Li, Gang; Li, Xiao-Sen; Li, Bo; Wang, Yi

2014-01-01

The combination forms of the hydrate dissociation methods in different well systems are divided into 6 main patterns. Dissociation processes of methane hydrate in porous media using the inverted five-spot water flooding method (Pattern 4) are investigated by the experimental observation and numerical simulation. In situ methane hydrate is synthesized in the Cubic Hydrate Simulator (CHS), a 5.832-L cubic reactor. A center vertical well is used as the hot water injection well, while the four vertical wells at the corner are the gas and water production wells. The gas production begins simultaneously with the hot water injection, while after approximately 20 min of compression, the water begins to be produced. One of the common characteristics of the inverted five-spot water flooding method is that both the gas and water production rates decrease with the reduction of the hydrate dissociation rate. The evaluation of the energy efficiency ratio might indicate the inverted five-spot water flooding as a promising gas producing method from the hydrate reservoir. - Highlights: • A three-dimensional 5.8-L cubic pressure vessel is developed. • Gas production of hydrate using inverted five-spot flooding method is studied. • Water/gas production rate and energy efficiency ratio are evaluated. • Temperature distributions of numerical simulation and experiment agree well. • Hydrate dissociation process is a moving boundary problem in this study

Online Variable Topology-Type Photovoltaic Grid-Connected Inverter

DEFF Research Database (Denmark)

Wu, Fengjiang; Sun, Bo; Duan, Jiandong

2015-01-01

In photovoltaic (PV) grid-connected generation system, the key focus is how to expand the generation range of the PV array and enhance the total efficiency of the system. This paper originally derived expressions of the total loss and grid current total harmonics distortions of cascaded inverter...... and H-bridge inverter under the conditions of variable output voltage and power of the PV array. It is proved that, compared with the H-bridge inverter, the operation range of the cascaded inverter is wider, whereas the total loss is larger. Furthermore, a novel online variable topology-type grid......-connected inverter is proposed. A bidirectional power switch is introduced into the conventional cascaded inverter to connect the negative terminals of the PV arrays. When the output voltages of the PV arrays are lower, the proposed inverter works under cascaded inverter mode to obtain wider generation range. When...

The effects of inverter magnetic fields on early seed germination of mung beans.

Science.gov (United States)

Huang, Hsin-Hsiung; Wang, Show-Ran

2008-12-01

The biological effects of extremely low frequency magnetic fields (ELF MFs) on living organisms have been explored in many studies. Most of them demonstrate the biological effects caused by 50/60 Hz magnetic fields or pulsed magnetic fields. However, as the development of power electronics flourishes, the magnetic fields induced are usually in other different waveforms. This study aims to assess the effects of magnetic fields generated by inverter systems on the early growth of plants using mung beans as an example. In the experiment, an inverter which can produce sinusoidal pulsed width modulation (SPWM) voltages was used to drive 3 specially made circular coils and an AC motor. Six SPWM voltages with different fundamental frequencies (10, 20, 30, 40, 50, and 60 Hz) set on the inverter drive the circuit to produce the specific kinds of MFs. The results indicate that the magnetic field induced by a 20 or 60 Hz SPWM voltage has an enhancing effect on the early growth of mung beans, but the magnetic fields induced by SPWM voltages of other frequencies (30, 40, and 50 Hz) have an inhibitory effect, especially at 50 Hz.

Clinical evaluation of exercise thallium-201 whole body scintigraphy in ischemic heart disease

International Nuclear Information System (INIS)

Kaneko, Kenzo; Watanabe, Yoshihiko; Kondo, Takeshi

1985-01-01

To evaluate whole body distribution and kinetics of Thallium-201 at exercise and redistribution, whole body scintigraphy (WB-S) was performed on 12 normal subjects (N), 19 patients with angina pectoris (AP) and 18 patients with old myocardial infarction (MI). WB-S was obtained using a gamma camera OMEGA 500 and analized by ADAC System IV. We estimated the following parameters from WB-S; 1) %Distribution (%D): the ratio of whole body counts to organ counts 2) washout rate (WR) in each organ. %D of the heart in N, AP and MI was similar at rest and exercise. At exercise, %D of the lung and the liver decreased and %D of thighs increased remarkably than at rest. At supine exercise, the lung indicated high %D and thinghs indicated low %D compared with at upright exercise. WR of the heart in AP and MI was significantly lower than in N (p<0.005, p<0.01) and further decreased proportionally to the number of stenotic coronary arteries and related to the ischemic ST depression of exercise ECG. WR of the heart was not correlation with pressure rate product and this finding suggested that WR of the heart was not prescribed by the tolerance of exercise but related to coronary flow at exercise a certain degree. WR of the lung in MI was significantly higher (p<0.025) and WR of thighs in AP and MI was significantly lower (p<0.025, p<0.05) compared with N. (author)

Inverted base pavements: construction and performance

KAUST Repository

Papadopoulos, Efthymios

2017-05-11

Inverted base pavements involve a well-compacted granular aggregate base built between a thin asphalt concrete layer and a cement-treated base. Inverted base pavements can be constructed using conventional equipment and procedures but require proper quality control. This study reviews the extensive South African experience and case histories in the USA. Accumulating evidence suggests that inverted base pavements are a viable alternative and can outperform conventional pavements at a lower cost. Inverted base pavements rely on the complementary interaction between layers. The cement-treated base provides a stiff foundation for efficient compaction and constrains the deformation of the stress-sensitive granular aggregate base. The thin asphalt surface layer deforms as a membrane and develops low tensile stress. Additional large-scale field tests should be conducted to assess the performance of inverted base pavement designs in a wide range of conditions relevant to the USA.

48 CFR 24.201 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 24.201 Section 24.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 24.201 Authority. The Freedom of...

Relation of immediate and delayed thallium-201 distribution to localization of iodine-125 antimyosin antibody in acute experimental myocardial infarction

International Nuclear Information System (INIS)

Khaw, B.A.; Strauss, H.W.; Pohost, G.M.; Fallon, J.T.; Katus, H.A.; Haber, E.

1983-01-01

Thallium-201 (TI-201) distribution in acute experimental myocardial infarction (MI) (n . 18) was compared with cardiac-specific antimyosin Fab (AM-Fab) uptake, a specific marker for myocardial necrosis. When antimyosin was injected 4 hours after ligation with TI-201 administered 23 hours 55 minutes later and measurement of myocardial distribution determined 5 minutes after intravenous administration of TI-201, (1) TI-201 distribution closely correlated with microsphere regional blood flow, and (2) an inverse exponential relation to iodine-125 (I-125) AM-Fab uptake was apparent. In another group of 4 animals, TI-201 and AM-Fab were administered intravenously 4 hours after MI, and 36 hours later myocardial distribution was measured. This delayed TI-201 distribution had a close inverse linear correlation with I-125 AM-Fab uptake. This inverse linear relation also was apparent in 28-hour-old MIs in dogs (n . 4) where collateral circulation had been established. TI-201 was administered intravenously at 27 hours after MI, and TI-201 distribution was determined 1 hour later. The present study demonstrated that whereas immediate TI-201 distribution is flow-limited, delayed TI-201 distribution is a marker of cell viability which, due to prolonged circulation time and redistribution, is not flow-limited

D N GAME

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. D N GAME. Articles written in Bulletin of Materials Science. Volume 40 Issue 7 December 2017 pp 1441-1445. Microwave-assisted synthesis and photoluminescence properties of ZnS:Pb 2 + nanophosphor for solid-state lighting · D N GAME C B PALAN N B INGALE S K ...

Aalborg Inverter - A new type of “Buck in Buck, Boost in Boost” Grid-tied Inverter

DEFF Research Database (Denmark)

Wu, Weimin; Blaabjerg, Frede

2013-01-01

This paper presents a new family of high efficiency DC/AC grid-tied inverter with a wide variation of input DC voltage. It is a kind of “Boost in Boost, Buck in Buck” inverter, meaning that only one power stage works at the high frequency to achieve the minimum switching loss. Furthermore......, the minimum filtering inductance in the power loop is achieved to reduce the conduction power loss whether in “Boost” or “Buck” mode. In theory, it can achieve higher efficiency than other inverters under the same condition of input DC voltage. The principle of operation is fully illustrated through...... the analysis on the equivalent circuits of a “three-level” single-phase inverter. Simulations show it has good control performance....

32 CFR 724.201 - Authority.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Authority. 724.201 Section 724.201 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.201 Authority. The Naval Discharge Review Board...

Mitigation Emission Strategy Based on Resonances from a Power Inverter System in Electric Vehicles

Directory of Open Access Journals (Sweden)

Li Zhai

2016-05-01

responsible elements were determined by the calculation through the equivalent circuits. A combination of mitigation strategies including adding common-mode (CM ferrite chokes through the Y-caps and the AC bus bar was designed to mitigate the resonances at 6 MHz, 11 MHz, and 26 MHz related to the CM conducted emission by IGBT switching and the radiated emission of the AC cable. The values of Z11 decreased respectively by 15 dB at 6 MHz, 0.4 dB at 11 MHz, and 11.5 dB at 26 MHz and the values of S21 decreased respectively by 8.6 dB at 6 MHz, 7 dB at 11 MHz, and 6.3 dB at 26 MHz. An equivalent model of the power inverter system for real-time simulation in time domain was built to validate the mitigation strategy in simulation software PSPICE.

43 CFR 20.201 - Ethics officials.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section 20.201... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The...

Simple hardware implementation of voltage balancing in capacitor-clamped inverter

Czech Academy of Sciences Publication Activity Database

Kokeš, Petr; Semerád, Radko

2009-01-01

Roč. 54, č. 4 (2009), s. 325-341 ISSN 0001-7043 R&D Projects: GA MPO FT-TA4/077 Institutional research plan: CEZ:AV0Z20570509 Keywords : capacitor -clamped multilevel inverter * flying capacitor voltage balancing * pulse width modulation (PWM) Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

Quantitative evaluation of right ventricular overload with thallium-201 myocardial perfusion scintigraphy

International Nuclear Information System (INIS)

Watanabe, Toshiya; Miyakoda, Hiroyuki; Koike, Yoshihiro; Itatsu, Hidetaka; Kawai, Naoki; Sotobata, Iwao.

1983-01-01

Thallium-201 myocardial perfusion scintigraphy and right-heart catheterization were performed on patients with right ventricular pressure overload (RVPO) or right ventricular volume overload (RVVO). In 18 patients with RVPO, right ventricular systolic pressure correlated significantly both with the RV/LV wall thallium-201 uptake ratios (r=0.54, p<0.02) and the RV wall/background thallium-201 uptake ratios (r=0.70, p<0.01). RV/LV work ratios also significantly correlated with RV/LV wall thallium-201 uptake ratios (r=0.57, p<0.02). In 19 patients with RVVO, Qp/Qs and RV/LV work ratios both significantly correlated with RV/LV wall thallium-201 uptake ratios (r=0.78 and 0.87, respectively; p<0.001 for both) and RV wall/background thallium-201 uptake ratios (r=0.69, p<0.01 for both parameters). Right ventricular systolic pressure also correlated with RV/LV wall thallium-201 uptake ratios (r=0.57, p<0.02). Feasibility of the differentiation between RVPO and RVVO was suggested with use of ''transitional view angle'' and RV/LV diameter ratios obtained from the scintigram. In patients who underwent cardiac surgery, post-operative alleviations of the right ventricular overload were evaluated. There was a significant decrease in RV/LV wall thallium-201 uptake ratios, but no significant decrease in RV wall/background thallium-201 uptake ratios in patients with RVPO. On the other hand, there was a significant decrease both in RV/LV wall thallium-201 uptake ratios and RV wall/background thallium-201 uptake ratios in patients with RVVO. No significant changes were observed between the scintigraphic measurements obtained 1 month and 1 year after the surgery, irrespective of the type of right ventricular overloading. (J.P.N.)

43 CFR 17.201 - Application.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 17.201 Section 17.201 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED PROGRAMS OF THE DEPARTMENT OF THE INTERIOR Nondiscrimination on the Basis of Handicap § 17.201 Application...

46 CFR 16.201 - Application.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Application. 16.201 Section 16.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN CHEMICAL TESTING Required Chemical Testing § 16.201 Application. (a) Chemical testing of personnel must be conducted as required by this...

In-phantom dosimetry using the 13C(d,n)14N reaction for BNCT (boron neutron capture therapy)

International Nuclear Information System (INIS)

Burlon, Alejandro; Kreiner, Andres J.; White, S.; Blackburn, B.; Gierga, David; Yanch, Jacquelyn C.

2000-01-01

The use of the 13 C(d,n) 14 N reaction at E d =1.5 MeV for accelerator-based boron neutron capture therapy is investigated. The 13 C(d,n) 14 N reaction presents the advantages of carbon as a target material and its large cross section. The deuteron beam was produced by a tandem accelerator at MIT's Laboratory for Accelerator Beam Applications. The resulting neutron spectra were evaluated in terms of RBE-dose rates at different depths inside a water-filled brain phantom using a heavy water moderator and lead reflector assembly. All results were simulated using the code MCNP. (author)

High-gain subnanowatt power consumption hybrid complementary logic inverter with WSe2 nanosheet and ZnO nanowire transistors on glass.

Science.gov (United States)

Shokouh, Seyed Hossein Hosseini; Pezeshki, Atiye; Ali Raza, Syed Raza; Lee, Hee Sung; Min, Sung-Wook; Jeon, Pyo Jin; Shin, Jae Min; Im, Seongil

2015-01-07

A 1D-2D hybrid complementary logic inverter comprising of ZnO nanowire and WSe2 nanosheet field-effect transistors (FETs) is fabricated on glass, which shows excellent static and dynamic electrical performances with a voltage gain of ≈60, sub-nanowatt power consumption, and at least 1 kHz inverting speed. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Rational Design of Molecular Hole-Transporting Materials for Perovskite Solar Cells: Direct versus Inverted Device Configurations.

Science.gov (United States)

Grisorio, Roberto; Iacobellis, Rosabianca; Listorti, Andrea; De Marco, Luisa; Cipolla, Maria Pia; Manca, Michele; Rizzo, Aurora; Abate, Antonio; Gigli, Giuseppe; Suranna, Gian Paolo

2017-07-26

Due to a still limited understanding of the reasons making 2,2',7,7'-tetrakis(N,N-di-p-methoxyphenylamine)-9,9'-spirobifluorene (Spiro-OMeTAD) the state-of-the-art hole-transporting material (HTM) for emerging photovoltaic applications, the molecular tailoring of organic components for perovskite solar cells (PSCs) lacks in solid design criteria. Charge delocalization in radical cationic states can undoubtedly be considered as one of the essential prerequisites for an HTM, but this aspect has been investigated to a relatively minor extent. In marked contrast with the 3-D structure of Spiro-OMeTAD, truxene-based HTMs Trux1 and Trux2 have been employed for the first time in PSCs fabricated with a direct (n-i-p) or inverted (p-i-n) architecture, exhibiting a peculiar behavior with respect to the referential HTM. Notwithstanding the efficient hole extraction from the perovskite layer exhibited by Trux1 and Trux2 in direct configuration devices, their photovoltaic performances were detrimentally affected by their poor hole transport. Conversely, an outstanding improvement of the photovoltaic performances in dopant-free inverted configuration devices compared to Spiro-OMeTAD was recorded, ascribable to the use of thinner HTM layers. The rationalization of the photovoltaic performances exhibited by different configuration devices discussed in this paper can provide new and unexpected prospects for engineering the interface between the active layer of perovskite-based solar cells and the hole transporters.

7 CFR 201.42 - Small containers.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...

5 CFR 2601.201 - Delegation.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Delegation. 2601.201 Section 2601.201... § 2601.201 Delegation. (a) The authority to solicit, accept, and utilize gifts in accordance with this... in accordance with paragraph (b) of this section may be redelegated only through a written delegation...

7 CFR 201.20 - Germination.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed present...

49 CFR 393.201 - Frames.

Science.gov (United States)

2010-10-01

... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...

28 CFR 31.201 - Audit.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial and...

19 CFR 201.140 - Employment.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

5 CFR 532.201 - Definitions.

Science.gov (United States)

2010-01-01

... establishments in the private sector by personal visit of data collectors. Host activity is the local Federal... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 532.201 Section 532.201... Prevailing Rate Determinations § 532.201 Definitions. For the purposes of this part: Full-scale survey means...

CLOSED LOOP CONTROL OF EMBEDDED Z-SOURCE INVERTER WITH FUZZY CONTROLLER FOR SOLAR PV APPLICATIONS

OpenAIRE

Midde Mahesh*, K. Leleedhar Rao

2017-01-01

This paper proposes the use of Embedded Z –source inverter system with fuzzy controller for Solar Photo Voltaic (PV) applications with adjustable speed drives. Closed loop operation FUZZY control strategies of EZSI system are proposed. EZSI produces the same voltage gain as Z-source inverter (ZSI) but due to the DC sources embedded within the X- shaped impedance network, it has the added advantage of inherent source filtering capability and also reduced capacitor sizing. This can be achiev...

Formation of O2-methylthymine in poly(dA-dT) on methylation with N-methyl-N-nitrosourea and dimethyl sulphate. Evidence that O2-methylthymine does not miscode during DNA synthesis.

Science.gov (United States)

Saffhill, R; Abbott, P J

1978-01-01

The alternating co-polymer has been methylated with either N methyl-N-nitrosourea (MNU) or dimethyl sulphate (DMS) and the levels of the various methylated thymidines (O2-methylthymidine, 3-methylthymidine and O4-methylthymidine) measured. MNU produced all three compounds whereas DMS only produced 3-methylthymidine and O2-methylthymidine at detectable levels. These results have been combined with our earlier results concerning the misincorporation of dGMP with E. coli DNA polymerase using MNU-methylated poly(dA-dT). These results indicate that O2-methylthymidine does not miscode during DNA synthesis. PMID:353735

Efficient/reliable dc-to-dc inverter circuit

Science.gov (United States)

Pasciutti, E. R.

1970-01-01

Feedback loop, which contains an inductor in series with a saturable reactor, is added to a standard inverter circuit to permit the inverter power transistors to be switched in a controlled and efficient manner. This inverter is applicable where the power source has either high or low impedance properties.

7 CFR 201.63 - Germination.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested. Mean...

ITER vacuum vessel design (D201 subtask 1.3 and subtask 3). Final report

International Nuclear Information System (INIS)

1996-01-01

ITER Task No. D201, Vacuum Vessel Design (Subtask 1.3 and Subtask 3), was initiated to propose and evaluate local vacuum vessel reinforcement alternatives in proximity to the Neutral Beam, Radial Mid-Plane, Top, and Divertor Ports. These areas were reported to be highly stressed regions based on the results of preliminary stress analyses performed by the USHT (US Home Team) and the ITER Joint Central Team (JCT) at the Garching JWS (Joint Work Site). Initial design activities focused on the divertor port region which was reported to experience the highest stress intensities. Existing stress analysis models and results were reviewed with the USHT stress analysts to obtain an overall understanding of the vessel response to the various applied loads. These reviews indicated that the reported stress intensities in the divertor port region were significantly affected by the loads applied to the vessel in adjacent regions

Modulation Technique for Four-Leg Voltage Source Inverter without a Look-Up Table

DEFF Research Database (Denmark)

Ebrahimzadeh, Esmaeil; Farhangi, Shahrokh; Iman-Eini, Hossein

2016-01-01

Three-dimensional space-vector modulation (3D SVM) has more popularity among the other modulation techniques of the four-leg inverter due to higher DC-link voltage utilisation. Sequencing schemes of the switching vectors in the 3D SVM are divided into Class I and II categories. Each of these clas...

Prognostic value of thallium-201 myocardial perfusion imaging in patients with unstable angina who respond to medical treatment

International Nuclear Information System (INIS)

Brown, K.A.

1991-01-01

Although the prognostic value of thallium-201 imaging is well established, its ability to risk stratify patients who present with unstable angina is unclear. Fifty-two consecutive patients admitted with unstable angina who responded to medical treatment and underwent stress thallium-201 imaging within 1 week of discharge were studied. Patients were followed up for 39 +/- 11 months. Cardiac events included cardiac death (n = 3), nonfatal myocardial infarction (n = 4) and admission for unstable angina or revascularization (n = 17). The ability of thallium-201 data (redistribution, fixed defects, normal) to predict cardiac events was compared with clinical data (age, gender, prior myocardial infarction, anginal syndrome, rest and stress electrocardiogram) and cardiac catheterization data using logistic regression. Thallium-201 redistribution was the only significant predictor of cardiac death or nonfatal myocardial infarction (p less than 0.05). The number of myocardial segments with thallium-201 redistribution (p less than 0.0005) and a history of prior myocardial infarction (p less than 0.05) were the only significant predictors of all cardiac events. Cardiac death or nonfatal myocardial infarction occurred more frequently in patients with thallium-201 redistribution (6 [26%] of 23) than in those without redistribution (1 [3%] of 29, p less than 0.05). Similarly, total cardiac events developed more frequently in patients with thallium-201 redistribution (p less than 0.001). Stress thallium-201 imaging has important prognostic value in patients admitted with unstable angina who respond to medical therapy and can identify subgroups at high versus low risk for future cardiac events

High voltage series resonant inverter ion engine screen supply. [SCR series resonant inverter for space applications

Science.gov (United States)

Biess, J. J.; Inouye, L. Y.; Shank, J. H.

1974-01-01

A high-voltage, high-power LC series resonant inverter using SCRs has been developed for an Ion Engine Power Processor. The inverter operates within 200-400Vdc with a maximum output power of 2.5kW. The inverter control logic, the screen supply electrical and mechanical characteristics, the efficiency and losses in power components, regulation on the dual feedback principle, the SCR waveforms and the component weight are analyzed. Efficiency of 90.5% and weight density of 4.1kg/kW are obtained.

17 CFR 201.54 - Settlement.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.54 Section 201... Regulations Pertaining to the Equal Access to Justice Act § 201.54 Settlement. The applicant and counsel for the Office or Division of the Commission may agree on a proposed settlement of the award before final...

Inverted spin sequences in the spectra of odd-odd nuclei in the 2S-1d and 2P-1f shells

International Nuclear Information System (INIS)

Sharma, Arvind; Sharma, S.D.

1990-01-01

In case of odd-odd nuclei, near magic numbers, there are found inverted sequences as well as few rotational members. In order to explain the unique feature of the spectra of odd-odd nuclei, we have applied modified form of rotational-vibrational model with two parameters A and B. It is found that level orders in inverted as well as in rotational sequences are very well reproduced on the basis of this model. In case of inverted spin sequences, the sign of B is found to be positive. The ratio of B/A is ≅ 10 -2 as compared to its value of the order of 10 -3 in case of even-even and odd-A nuclei. We infer that pair correlations are responsible for these invertions. The simple model applied here worked well to predict these inverted spectra. (author)

Obtaining the neutron time-of-flight instrument response function for a single D-T neutron utilizing n-alpha coincidence from the d(t, α) n nuclear reaction

Science.gov (United States)

Styron, Jedediah; Ruiz, Carlos; Hahn, Kelly; Cooper, Gary; Chandler, Gordon; Jones, Brent; McWatters, Bruce; Smith, Jenny; Vaughan, Jeremy

2017-10-01

A measured neutron time-of-flight (nTOF) signal is a convolution of the neutron reaction history and the instrument response function (IRF). For this work, the IRF was obtained by measuring single, D-T neutron events by utilizing n-alpha coincidence. The d(t, α) n nuclear reaction was produced at Sandia National Laboratories' Ion Beam Laboratory using a 300-keV Cockroft-Walton generator to accelerate a 2- μA beam, of 175-keV D + ions, into a stationary, 2.6- μm, ErT2 target. Comparison of these results to those obtained using cosmic-rays and photons will be discussed. Sandia National Laboratories.

Drosophila mutations at the mei-9 and mus(2)201 loci which block excision of thymine dimers also block induction of unscheluded DNA synthesis by methyl methanesulfonate, ethyl methanesulfonate, N-methyl-N-nitrosourea, UV light and X-rays

International Nuclear Information System (INIS)

Dusenbery, R.L.; McCormick, S.C.; Smith, P.D.

1983-01-01

The mei-9 and mus(2)201 mutants of Drosophila melanogaster were identified as mutagen-sensitive mutants on the basis of larval hypersensitivity to methyl methanesulfonate and characterized as excision repair-deficient on the basis of a greatly reduced capacity to excise thymine dimers from cellular DNA. The high degree of larval cytotoxicity observed with a variety of other chemical and physical agents indicated that these mutants may be unable to excise other important classes of DNA adducts. We have measured the ability of the single mutants and the double mutant combination mei-9;mus(2)201 to perform the resynthesis step in excision repair by means of an autoradiographic analysis of unscheduled DNA synthesis (UDS) induced in a mixed population of primary cells in culture. The 3 strains exhibit no detectable UDS activity in response to applied doses of 1.5-6.0 mM methyl methanesulfonate, 1.0-4.5 nM N-methyl-N-nitrosourea or 10-40 J/m 2 254-nm UV light, dose ranges in which control cells exhibit a strong dose-dependent UDS response. The mei-9 and mei-9;mus(2)201 mutants also have no detectable UDS response to X-ray doses of 300-1.800 rad, whereas the mus(2)201 mutant exhibits a reduced, but dose-dependent, response over this range. These data correlate well with the degree of larval hypersensitivity of the strains and suggest that mutations at both loci block the excision repair of a wide variety of DNA damage prior to the resynthesis step. (orig.)

Theoretical study of inverted sandwich type complexes of 4d transition metal elements: interesting similarities to and differences from 3d transition metal complexes.

Science.gov (United States)

Kurokawa, Yusaku I; Nakao, Yoshihide; Sakaki, Shigeyoshi

2012-03-08

Inverted sandwich type complexes (ISTCs) of 4d metals, (μ-η(6):η(6)-C(6)H(6))[M(DDP)](2) (DDPH = 2-{(2,6-diisopropylphenyl)amino}-4-{(2,6-diisopropylphenyl)imino}pent-2-ene; M = Y, Zr, Nb, Mo, and Tc), were investigated with density functional theory (DFT) and MRMP2 methods, where a model ligand AIP (AIPH = (Z)-1-amino-3-imino-prop-1-ene) was mainly employed. When going to Nb (group V) from Y (group III) in the periodic table, the spin multiplicity of the ground state increases in the order singlet, triplet, and quintet for M = Y, Zr, and Nb, respectively, like 3d ISTCs reported recently. This is interpreted with orbital diagram and number of d electrons. However, the spin multiplicity decreases to either singlet or triplet in ISTC of Mo (group VI) and to triplet in ISTC of Tc (group VII), where MRMP2 method is employed because the DFT method is not useful here. These spin multiplicities are much lower than the septet of ISTC of Cr and the nonet of that of Mn. When going from 3d to 4d, the position providing the maximum spin multiplicity shifts to group V from group VII. These differences arise from the size of the 4d orbital. Because of the larger size of the 4d orbital, the energy splitting between two d(δ) orbitals of M(AIP) and that between the d(δ) and d(π) orbitals are larger in the 4d complex than in the 3d complex. Thus, when occupation on the d(δ) orbital starts, the low spin state becomes ground state, which occurs at group VI. Hence, the ISTC of Nb (group V) exhibits the maximum spin multiplicity.

Thallium 201 Scintigraphy

Science.gov (United States)

McKillop, James H.

1980-01-01

The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging. The main clinical application of 201TI scintigraphy has been in myocardial imaging. Abnormal uptake of the isotope results in a cold spot on the myocardial image. In patients with coronary artery disease, the differentiation of ischemic and infarcted myocardium is made by comparing images obtained after injecting the radionuclide at the peak of a maximal exercise test with those obtained after injection at rest. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. Some investigators believe that redistribution images obtained four to six hours after stress injection (without administering further 201TI) give the same information as a separate rest study. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 percent to 95 percent, though computer processing of the images may be necessary to achieve the higher figure. The prediction of the extent of coronary disease from 201TI images is less reliable. An abnormal 201TI image is not entirely specific for coronary artery disease and the likelihood of an abnormal image being due to this diagnosis varies according to the clinical circumstances. The main clinical value of 201TI myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most

Modulation of Current Source Inverter

Directory of Open Access Journals (Sweden)

Golam Reza Arab Markadeh

2011-04-01

Full Text Available Direct torque control with Current Source Inverter (CSI instead of voltage source inverter is so appropriate because of determining the torque of induction motor with machine current and air gap flux. In addition, Space-Vector Modulation (SVM is a more proper method for CSI because of low order harmonics reduction, lower switching frequency and easier implementation. This paper introduces the SVM method for CSI and uses the proposed inverter for vector control of an induction motor. The simulation results illustrate fast dynamic response and desirable torque and speed output. Fast and accurate response to changes of speed and load torque reference completely proves the prominence of this method.

Detecting and mitigating inverter aging

International Nuclear Information System (INIS)

Gunther, W.E.; Taylor, J.H.; Aggarwal, S.K.

1988-01-01

Nuclear power plants use inverters to supply power to safety-related equipment, instrumentation, and controls. They convert direct current (dc) to alternating current (ac) power, thereby making low voltage ac power available even under a station blackout condition. As part of the U.S. NRC's nuclear plant aging research (NPAR) program, the operating experience of this equipment has been analyzed to determine the dominant failure modes and causes. This paper summarizes that data, and then describes methods which can be employed to detect inverter degradation prior to failure, as well as methods to minimize the failure effects. In both cases, the mitigation of inverter aging is emphasized

Diode-Assisted Buck-Boost Current Source Inverters

DEFF Research Database (Denmark)

Gao, F.; Cai, Liang; Loh, P.C.

2007-01-01

This paper presents a couple of novel current source inverters (CSIs) with the enhanced current buckboost capability. With the unique diode-inductor network added between current source inverter circuitry and current boost elements, the proposed buck-boost current source inverters demonstrate...... uninfluenced. Lastly, all theoretical findings were verified experimentally using constructed laboratory prototypes....

A Single Phase Doubly Grounded Semi-Z-Source Inverter for Photovoltaic (PV Systems with Maximum Power Point Tracking (MPPT

Directory of Open Access Journals (Sweden)

Tofael Ahmed

2014-06-01

Full Text Available In this paper, a single phase doubly grounded semi-Z-source inverter with maximum power point tracking (MPPT is proposed for photovoltaic (PV systems. This proposed system utilizes a single-ended primary inductor (SEPIC converter as DC-DC converter to implement the MPPT algorithm for tracking the maximum power from a PV array and a single phase semi-Z-source inverter for integrating the PV with AC power utilities. The MPPT controller utilizes a fast-converging algorithm to track the maximum power point (MPP and the semi-Z-source inverter utilizes a nonlinear SPWM to produce sinusoidal voltage at the output. The proposed system is able to track the MPP of PV arrays and produce an AC voltage at its output by utilizing only three switches. Experimental results show that the fast-converging MPPT algorithm has fast tracking response with appreciable MPP efficiency. In addition, the inverter shows the minimization of common mode leakage current with its ground sharing feature and reduction of the THD as well as DC current components at the output during DC-AC conversion.

Live Imaging of Shoot Meristems on an Inverted Confocal Microscope Using an Objective Lens Inverter Attachment

Science.gov (United States)

Nimchuk, Zachary L.; Perdue, Tony D.

2017-01-01

Live imaging of above ground meristems can lead to new insights in plant development not possible from static imaging of fixed tissue. The use of an upright confocal microscope offers several technical and biological advantages for live imaging floral or shoot meristems. However, many departments and core facilities possess only inverted confocal microscopes and lack the funding for an additional upright confocal microscope. Here we show that imaging of living apical meristems can be performed on existing inverted confocal microscopes with the use of an affordable and detachable InverterScope accessory. PMID:28579995

Live Imaging of Shoot Meristems on an Inverted Confocal Microscope Using an Objective Lens Inverter Attachment.

Science.gov (United States)

Nimchuk, Zachary L; Perdue, Tony D

2017-01-01

Live imaging of above ground meristems can lead to new insights in plant development not possible from static imaging of fixed tissue. The use of an upright confocal microscope offers several technical and biological advantages for live imaging floral or shoot meristems. However, many departments and core facilities possess only inverted confocal microscopes and lack the funding for an additional upright confocal microscope. Here we show that imaging of living apical meristems can be performed on existing inverted confocal microscopes with the use of an affordable and detachable InverterScope accessory.

DC-to-AC inverter ratio failure detector

Science.gov (United States)

Ebersole, T. J.; Andrews, R. E.

1975-01-01

Failure detection technique is based upon input-output ratios, which is independent of inverter loading. Since inverter has fixed relationship between V-in/V-out and I-in/I-out, failure detection criteria are based on this ratio, which is simply inverter transformer turns ratio, K, equal to primary turns divided by secondary turns.

Analysis to Inform CA Grid Integration Rules for PV: Final Report on Inverter Settings for Transmission and Distribution System Performance

Energy Technology Data Exchange (ETDEWEB)

Smith, Jeff [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Rylander, Matthew [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Boemer, Jens [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mather, Barry [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-09-01

The fourth solicitation of the California Solar Initiative (CSI) Research, Development, Demonstration and Deployment (RD&D) Program established by the California Public Utilities Commission (CPUC) supported the Electric Power Research Institute (EPRI), National Renewable Energy Laboratory (NREL), and Sandia National Laboratories (SNL) with data provided from Pacific Gas and Electric (PG&E), Southern California Edison (SCE), and San Diego Gas and Electric (SDG&E) conducted research to determine optimal default settings for distributed energy resource advanced inverter controls. The inverter functions studied are aligned with those developed by the California Smart Inverter Working Group (SIWG) and those being considered by the IEEE 1547 Working Group. The advanced inverter controls examined to improve the distribution system response included power factor, volt-var, and volt-watt. The advanced inverter controls examined to improve the transmission system response included frequency and voltage ride-through as well as Dynamic Voltage Support. This CSI RD&D project accomplished the task of developing methods to derive distribution focused advanced inverter control settings, selecting a diverse set of feeders to evaluate the methods through detailed analysis, and evaluating the effectiveness of each method developed. Inverter settings focused on the transmission system performance were also evaluated and verified. Based on the findings of this work, the suggested advanced inverter settings and methods to determine settings can be used to improve the accommodation of distributed energy resources (PV specifically). The voltage impact from PV can be mitigated using power factor, volt-var, or volt-watt control, while the bulk system impact can be improved with frequency/voltage ride-through.

Clinical significance of normal exercise thallium-201 myocardial scintigraphy in subjects with abnormal exercise electrocardiographic findings

International Nuclear Information System (INIS)

Matsuo, Takeshi; Nishimura, Tsunehiko; Uehara, Toshiisa; Hayashida, Kohei; Chiba, Hiroshi; Mitani, Isao; Saito, Muneyasu; Sumiyoshi, Tetsuya

1988-01-01

The relationship between exercise thallium-201 scintigraphic findings and clinical features (chest pain, risk factors, resting electrocardiography, exercise electrocardiography and prognosis) was studied in the 234 patients with profound ST-segment depression (J 80 ≥ -2 mm) or negative U wave in exercise electrocardiography. We classified these cases into two groups by exercise thallium perfusion; (I) normal thallium-201 perfusion (n = 24), (II) abnormal thallium-201 perfusion (n = 210). The incidence of female in group I was larger than that in group II. In resting electrocardiography, left ventricular hypertrophy was found more frequent in group I. In exercise electrocardiography, most of ST-segment depression in group I revealed up-slope type and a rapid recovery to baseline. Group I had lower incidence of cardiac events (cardiac death, nonfatal myocardial infarction, percutaneous transluminal coronary angioplasty, coronary artery bypass grafting). In conclusion, normal thallium-201 perfusion in exercise thallium-201 scintigraphy was more useful indicator for prognosis, even if the patients had the findings of profound ST-segment depression or negative U wave in exercise electrocardiography. (author)

Dual-view inverted selective plane illumination microscopy (diSPIM) with improved background rejection for accurate 3D digital pathology

Science.gov (United States)

Hu, Bihe; Bolus, Daniel; Brown, J. Quincy

2018-02-01

Current gold-standard histopathology for cancerous biopsies is destructive, time consuming, and limited to 2D slices, which do not faithfully represent true 3D tumor micro-morphology. Light sheet microscopy has emerged as a powerful tool for 3D imaging of cancer biospecimens. Here, we utilize the versatile dual-view inverted selective plane illumination microscopy (diSPIM) to render digital histological images of cancer biopsies. Dual-view architecture enabled more isotropic resolution in X, Y, and Z; and different imaging modes, such as adding electronic confocal slit detection (eCSD) or structured illumination (SI), can be used to improve degraded image quality caused by background signal of large, scattering samples. To obtain traditional H&E-like images, we used DRAQ5 and eosin (D&E) staining, with 488nm and 647nm laser illumination, and multi-band filter sets. Here, phantom beads and a D&E stained buccal cell sample have been used to verify our dual-view method. We also show that via dual view imaging and deconvolution, more isotropic resolution has been achieved for optical cleared human prostate sample, providing more accurate quantitation of 3D tumor architecture than was possible with single-view SPIM methods. We demonstrate that the optimized diSPIM delivers more precise analysis of 3D cancer microarchitecture in human prostate biopsy than simpler light sheet microscopy arrangements.

Choose your business partners carefully. The bankruptcy of the current inverter producer RES affected many of its business partners; Drum pruefe, wer sich bindet. Wie die Insolvenz des Wechselrichterherstellers RES eine Vielzahl an Geschaedigten schafft

Energy Technology Data Exchange (ETDEWEB)

Rutschmann, I.

2008-02-15

Customers of the RES GmbH current inverter producer complained about disturbances, outages, and low yields. Now, the producer has filed for insolvency; business partners will probably lose their warranty claim and also their contact for repair and replacement parts. IPE, a partner fitter's company, even fears of going bankrupt too. All partners agree that in the future, they will limit their business activities to partners they know better. (orig.)

NREL Evaluates Advanced Solar Inverter Performance for Hawaiian Electric

Science.gov (United States)

Companies | Energy Systems Integration Facility | NREL NREL Evaluates Advanced Solar Inverter Performance for Hawaiian Electric Companies NREL Evaluates Advanced Solar Inverter Performance for Hawaiian performance and impacts of today's advanced solar inverters, as well as proprietary feedback to the inverter

A low temperature investigation of the gas-phase N(2D) + NO reaction. Towards a viable source of N(2D) atoms for kinetic studies in astrochemistry.

Science.gov (United States)

Nuñez-Reyes, Dianailys; Hickson, Kevin M

2018-06-18

The gas-phase reaction of metastable atomic nitrogen N(2D) with nitric oxide has been investigated over the 296-50 K temperature range using a supersonic flow reactor. As N(2D) could not be produced photolytically in the present work, these excited state atoms were generated instead through the C(3P) + NO → N(2D) + CO reaction while C(3P) atoms were created in situ by the 266 nm pulsed laser photolysis of CBr4 precursor molecules. The kinetics of N(2D) atoms were followed on-resonance by vacuum ultraviolet laser induced fluorescence at 116.7 nm. The measured rate constants for the N(2D) + NO reaction are in excellent agreement with most of the earlier work at room temperature and represent the only available kinetic data for this process below 296 K. The rate constants are seen to increase slightly as the temperature falls to 100 K with a more substantial increase at even lower temperature; a finding which is not reproduced by theoretical work. The prospects for using this chemical source of N(2D) atoms in future studies of a wide range of N(2D) atom reactions are discussed.

Pulsewidth-modulated 2-source neutral-point-clamped inverter

DEFF Research Database (Denmark)

Blaabjerg, Frede; Loh, Poh Chang; Gao, Feng

2007-01-01

This paper presents the careful integration of a newly proposed Z-source topological concept to the basic neutral-point-clamped (NPC) inverter topology for designing a three-level inverter with both voltage-buck and voltage-boost capabilities. The designed Z-source NPC inverter uses two unique X......-shaped inductance-capacitance (LC) impedance networks that are connected between two isolated dc input power sources and its inverter circuitry for boosting its AC output voltage. Through the design of an appropriate pulsewidth-modulation (PWM) algorithm, the two impedance networks can be short......-circuited sequentially (without shooting through the inverter full DC link) for implementing the ldquonearest-three-vectorrdquo modulation principle with minimized harmonic distortion and device commutations per half carrier cycle while performing voltage boosting. With only a slight modification to the inverter PWM...

7 CFR 201.41 - Bags.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Bags. 201.41 Section 201.41 Agriculture Regulations of... Sampling in the Administration of the Act § 201.41 Bags. (a) For lots of six bags or less, each bag shall be sampled. A total of at least five trierfuls shall be taken. (b) For lots of more than six bags...

32 CFR 48.201 - Options.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Options. 48.201 Section 48.201 National Defense...'S FAMILY PROTECTION PLAN Election of Options § 48.201 Options. As provided in § 48.203, a member may... amount equal to such 121/2 per centum. (a) Option 1 is an annuity payable to or on behalf of his widow...

Dicty_cDB: VHO201 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

Implementation of floating gate MOSFET in inverter for threshold voltage tunability

Directory of Open Access Journals (Sweden)

Musa F.A.S.

2017-01-01

Full Text Available This paper presents the ability of floating gate MOSFET (FGMOS threshold voltage to be programmed or tuned which is exploited to improve the performance of electronic circuit design. This special characteristic owns by FGMOS is definitely contributes towards low voltage and low power circuit design. The comparison of threshold voltage between FGMOS and conventional NMOS is done in order to prove that FGMOS is able to produce a lower threshold voltage compared to conventional NMOS. In addition, in this paper, an implementation of FGMOS into inverter circuit is also done to show the programmability of FGMOS threshold voltage. The operations of the inverter circuits are verified using Sypnopsys simulation in 0.1μm CMOS technology with supply voltage of 1.8V.

48 CFR 1318.201 - Contingency operation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contingency operation. 1318.201 Section 1318.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 1318.201 Contingency...

41 CFR 50-201.101 - Employees affected.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employees affected. 50-201.101 Section 50-201.101 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.101 Employees...

On Stability of Voltage Source Inverters in Weak Grids

DEFF Research Database (Denmark)

Adib, Aswad; Mirafza, Behrooz; Wang, Xiongfei

2018-01-01

As the number of inverters increases in the power grid, the stability of grid-tied inverters becomes an important concern for the power industry. In particular, a weak grid can lead to voltage fluctuations at the inverter terminals and consequently cause inverter instability. In this paper, impac...

Hardness of deriving invertible sequences from finite state machines

DEFF Research Database (Denmark)

Hierons, Robert M.; Mousavi, Mohammad Reza; Thomsen, Michael Kirkedal

2017-01-01

invertible sequences; these allow one to construct additional UIOs once a UIO has been found. We consider three optimisation problems associated with invertible sequences: deciding whether there is a (proper) invertible sequence of length at least K; deciding whether there is a set of invertible sequences...

Variación espacial y temporal en la composición de la dieta de peces invertívoros en un río neotropical, Venezuela

Directory of Open Access Journals (Sweden)

Mario Ortaz

2011-09-01

Full Text Available La ictiofauna invertívora es un componente importante en los ríos neotropicales y representa un enlace entre los invertebrados acuáticos y los piscívoros. En el presente trabajo se evaluó la amplitud y sobreposición interespecífica de dieta de nueve especies de peces invertívoros durante tres fases hidrológicas consecutivas: descenso (diciembre/07, enero/08, febrero/08, marzo/08, aguas bajas (abril/08 y ascenso de aguas (junio/08 en dos secciones de un río venezolano ubicadas a distinta altitud (subcuenca alta, SA y subcuenca baja, SB. Los peces se recolectaron con una red de cerco (0.5cm entrenudos entre las 8:00 y 11:00 horas. La dieta de cada especie se evaluó usando un índice de importancia relativa (IIR que incluyó el número, peso y frecuencia de ocurrencia de los items consumidos. Para estimar la amplitud y sobreposición interespecífica de dieta se emplearon los índices de Levín (Bi y Morisita (IM, respectivamente. Todas las estimaciones se realizaron con la frecuencia numérica de las presas consumidas. Se capturaron nueve especies, ocho Characiformes, tres en SA (Knodus deuteronoides, Creagrutus bolivari y C. melasma y cinco en SB (Thoracocharax stellatus, Moenkhausia lepidura, Cheirodon pulcher, Ctenobrycon spilurus y Aphyocharax alburnus y un Cyprinodontiformes (Poecilia reticulata, capturada en SA. En SA el principal recurso consumido fueron insectos acuáticos mientras que el material vegetal y los artrópodos terrestres fueron recursos secundarios. En SB, las especies consumieron estos items además de zooplancton (Copepoda, Cladocera y estadios larvales de crustáceos Decapoda, pero hubo una sustitución temporal con un predominio de zooplancton en descenso y aguas bajas. En general, la amplitud de la dieta disminuyó en descenso de aguas en ambas secciones e incrementó en ascenso de aguas. Sin embargo, la amplitud promedio fue mayor en SA. La sobreposición interespecífica de dieta fue alta en SA mientras que

A Hybrid, Current-Source/Voltage-Source Power Inverter Circuit

DEFF Research Database (Denmark)

Trzynadlowski, Andrzej M.; Patriciu, Niculina; Blaabjerg, Frede

2001-01-01

A combination of a large current-source inverter and a small voltage-source inverter circuits is analyzed. The resultant hybrid inverter inherits certain operating advantages from both the constituent converters. In comparison with the popular voltage-source inverter, these advantages include...... reduced switching losses, improved quality of output current waveforms, and faster dynamic response to current control commands. Description of operating principles and characteristics of the hybrid inverter is illustrated with results of experimental investigation of a laboratory model....

Switching Characteristics of Ferroelectric Transistor Inverters

Science.gov (United States)

Laws, Crystal; Mitchell, Coey; MacLeod, Todd C.; Ho, Fat D.

2010-01-01

This paper presents the switching characteristics of an inverter circuit using a ferroelectric field effect transistor, FeFET. The propagation delay time characteristics, phl and plh are presented along with the output voltage rise and fall times, rise and fall. The propagation delay is the time-delay between the V50% transitions of the input and output voltages. The rise and fall times are the times required for the output voltages to transition between the voltage levels V10% and V90%. Comparisons are made between the MOSFET inverter and the ferroelectric transistor inverter.

Inverted temperature sequences: role of deformation partitioning

Science.gov (United States)

Grujic, D.; Ashley, K. T.; Coble, M. A.; Coutand, I.; Kellett, D.; Whynot, N.

2015-12-01

The inverted metamorphism associated with the Main Central thrust zone in the Himalaya has been historically attributed to a number of tectonic processes. Here we show that there is actually a composite peak and deformation temperature sequence that formed in succession via different tectonic processes. The deformation partitioning seems to the have played a key role, and the magnitude of each process has varied along strike of the orogen. To explain the formation of the inverted metamorphic sequence across the Lesser Himalayan Sequence (LHS) in eastern Bhutan, we used Raman spectroscopy of carbonaceous material (RSCM) to determine the peak metamorphic temperatures and Ti-in-quartz thermobarometry to determine the deformation temperatures combined with thermochronology including published apatite and zircon U-Th/He and fission-track data and new 40Ar/39Ar dating of muscovite. The dataset was inverted using 3D-thermal-kinematic modeling to constrain the ranges of geological parameters such as fault geometry and slip rates, location and rates of localized basal accretion, and thermal properties of the crust. RSCM results indicate that there are two peak temperature sequences separated by a major thrust within the LHS. The internal temperature sequence shows an inverted peak temperature gradient of 12 °C/km; in the external (southern) sequence, the peak temperatures are constant across the structural sequence. Thermo-kinematic modeling suggest that the thermochronologic and thermobarometric data are compatible with a two-stage scenario: an Early-Middle Miocene phase of fast overthrusting of a hot hanging wall over a downgoing footwall and inversion of the synkinematic isotherms, followed by the formation of the external duplex developed by dominant underthrusting and basal accretion. To reconcile our observations with the experimental data, we suggest that pervasive ductile deformation within the upper LHS and along the Main Central thrust zone at its top stopped at

Myocardial scintigraphy with thallium-201

International Nuclear Information System (INIS)

Schwaiger, M.; Silber, S.; Klein, U.; Rudolph, W.

1980-01-01

Thallium-201 myocardial scintigraphy is an important non-invasive method for assessment of coronary artery disease. Other applications of the method such as delineation of the right ventricular free wall in right ventricular overload, or the detection of hypertrophic cardiomyopathies or myocardial infiltrations are of subordinate importance. In heart disease such as congestive cardiomyopathy and mitral valve prolapse thallium-201 uptake defects have been described, the clinical implications of these findings, however, cannot be adequately interpreted at this time. Myocardial uptake of thallium-201 is an active process, dependent on and proportional to perfusion. Differentiation between myocardial ischemia and myocardial scar is based on the presence or absence of thallium-201 'redistribution'. That is, in the presence of acute reversible ischemia there is increased thallium-201 uptake in the post-ischemic phase in previously hypoperfused myocardium and, subsequently, equilibrium of the initially registered activity differences. 'Redistribution' has also been described in the resting scintigram of patients with severe coronary artery disease and chronic hypoperfusion. (orig.) [de

12 CFR 201.51 - Interest rates applicable to credit extended by a Federal Reserve Bank. 1

Science.gov (United States)

2010-01-01

... account rates on market sources of funds. (d) Primary credit rate in a financial emergency. (1) The... rates for primary credit provided to depository institutions under § 201.4(a) are: Federal Reserve Bank... institutions under 201.4(b) are: Federal Reserve Bank Rate Effective Boston 1.00 December 17, 2008. New York 1...

48 CFR 201.403 - Individual deviations.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual deviations. 201.403 Section 201.403 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Individual deviations. (1) Individual deviations, except those described in 201.402(1) and paragraph (2) of...

N D Pandey

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. N D Pandey. Articles written in Bulletin of Materials Science. Volume 29 Issue 3 June 2006 pp 233-238 Biomaterials. External stimuli response on a novel chitosan hydrogel crosslinked with formaldehyde · A Singh S S Narvi P K Dutta N D Pandey · More Details Abstract Fulltext ...

Novel, Four-Switch, Z-Source Three-Phase Inverter

DEFF Research Database (Denmark)

Antal, Robert; Muntean, Nicolae; Boldea, Ion

2010-01-01

This paper presents a new z-source three phase inverter topology. The proposed topology combines the advantages of a traditional four-switch three-phase inverter with the advantages of the z impedance network (one front-end diode, two inductors and two X connected capacitors). This new topology......, besides the self-boost property, has low switch count and it can operate as a buck-boost inverter. In contrast to standard four-switch three-phase inverter which operates at half dc input voltage the proposed four-switch z-source inverter, by self boosting, brings the output voltage at same (or higher......) value as in six switch standard three-phase inverter. The article presents the derivation of the equations describing the operation of the converter based on space vector analysis, validation through digital simulations in PSIM and preliminary experimental results on a laboratory setup with a dsPIC30F...

Corrosion resistance of CrN thin films produced by dc magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Ruden, A. [Laboratorio de Física del Plasma, Universidad Nacional de Colombia Sede Manizales, Km. 9 vía al Magdalena, Manizales (Colombia); Laboratorio de Recubrimientos Duros y Aplicaciones Industriales–RDAI, Universidad del Valle, Calle 13 N° 100-00 Ciudadela Meléndez, Cali (Colombia); Departamento de matemáticas, Universidad Tecnológica de Pereira, Pereira (Colombia); Restrepo-Parra, E., E-mail: erestrepopa@unal.edu.co [Laboratorio de Física del Plasma, Universidad Nacional de Colombia Sede Manizales, Km. 9 vía al Magdalena, Manizales (Colombia); Paladines, A.U.; Sequeda, F. [Laboratorio de Recubrimientos Duros y Aplicaciones Industriales–RDAI, Universidad del Valle, Calle 13 N° 100-00 Ciudadela Meléndez, Cali (Colombia)

2013-04-01

In this study, the electrochemical behavior of chromium nitride (CrN) coatings deposited on two steel substrates, AISI 304 and AISI 1440, was investigated. The CrN coatings were prepared using a reactive d.c. magnetron sputtering deposition technique at two different pressures (P1 = 0.4 Pa and P2 = 4 Pa) with a mixture of N{sub 2}–Ar (1.5-10). The microstructure and crystallinity of the CrN coatings were investigated using X-ray diffraction. The aqueous corrosion behavior of the coatings was evaluated using two methods. The polarization resistance (Tafel curves) and electrochemical impedance spectra (EIS) in a saline (3.5% NaCl solution) environment were measured in terms of the open-circuit potentials and polarization resistance (R{sub p}). The results indicated that the CrN coatings present better corrosion resistance and R{sub p} values than do the uncoated steel substrates, especially for the coatings produced on the AISI 304 substrates, which exhibited a strong enhancement in the corrosion resistance. Furthermore, better behavior was observed for the coatings produced at lower pressures (0.4 Pa) than those grown at 4 Pa.

Inverted repeats in the promoter as an autoregulatory sequence for TcrX in Mycobacterium tuberculosis

International Nuclear Information System (INIS)

Bhattacharya, Monolekha; Das, Amit Kumar

2011-01-01

Highlights: ► The regulatory sequences recognized by TcrX have been identified. ► The regulatory region comprises of inverted repeats segregated by 30 bp region. ► The mode of binding of TcrX with regulatory sequence is unique. ► In silico TcrX–DNA docked model binds one of the inverted repeats. ► Both phosphorylated and unphosphorylated TcrX binds regulatory sequence in vitro. -- Abstract: TcrY, a histidine kinase, and TcrX, a response regulator, constitute a two-component system in Mycobacterium tuberculosis. tcrX, which is expressed during iron scarcity, is instrumental in the survival of iron-dependent M. tuberculosis. However, the regulator of tcrX/Y has not been fully characterized. Crosslinking studies of TcrX reveal that it can form oligomers in vitro. Electrophoretic mobility shift assays (EMSAs) show that TcrX recognizes two regions in the promoter that are comprised of inverted repeats separated by ∼30 bp. The dimeric in silico model of TcrX predicts binding to one of these inverted repeat regions. Site-directed mutagenesis and radioactive phosphorylation indicate that D54 of TcrX is phosphorylated by H256 of TcrY. However, phosphorylated and unphosphorylated TcrX bind the regulatory sequence with equal efficiency, which was shown with an EMSA using the D54A TcrX mutant.

4 CFR 201.13 - Business information.

Science.gov (United States)

2010-01-01

... 4 Accounts 1 2010-01-01 2010-01-01 false Business information. 201.13 Section 201.13 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.13 Business information. (a) In general. Business information obtained by the Board from a submitter shall be disclosed...

Rheocasting of Al-Cu alloy A201 with different silver content

CSIR Research Space (South Africa)

Masuku, EP

2008-09-01

Full Text Available Rheocasting of alloys A206 and A201 was investigated in this study. Conical bars with different silver contents were produced using CSIR rheoprocess technology, together with high pressure die casting. The results showed that addition of Ag to alloy...

Thallium-201 scintigraphy for bone and soft tissue tumors

Energy Technology Data Exchange (ETDEWEB)

Tokuumi, Yuji; Tsuchiya, Hiroyuki; Sunayama, Chiaki; Matsuda, Eizo; Asada, Naohiro; Taki, Junichi; Sumiya, Hisashi; Miyauchi, Tsutomu; Tomita, Katsuro [Kanazawa Univ. (Japan). School of Medicine

1995-05-01

This study was undertaken to assess the usefulness of thallium-201 scintigraphy in bone and soft tissue tumors. Pre-therapy scintigraphy was undertaken in a total of 136 patients with histologically confirmed diagnosis, consisting of 74 with malignant bone and soft tissue tumors, 39 with benign ones, 12 with diseases analogous to tumors, and 11 others. Thallium activity was graded on a scale of 0-4: 0=background activity, 1=equivocal activity, 2=definitive activity, but less than myocardium, 3=definite activity equal to myocardium, and 4=activity greater than myocardium. In the group of malignant tumors, thallium-201 uptake was found in 80%, although it was low for chondrosarcoma (2/8) and malignant Schwannoma (one/3). The group of benign tumors, however, showed it in only 41%, being restricted to those with giant cell tumors, chondroblastoma, fibromatosis, and osteoid osteoma. Thallium-201 uptake was also found in all 8 patients with metastatic tumors. In 23 patients undergoing thallium imaging before and after chemotherapy, scintigraphic findings revealed a high correlation with histopathological findings. Thus, thallium-201 scintigraphy may be potentially used to distinguish malignant from benign bone and soft tissue tumors, except for a few histopathological cases, as well as to determine loco-regional metastases and response to chemotherapy. (N.K.).

A remark on Kac-Wakimoto hierarchies of D-type

International Nuclear Information System (INIS)

Wu Chaoxzhong

2010-01-01

For the Kac-Wakimoto hierarchy constructed from the principal vertex operator realization of the basic representation of the affine Lie algebra D (1) n , we compute the coefficients of the corresponding Hirota bilinear equations, and verify the coincidence of these bilinear equations with the ones that are satisfied by Givental's total descendant potential of the D n singularity, as conjectured by Givental and Milanov (2005 Simple singularities and integrable hierarchies The Breadth of Symplectic and Poisson Geometry (Prog. Math. vol 232) (Boston: Birkhaeuser) pp 173-201).

Thallium-201 myocardial imaging

International Nuclear Information System (INIS)

Wackers, F.J.Th.

1980-01-01

Three views are routinely obtained for 201 Tl scintigraphy: 0 0 anterior, 45 0 left-anterior-oblique, both views with the patient supine and a left-lateral view, with the patient lying on his right side. Following intravenous injection of 201 Tl, the scintiscans of a normal subject only demonstrate the left ventricle. In patients with normal myocardial perfusion, the left ventricle appears horseshoe or ovoid in shape. The central area of decreased activity represents the left ventricular cavity and is normal. The accumulation of 201 Tl in the normal left ventricle is usually homogeneous. However, some areas with apparent diminished uptake may occur in the normal subject. These variations of the normal image are discussed. The right ventricle, because of its smaller myocardial mass and relatively less 201 Tl accumulation per gram of tissue, is usually on a resting study not, or only faintly, visualized. However, following exercise, the right ventricle is clearly visualized. (Auth.)

Tritiated-water detection with a 2D(γ,n)1H monitor

International Nuclear Information System (INIS)

Winn, W.G.; Baumann, N.P.

Tritiated process water is monitored by detecting the D 2 O component via the 2 D(γ,n) 1 H reaction. A probe containing a 1 to 7 mCi 24 Na (15 h) γ-source and six 3 He neutron detectors produces and monitors the 2 D(γ,n) 1 H reaction. A variety of probe configurations were examined for D 2 O detection sensitivity. The corresponding detection limits range from 6 to 280 μL for D 2 O droplets and 1 to 13 μL/cm for D 2 O streams, when 10-minute neutron counting with a 1 mCi γ-source is used. Results from two field applications illustrate the utility of the monitor

Transistorized PWM inverter-induction motor drive system

Science.gov (United States)

Peak, S. C.; Plunkett, A. B.

1982-01-01

This paper describes the development of a transistorized PWM inverter-induction motor traction drive system. A vehicle performance analysis was performed to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of inverter and motor specifications. The inverter was a transistorized three-phase bridge using General Electric power Darlington transistors. The description of the design and development of this inverter is the principal object of this paper. The high-speed induction motor is a design which is optimized for use with an inverter power source. The primary feedback control is a torque angle control with voltage and torque outer loop controls. A current-controlled PWM technique is used to control the motor voltage. The drive has a constant torque output with PWM operation to base motor speed and a constant horsepower output with square wave operation to maximum speed. The drive system was dynamometer tested and the results are presented.

17 CFR 201.104 - Business hours.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...

17 CFR 201.58 - Judicial review.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of final...

24 CFR 201.41 - Loan servicing.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan servicing. 201.41 Section 201... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan Administration § 201.41 Loan servicing. (a) Generally...

Integral inverter/battery charger for use in electric vehicles

Science.gov (United States)

Thimmesch, D.

1983-01-01

The design and test results of a thyristor based inverter/charger are discussed. A battery charger is included integral to the inverter by using a subset of the inverter power circuit components. The resulting charger provides electrical isolation between the vehicle propulsion battery and ac line and is capable of charging a 25 kWh propulsion battery in 8 hours from a 220 volt ac line. The integral charger employs the inverter commutation components at a resonant ac/dc isolated converter rated at 3.6 kW. Charger efficiency and power factor at an output power of 3.6 kW are 86% and 95% respectively. The inverter, when operated with a matching polyphase ac induction motor and nominal 132 volt propulsion battery, can provide a peak shaft power of 34 kW (45 ph) during motoring operation and 45 kW (60 hp) during regeneration. Thyristors are employed for the inverter power switching devices and are arranged in an input-commutated topology. This configuration requires only two thyristors to commutate the six main inverter thyristors. Inverter efficiency during motoring operation at motor shaft speeds above 450 rad/sec (4300 rpm) is 92-94% for output power levels above 11 KW (15 hp). The combined ac inverter/charger package weighs 47 kg (103 lbs).

Design optimization of grid-connected PV inverters

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2011-01-01

The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....

31 CFR 800.201 - Business day.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...

24 CFR 201.10 - Loan amounts.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan amounts. 201.10 Section 201.10... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.10 Loan amounts. (a) Property...

7 CFR 201.15 - Weed seeds.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

InvertNet: a new paradigm for digital access to invertebrate collections

Directory of Open Access Journals (Sweden)

Chris Dietrich

2012-07-01

Full Text Available InvertNet, one of the three Thematic Collection Networks (TCNs funded in the first round of the U.S. National Science Foundation’s Advancing Digitization of Biological Collections (ADBC program, is tasked with providing digital access to ~60 million specimens housed in 22 arthropod (primarily insect collections at institutions distributed throughout the upper midwestern USA. The traditional workflow for insect collection digitization involves manually keying information from specimen labels into a database and attaching a unique identifier label to each specimen. This remains the dominant paradigm, despite some recent attempts to automate various steps in the process using more advanced technologies. InvertNet aims to develop improved semi-automated, high-throughput workflows for digitizing and providing access to invertebrate collections that balance the need for speed and cost-effectiveness with long-term preservation of specimens and accuracy of data capture. The proposed workflows build on recent methods for digitizing and providing access to high-quality images of multiple specimens (e.g., entire drawers of pinned insects simultaneously. Limitations of previous approaches are discussed and possible solutions are proposed that incorporate advanced imaging and 3-D reconstruction technologies. InvertNet couples efficient digitization workflows with a highly robust network infrastructure capable of managing massive amounts of image data and related metadata and delivering high-quality images, including interactive 3-D reconstructions in real time via the Internet.

A new on-chip all-digital three-phase full-bridge dc/ac power inverter with feedforward and frequency control techniques.

Science.gov (United States)

Chen, Jiann-Jong; Kung, Che-Min

2010-09-01

The communication speed between components is far from satisfactory. To achieve high speed, simple control system configuration, and low cost, a new on-chip all-digital three-phase dc/ac power inverter using feedforward and frequency control techniques is proposed. The controller of the proposed power inverter, called the shift register, consists of six-stage D-latch flip-flops with a goal of achieving low-power consumption and area efficiency. Variable frequency is achieved by controlling the clocks of the shift register. One advantage regarding the data signal (D) and the common clock (CK) is that, regardless of the phase difference between the two, all of the D-latch flip-flops are capable of delaying data by one CK period. To ensure stability, the frequency of CK must be six times higher than that of D. The operation frequency of the proposed power inverter ranges from 10 Hz to 2 MHz, and the maximum output loading current is 0.8 A. The prototype of the proposed circuit has been fabricated with TSMC 0.35 μm 2P4M CMOS processes. The total chip area is 2.333 x 1.698 mm2. The three-phase dc/ac power inverter is applicable in uninterrupted power supplies, cold cathode fluorescent lamps, and motors, because of its ability to convert the dc supply voltage into the three-phase ac power sources.

Selective harmonic elimination strategy in eleven level inverter for PV system with unbalanced DC sources

Science.gov (United States)

Ghoudelbourk, Sihem.; Dib, D.; Meghni, B.; Zouli, M.

2017-02-01

The paper deals with the multilevel converters control strategy for photovoltaic system integrated in distribution grids. The objective of the proposed work is to design multilevel inverters for solar energy applications so as to reduce the Total Harmonic Distortion (THD) and to improve the power quality. The multilevel inverter power structure plays a vital role in every aspect of the power system. It is easier to produce a high-power, high-voltage inverter with the multilevel structure. The topologies of multilevel inverter have several advantages such as high output voltage, lower total harmonic distortion (THD) and reduction of voltage ratings of the power semiconductor switching devices. The proposed control strategy ensures an implementation of selective harmonic elimination (SHE) modulation for eleven levels. SHE is a very important and efficient strategy of eliminating selected harmonics by judicious selection of the firing angles of the inverter. Harmonics elimination technique eliminates the need of the expensive low pass filters in the system. Previous research considered that constant and equal DC sources with invariant behavior; however, this research extends earlier work to include variant DC sources, which are typical of lead-acid batteries when used in system PV. This Study also investigates methods to minimize the total harmonic distortion of the synthesized multilevel waveform and to help balance the battery voltage. The harmonic elimination method was used to eliminate selected lower dominant harmonics resulting from the inverter switching action.

Five-Level Z-Source Neutral Point-Clamped Inverter

DEFF Research Database (Denmark)

Gao, F.; Loh, P.C.; Blaabjerg, Frede

2007-01-01

This paper proposes a five-level Z-source neutralpoint- clamped (NPC) inverter with two Z-source networks functioning as intermediate energy storages coupled between dc sources and NPC inverter circuitry. Analyzing the operational principles of Z-source network with partial dclink shoot......-through scheme reveals the hidden theories in the five-level Z-source NPC inverter unlike the operational principle appeared in the general two-level Z-source inverter, so that the five-level Z-source NPC inverter can be designed with the modulation of carrier-based phase disposition (PD) or alternative phase...

Analysis of Magnetically-Coupled Impedance Source Three-Phase Four-Switch Inverters

DEFF Research Database (Denmark)

Li, Kerui; Abdelhakim, Ahmed; Yang, Yongheng

2017-01-01

In this paper, magnetically-coupled impedance source (MCIS) three-phase four-switch inverters are introduced for renewable energy applications. This inverter utilizes two single-phase MCIS inverters to obtain a three-phase output, where less component-count is achieved in order to reduce the inve......In this paper, magnetically-coupled impedance source (MCIS) three-phase four-switch inverters are introduced for renewable energy applications. This inverter utilizes two single-phase MCIS inverters to obtain a three-phase output, where less component-count is achieved in order to reduce...... the inverter volume. On the other hand, as a result of the reduced number of switches, the proposed inverter suffers from higher voltage stresses. The MCIS inverters are first reviewed. Then, the modulation and operation principle of the MCIS three-phase inverter topology are introduced before sizing...

Synergy of the Developed 6D BIM Framework and Conception of the nD BIM Framework and nD BIM Process Ontology

Science.gov (United States)

O'Keeffe, Shawn Edward

2013-01-01

The author developed a unified nD framework and process ontology for Building Information Modeling (BIM). The research includes a framework developed for 6D BIM, nD BIM, and nD ontology that defines the domain and sub-domain constructs for future nD BIM dimensions. The nD ontology defines the relationships of kinds within any new proposed…

Japanese power electronics inverter technology and its impact on the American air conditioning industry

Energy Technology Data Exchange (ETDEWEB)

Ushimaru, Kenji.

1990-08-01

Since 1983, technological advances and market growth of inverter- driven variable-speed heat pumps in Japan have been dramatic. The high level of market penetration was promoted by a combination of political, economic, and trade policies in Japan. A unique environment was created in which the leading domestic industries-- microprocessor manufacturing, compressors for air conditioning and refrigerators, and power electronic devices--were able to direct the development and market success of inverter-driven heat pumps. As a result, leading US variable-speed heat pump manufacturers should expect a challenge from the Japanese producers of power devices and microprocessors. Because of the vertically-integrated production structure in Japan, in contrast to the out-sourcing culture of the United States, price competition at the component level (such as inverters, sensors, and controls) may impact the structure of the industry more severely than final product sales. 54 refs., 47 figs., 1 tab.

Japanese power electronics inverter technology and its impact on the American air conditioning industry

Science.gov (United States)

Ushimaru, Kenji

1990-08-01

Since 1983, technological advances and market growth of inverter-driven variable-speed heat pumps in Japan have been dramatic. The high level of market penetration was promoted by a combination of political, economic, and trade policies in Japan. A unique environment was created in which the leading domestic industries, microprocessor manufacturing, compressors for air conditioning and refrigerators, and power electronic devices, were able to direct the development and market success of inverter-driven heat pumps. As a result, leading U.S. variable-speed heat pump manufacturers should expect a challenge from the Japanese producers of power devices and microprocessors. Because of the vertically-integrated production structure in Japan, in contrast to the out-sourcing culture of the United States, price competition at the component level (such as inverters, sensors, and controls) may impact the structure of the industry more severely than final product sales.

N-fluoroalkylated and N-alkylated analogues of the dopaminergic D-2 receptor antagonist raclopride

International Nuclear Information System (INIS)

Lannoye, G.S.; Moerlein, S.M.; Parkinson, D.; Welch, M.J.

1990-01-01

A series of raclopride [(S)-2-[(3,5-dichloro-6-methoxy-2- hydroxybenzamido)methyl]-1-ethylpyrrolidine] derivatives bearing pyrrolidino N-fluoroalkyl or -alkyl substituents were synthesized and evaluated as potential dopaminergic receptor-based positron tomography radiopharmaceuticals. Radiosynthetic procedures for producing the corresponding N-[18F]fluoroalkylated analogues of raclopride from 18F- (beta+, t1/2 = 110 min) in high specific activity were also developed. In vitro binding assays using competitive displacement of [3H]spiperone from primate caudate tissue indicated that the N-alkylated analogues of raclopride had Ki values of 5-40 nM, whereas the corresponding values for analogous N-fluoroalkylated derivatives ranged from 90-160 nM. The relatively low D-2 binding affinity of these fluorinated salicylamides was corroborated by in vivo tissue biodistribution results in rodents. On the basis of structure-binding correlations, the impact of intramolecular hydrogen bonding, ligand basicity, and steric bulk on the affinity of the benzamides for D-2 receptor binding are discussed. Strategies are presented for the development of alternative fluorinated salicylamides that are both receptor active and metabolically stable

Contribution to the study of thallium 201 myocardium scintigraphy

International Nuclear Information System (INIS)

Annweiler, Marc.

1976-01-01

In this work a new isotope was tested in the field of myocardium scintigraphy: thallium 201. The different radioisotopes used so far in myocardium scintigraphy are reviewed to begin with. The main biological and physical characteristics of thallium and the scintillation camera used for this work are described next. In our opinion thallium 201 owing to its biological behavior similar to that of potassium and to its physical characteristics, appears as one of the better -if not the best- known tracer suitable for use in myocardium scintigraphy. Its properties are suited to the use of a scintillation camera, which considerably shortens the examination time and thus allows an isotopic exploration of the myocardium from several incidences. The only disadvantage of this cyclotron-produced isotope seems to be its high price which will probably limit its use on a large scale. Fifty thallium 201 myocardium scintigraphs were practised on forty-eight coronary thrombosis patients. From this was established a precise topographic correlation between the electrocardiographic diagnosis and the scintigraph. The two corresponded in 47 cases out of 50. The few disagreements between ECG and scintigraphic results seem to be due either to poor-quality images or to an overall myocardium hypofixation connected with a very extensive necrosis. This means that thallium 201 myocardium scintigraphy is a reliable method of examination in the great majority of cases, giving a direct picture of the heart muscle and its necrotic lesions [fr

21 CFR 201.105 - Veterinary drugs.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...

19 CFR 201.110 - Self-evaluation.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...

Inverse Interval Matrix: A Survey

Czech Academy of Sciences Publication Activity Database

Rohn, Jiří; Farhadsefat, R.

2011-01-01

Roč. 22, - (2011), s. 704-719 E-ISSN 1081-3810 R&D Projects: GA ČR GA201/09/1957; GA ČR GC201/08/J020 Institutional research plan: CEZ:AV0Z10300504 Keywords : interval matrix * inverse interval matrix * NP-hardness * enclosure * unit midpoint * inverse sign stability * nonnegative invertibility * absolute value equation * algorithm Subject RIV: BA - General Mathematics Impact factor: 0.808, year: 2010 http://www.math.technion.ac.il/iic/ ela / ela -articles/articles/vol22_pp704-719.pdf

Comparative study of SiC- and Si-based photovoltaic inverters

Science.gov (United States)

Ando, Yuji; Oku, Takeo; Yasuda, Masashi; Shirahata, Yasuhiro; Ushijima, Kazufumi; Murozono, Mikio

2017-01-01

This article reports comparative study of 150-300 W class photovoltaic inverters (Si inverter, SiC inverter 1, and SiC inverter 2). In these sub-kW class inverters, the ON-resistance was considered to have little influence on the efficiency. The developed SiC inverters, however, have exhibited an approximately 3% higher direct current (DC)-alternating current (AC) conversion efficiency as compared to the Si inverter. Power loss analysis indicated a reduction in the switching and reverse recovery losses of SiC metal-oxide-semiconductor field-effect transistors used for the DC-AC converter is responsible for this improvement. In the SiC inverter 2, an increase of the switching frequency up to 100 kHz achieved a state-of-the-art combination of the weight (1.25 kg) and the volume (1260 cm3) as a 150-250 W class inverter. Even though the increased switching frequency should cause the increase of the switching losses, the SiC inverter 2 exhibited an efficiency comparable to the SiC inverter 1 with a switching frequency of 20 kHz. The power loss analysis also indicated a decreased loss of the DC-DC converter built with SiC Schottky barrier diodes led to the high efficiency for its increased switching frequency. These results clearly indicated feasibility of SiC devices even for sub-kW photovoltaic inverters, which will be available for the applications where compactness and efficiency are of tremendous importance.

21 CFR 201.70 - Calcium labeling.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Calcium labeling. 201.70 Section 201.70 Food and... LABELING Labeling Requirements for Over-the-Counter Drugs § 201.70 Calcium labeling. (a) The labeling of over-the-counter (OTC) drug products intended for oral ingestion shall contain the calcium content per...

7 CFR 1435.201 - Civil penalties.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Civil penalties. 1435.201 Section 1435.201... Recordkeeping Requirements § 1435.201 Civil penalties. (a) Any processor, refiner, or importer of sugar, syrup... false data required under § 1435.200(a) through (e), is subject to a civil penalty of no more than $10...

Evidence that human papillomavirus causes inverted papilloma is sparse.

Science.gov (United States)

Justice, Jeb M; Davis, Kern M; Saenz, Daniel A; Lanza, Donald C

2014-12-01

Controversy exists regarding the pathogenesis of inverted papilloma as it relates to the involvement of human papillomavirus (HPV). The purpose of this report is to describe the prevalence of HPV in nondysplastic, "early inverted papilloma" and to summarize HPV detection rates in the general population and in other HPV related neoplasia. This case series report characterizes consecutive inverted papilloma patients from January 2005 to August 2012 with regard to smoking history, dysplasia, and HPV detection rates. Presence or absence of low/high risk HPV was determined by standardized in situ hybridization DNA probes. Medline literature review was performed to determine the prevalence of HPV in inverted papilloma without moderate or severe dysplasia. Thirty-six consecutive patients were identified with an average age of 63.6 (range, 40-84) years; gender: 23 men, 13 women. More than half (55%) were active or former smokers (14% active and 41% former). High/low risk HPV was present in 1 in 36 (2.7%) patients and 1 in 36 (2.7%) had mild dysplasia. In the literature review: (1) HPV was detected in 16.4% of inverted papilloma without dysplasia; (2) oral cavity HPV detection was 4.2% to 11.4% in the normal population; and (3) HPV was normally detected in 85% to 95% of HPV-related neoplasia. Given histological features of inverted papilloma and comparatively low detection rates of HPV in inverted papilloma without dysplasia (2.7%), as well as the summary of the world literature, HPV is not related to the initial pathogenesis of inverted papilloma or inverted papilloma's tendency to persist or recur. It is postulated that since inverted papilloma is more an inflammatory polyp, it is susceptible to secondary HPV infection because of its metaplasia. Tobacco and other causes of respiratory epithelium remodeling are more plausible explanations for the initial tissue transformation to inverted papilloma. © 2014 ARS-AAOA, LLC.

7 CFR 201.11a - Hybrid.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The percentage...

Clinical investigation of large perfusion defect cases with 201Tl exercise myocardial scintigraphy

International Nuclear Information System (INIS)

Morota, Motoi; Kobayashi, Yasuhiko

1999-01-01

We investigated retrospectively the clinical significance of large perfusion defect on 201 Thallium myocardial scintigraphy from the records of 833 patients during the past 3 years from 1991 to 1994. The patients were divided into 3 groups according to the extent of perfusion defect; cases with normal perfusion (n=561), with small perfusion defect (n=211) and with large perfusion defect (n=61). We found that the proportions of cases with large perfusion defect was significantly larger than that of cases with small perfusion defect in myocardial disease (MD; hypertrophic cardiomyopathy, dilated cardiomyopathy, and post myocarditis combined) (P 201 Thallium myocardial scintigraphy and that complication of diabetes mellitus and clinical symptoms may be useful in differentiating IHD from MD. (author)

Chromatic changes to artificial irises produced using different techniques

Science.gov (United States)

Bannwart, Lisiane Cristina; Goiato, Marcelo Coelho; dos Santos, Daniela Micheline; Moreno, Amália; Pesqueira, Aldiéris Alves; Haddad, Marcela Filié; Andreotti, Agda Marobo; de Medeiros, Rodrigo Antonio

2013-05-01

Ocular prostheses are important determinants of their users' aesthetic recovery and self-esteem. Because of use, ocular prostheses longevity is strongly affected by instability of the iris color due to polymerization. The goal of this study is to examine how the color of the artificial iris button is affected by different techniques of artificial wear and by the application of varnish following polymerization of the colorless acrylic resin that covers the colored paint. We produce 60 samples (n=10) according to the wear technique applied: conventional technique without varnish (PE); conventional technique with varnish (PEV); technique involving a prefabricated cap without varnish (CA); technique involving a prefabricated cap with varnish (CAV); technique involving inverted painting without varnish (PI); and technique involving inverted painting with varnish (PIV). Color readings using a spectrophotometer are taken before and after polymerization. We submitted the data obtained to analyses of variance and Tukey's test (P<0.05). The color test shows significant changes after polymerization in all groups. The PE and PI techniques have clinically acceptable values of ΔE, independent of whether we apply varnish to protect the paint. The PI technique produces the least color change, whereas the PE and CA techniques significantly improve color stability.

D Reconstruction of Ancient Egyptian Rock-Cut Tombs: the Case of M.I.D.A.N.05.

Science.gov (United States)

Nabil, M.; Betrò, M.; Metwally, M. N.

2013-07-01

In this paper we present an on-going work to reconstruct a 3D model of M.I.D.A.N.05., an ancient Egyptian tomb located in Luxor. The reconstruction aims at producing a high quality 3D model of the tomb to help in archaeological investigation and other scientific uses. We present details about the different stages of the used reconstruction pipeline, the results so far, and the evaluation of the results in view of the project objectives.

Small-angle neutron polarization for the 2H(d vector,n vector)3He reaction near Esub(d) = 8MeV

International Nuclear Information System (INIS)

Tornow, W.; Woye, W.; Mack, G.

1981-01-01

Considerable improvement in the quality of analyzing power experiments performed with polarized fast neutrons has been achieved during the last few years by using neutrons from the polarization transfer reaction 2 H(d vector,n vector) 3 He at a reaction angle of theta = 0 0 . To compromise in these experiments between intensity problems and finite geometry corrections, it is desirable in some instances to subtend a full-width angle Δtheta of 20 0 (lab) centered about theta = 0 0 . In order to investigate the suitability of this reaction as a source of polarized neutrons for cases where the scatterer is close to the neutron source, the neutron polarization of the reaction 2 H(d vector,n vector) 3 He has been studied with Δtheta of about 3 0 in 3 0 steps out to theta = 20 0 (lab). An incident deuteron energy near 8 MeV was chosen to yield outgoing neutrons at 11.0 MeV, a typical energy for neutron analyzing power experiments. It is found that the effective neutron polarization, a combination of the two polarizations measured when the direction of the deuteron polarization is inverted or flipped at the polarized ion source, is large and nearly constant for angles between theta = 0 0 and theta = 10 0 (lab). (orig.)

Isolation and molecular characterization of dTnp1, a mobile and defective transposable element of Nicotiana plumbaginifolia.

Science.gov (United States)

Meyer, C; Pouteau, S; Rouzé, P; Caboche, M

1994-01-01

By Northern blot analysis of nitrate reductase-deficient mutants of Nicotiana plumbaginifolia, we identified a mutant (mutant D65), obtained after gamma-ray irradiation of protoplasts, which contained an insertion sequence in the nitrate reductase (NR) mRNA. This insertion sequence was localized by polymerase chain reaction (PCR) in the first exon of NR and was also shown to be present in the NR gene. The mutant gene contained a 565 bp insertion sequence that exhibits the sequence characteristics of a transposable element, which was thus named dTnp1. The dTnp1 element has 14 bp terminal inverted repeats and is flanked by an 8-bp target site duplication generated upon transposition. These inverted repeats have significant sequence homology with those of other transposable elements. Judging by its size and the absence of a long open reading frame, dTnp1 appears to represent a defective, although mobile, transposable element. The octamer motif TTTAGGCC was found several times in direct orientation near the 5' and 3' ends of dTnp1 together with a perfect palindrome located after the 5' inverted repeat. Southern blot analysis using an internal probe of dTnp1 suggested that this element occurs as a single copy in the genome of N. plumbaginifolia. It is also present in N. tabacum, but absent in tomato or petunia. The dTnp1 element is therefore of potential use for gene tagging in Nicotiana species.

Evaluación de métodos de propagación, fertilización nitrogenada y fenología de estevia en condiciones del Valle del Cauca Evaluation of propagation methods, nitrogen fertilization and phenology in stevia in the Cauca Valley, Colombia

Directory of Open Access Journals (Sweden)

Carmen R Bonilla C

Full Text Available En el Centro Experimental de la Universidad Nacional de Colombia sede Palmira se evaluó el prendimiento de estacas apicales y basales de Stevia rebaudiana en tres sustratos de enraizamiento (carbonilla-arena, carbonilla-compost y arena-compost y tres fuentes de nitrógeno (urea 46%N, compost 1.5%N y gallinaza 1% N. El mejor método de propagación fue la estaca apical en sustrato carbonilla-arena 1:1, volumen; las fuentes de nitrógeno no presentaron diferencias significativas en la acumulación de materia seca de hojas. Se diferenciaron los siguientes periodos fenológicos: Emergencia: 6 días después de la siembra (dís, Estado vegetativo: 17 dias, Floración: 71 dís, Fructificación: 115 dís, Senescencia: 169 dís y Rebrote: 201 dísThis research was carried out at the Experimental Center of the National University of Colombia ( Palmira in order to know more about the cropping system of Stevia rebaudiana Bertoni. The research consisted of an evaluation of rooting process and growth of cuttings from basal and apical position of the stem. The results were obtained from three root sustrates (coal ship-sand, coal ship-compost and sand-compost and three different nitrogen sources (urea 46%N, compost 1.5% N and chicken manure 1% N. The results showed that the most productive sustrate was coal ship-sand 1:1 volume. The application of the nitrogen sources had no significant differences in accumulation of leaf dry matter. Phenological observation were as follows: emergence: 6 days after sowing (das, vegetative state: 17 das, flowering: 71 das, fructificatión: 115 das, senility: 169 das and shoot: 201 dís.

Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices

International Nuclear Information System (INIS)

Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho

1999-01-01

Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease

42 CFR 50.201 - Applicability.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 50.201 Section 50.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY... Public Health Service. ...

Asymmetrical and symmetrical embedded Z-source inverters

DEFF Research Database (Denmark)

Gao, F.; Loh, P.C.; Li, D.

2011-01-01

ends, which indirectly translates to a lowering of overall system cost. These noted advantages are indeed appropriate for applications like photovoltaic and fuel cell energy harnessing, and have already been confirmed in simulation and experimentally using a laboratory-implemented inverter prototype.......This study presents two types of embedded Z-source inverters with each type further divided into asymmetrical and symmetrical realisations. Being different from their traditional counterparts, the presented inverters have their dc sources inserted within their X-shaped impedance networks so...

Dipyridamole thallium-201 single-photon emission computed tomography for prediction of perioperative cardiac events in patients with arteriosclerosis obliterans undergoing vascular surgery

International Nuclear Information System (INIS)

Ziyang, Huang; Komori, Sadayoshi; Sawanobori, Takao

1998-01-01

The aim of the study was to determine whether or not dipyridamole thallium-201 single-photon emission computed tomography ( 201 Tl-SPECT) has significant additive value for predicting perioperative cardiac events in patients with arteriosclerosis obliterans (ASO) undergoing vascular surgery. Routine preoperative 201 Tl-SPECT was performed in 106 consecutive patients with ASO (age 68±8.9 years; 91 men and 15 women). The frequency of reversible defects in a clinical high-risk group (n=44) was significantly higher than in a low-risk group (n=62; 55% vs 24%, p 201 Tl-SPECT data to clinical risk-stratified patients with ASO allows better prediction of perioperative cardiac events. (author)

Optimal Design of Modern Transformerless PV Inverter Topologies

DEFF Research Database (Denmark)

Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inverter design variables are derived for each PV inverter topology and installation site. The H5, H6, neutral point...... clamped, active-neutral point clamped and conergy-NPC PV inverters designed using the proposed optimization process feature lower levelized cost of generated electricity and lifetime cost, longer mean time between failures and inject more PV-generated energy into the electric grid than their nonoptimized......The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during...

Development of inverter for elevator door control

Energy Technology Data Exchange (ETDEWEB)

Kim, J.K.; Choi, U.D.; Jung, M.K.; Choi, S.K. [HHI R and D Center (Korea, Republic of); Yun, J.H.; Han, S.B. [HELCO R and D Center (Korea, Republic of)

1995-07-01

Most of the elevator door controllers have been controlled by DC Motors as an actuator. Recently, The control system using AC induction motor and general purpose inverter has been applied to control of elevator door. But there are some difficulties in making use of this system, such as adjustment of door speed pattern, door open-close time, and security of passenger safety. In order to solve these problems, a special inverter has been developed with an encoder feedback. From the result of field-test, we proved that a special inverter with encoder feedback device has come to considerable effect. Until now about 1,200 sets of these inverters are operated in Korea and about 100 sets are operated in South-east Asia. (author). 3 refs., 10 figs., 3 tabs.

Operational analysis and comparative evaluation of embedded Z-Source inverters

DEFF Research Database (Denmark)

Blaabjerg, Frede; Gao, F.; Loh, P.C.

2008-01-01

) circuitry connected instead of the generic voltage source inverter (VSI) circuitry. Further proceeding on to the topological variation, parallel embedded Z-source inverters are presented with the detailed analysis of topological configuration and operational principles showing that they are the superior......This paper presents various embedded Z-source (EZ-source) inverters broadly classified as shunt or parallel embedded Z-source inverter. Being different from the traditional Z-source inverter, EZ-source inverters are constructed by inserting dc sources into the X-shaped impedance network so...... that the dc input current flows smoothly during the whole switching period unlike the traditional Z-source inverter. This feature is interesting when PV panels or fuel cells are assumed to power load since the continuous input current flow reduces control complexity of dc source and system design burden...

Advanced Power Electronics and Smart Inverters | Grid Modernization | NREL

Science.gov (United States)

Advanced Power Electronics and Smart Inverters Advanced Power Electronics and Smart Inverters , into the electric distribution system requires advanced power electronics, or smart inverters, that . Contact Sudipta Chakraborty Power Electronics Team Lead sudipta.chakraborty@nrel.gov | 303-384-7093

Optimal inverter logic gate using 10-nm double gate-all-around (DGAA transistor with asymmetric channel width

Directory of Open Access Journals (Sweden)

Myunghwan Ryu

2016-01-01

Full Text Available We investigate the electrical characteristics of a double-gate-all-around (DGAA transistor with an asymmetric channel width using three-dimensional device simulation. The DGAA structure creates a silicon nanotube field-effect transistor (NTFET with a core-shell gate architecture, which can solve the problem of loss of gate controllability of the channel and provides improved short-channel behavior. The channel width asymmetry is analyzed on both sides of the terminals of the transistors, i.e., source and drain. In addition, we consider both n-type and p-type DGAA FETs, which are essential to forming a unit logic cell, the inverter. Simulation results reveal that, according to the carrier types, the location of the asymmetry has a different effect on the electrical properties of the devices. Thus, we propose the N/P DGAA FET structure with an asymmetric channel width to form the optimal inverter. Various electrical metrics are analyzed to investigate the benefits of the optimal inverter structure over the conventional inverter structure. Simulation results show that 27% delay and 15% leakage power improvement are enabled in the optimum structure.

Thin type inverter for machine-room-less elevator; Machine roomless elevator yo usugata inverter

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-01-10

In the elevator industry, a machine-room-less elevator, which does not necessitate a machine room usually installed on the roof, has come into the spotlight in the domain of low and intermediate speed elevators. The lack of a machine room, however, will necessarily limit the space for the installation of the traction motor and control panel. Fuji Electric Co., Ltd., in order to properly cope with the situation, has developed in cooperation with Fujitec Co., Ltd., a very thin type inverter installable on an elevator hall floor. The inverter, based on Fuji Electric's high-performance vector control inverter FRENIC5000VG5, is as thin as 100mm, and is available in three series up to 11kW. For the embodiment of such a thin structure, a cooling structure of Fuji Electric's own is employed, and prudence is exercised as required at many locations so that maintainability will not be impaired throughout the very thin control panel design. (translated by NEDO)

Thallium-201 myocardial imaging for evaluation of pulmonary hypertension

International Nuclear Information System (INIS)

Ikuno, Yoshiyasu

1979-01-01

Thallium-201 ( 201 Tl) myocardial scintigraphy (TMS) was performed in 54 patients. The images were analysed semi-quantitatively by measuring the extent of radioisotope concentration in the right ventricular free wall and the size of the right ventricular cavity. The extent of radioisotope concentration (four degrees) was expressed as the right ventricular activity score (RVAS) and the size of the right ventricular cavity (three degrees) was expressed as the right ventricular cavity score (RVCS). The scores were added for a right ventricular total score (RVTS). To establish criteria for the diagnosis of pulmonary hypertension (PH) by means of TMS, these scores were compared with the values of pulmonary arterial mean pressure (PAMP). The criteria were evaluated by comparing them with conventional criteria for electrocardiographic diagnosis of right ventricular hypertrophy. Patients with a 2-point RVAS had a significantly higher PAMP than those with a 0 or 1-point RVAS (p 201 Tl myocardial scintigrams is a useful non-invasive method for evaluating PH and its severity. (J.P.N.)

Effects of cross talk on dual energy SPECT imaging between 123I-BMIPP and 201Tl

International Nuclear Information System (INIS)

Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru

1994-01-01

The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.)

Correlation between myocardial Thallium-201 kinetics, myocardial lactate metabolism and coronary angiographic findings in hypertrophic cardiomyopathy

International Nuclear Information System (INIS)

Hanrath, P.; Mathey, D.; Thiel, U.; Kupper, W.; Bleifeld, W.; Mantz, R.; Vorbringer, H.; Schneider, C.

1980-01-01

In 20 patients with idiopathic hypertrophic obstructive and nonobstructive cardiomyopathy (IHSS), biphasic Thallium-201 myocardial scintigraphy was performed. Regional myocardial Thallium-201 kinetics of these patients were analysed by a semiquantitative computerized method and compared with those of 6 normal subjects. In 12 of 18 with IHSS and no coronary artery disease 26 regions of interest with irreversible and 6 regions of interest with reversible Thallium-201 defects could be detected. Most of the Thallium-201 defects were localized in the interventricular septum. The defects were not related to the age of the patients and there was no relationship between the occurence of reversible Thallium-201 defects and pathological myocardial lactate extraction rate during maximal atrial pacing measured in 14 patients. The percentage (6.8%) of irreversible defect regions in patients with LV outflow obstruction at rest (n = 13) was more than twice higher compared to those (n = 5, 3.2%) without LV outflow obstruction or no provocative pressure gradient, resp. These data suggest that IHSS often associated with regional ischemic myocardial fibrosis despite normal coronary arteries. Therefore in these patients Thallium scintigraphy cannot be used as a noninvasive screening method to exclude or prove coronary artery disease. (orig.) [de

Inverter Output Filter Effect on PWM Motor Drives of a Flywheel Energy Storage System

Science.gov (United States)

Santiago, Walter

2004-01-01

NASA Glenn Research Center (GRC) has been involved in the research and development of high speed flywheel systems for small satellite energy storage and attitude control applications. One research and development area has been the minimization of the switching noise produced by the pulsed width modulated (PWM) inverter that drives the flywheel permanent magnet motor/generator (PM M/G). This noise can interfere with the flywheel M/G hardware and the system avionics hampering the full speed performance of the flywheel system. One way to attenuate the inverter switching noise is by placing an AC filter at the three phase output terminals of the inverter with the filter neutral point connected to the DC link (DC bus) midpoint capacitors. The main benefit of using an AC filter in this fashion is the significant reduction of the inverter s high dv/dt switching and its harmonics components. Additionally, common mode (CM) and differential mode (DM) voltages caused by the inverter s high dv/dt switching are also reduced. Several topologies of AC filters have been implemented and compared. One AC filter topology consists of a two-stage R-L-C low pass filter. The other topology consists of the same two-stage R-L-C low pass filter with a series connected trap filter (an inductor and capacitor connected in parallel). This paper presents the analysis, design and experimental results of these AC filter topologies and the comparison between the no filter case and conventional AC filter.

Adaptation of a fuzzy controller’s scaling gains using genetic algorithms for balancing an inverted pendulum

Directory of Open Access Journals (Sweden)

Duka Adrian-Vasile

2011-12-01

Full Text Available This paper examines the development of a genetic adaptive fuzzy control system for the Inverted Pendulum. The inverted pendulum is a classical problem in Control Engineering, used for testing different control algorithms. The goal is to balance the inverted pendulum in the upright position by controlling the horizontal force applied to its cart. Because it is unstable and has a complicated nonlinear dynamics, the inverted pendulum is a good testbed for the development of nonconventional advanced control techniques. Fuzzy logic technique has been successfully applied to control this type of system, however most of the time the design of the fuzzy controller is done in an ad-hoc manner, and choosing certain parameters (controller gains, membership functions proves difficult. This paper examines the implementation of an adaptive control method based on genetic algorithms (GA, which can be used on-line to produce the adaptation of the fuzzy controller’s gains in order to achieve the stabilization of the pendulum. The performances of the proposed control algorithms are evaluated and shown by means of digital simulation.

Late reversibility of tomographic myocardial thallium-201 defects: an accurate marker of myocardial viability

International Nuclear Information System (INIS)

Kiat, H.; Berman, D.S.; Maddahi, J.; De Yang, L.; Van Train, K.; Rozanski, A.; Friedman, J.

1988-01-01

Twenty-one patients were studied who underwent thallium-201 stress-redistribution single photon emission computed tomography (SPECT) both before and after coronary artery bypass grafting (n = 15) or transluminal coronary angioplasty (n = 6). All patients underwent thallium imaging 15 min, 4 h and late (18 to 72 h) after stress as part of the preintervention thallium-201 scintigram. In a total of 201 tomographic myocardial segments with definite post-stress thallium-201 perfusion defects in which the relevant coronary arteries were subsequently successfully reperfused, the 4 h redistribution images did not predict the postintervention scintigraphic improvement: 67 (85%) of the 79 4 h reversible as well as 88 (72%) of the 122 4 h nonreversible segments improved (p = NS). The 18 to 72 h late redistribution images effectively subcategorized the 4 h nonreversible segments with respect to postintervention scintigraphic improvement: 70 (95%) of the 74 late reversible segments improved after intervention, whereas only 18 (37%) of the 48 late nonreversible segments improved (p less than 0.0001). The frequency of late reversible defects and the frequency of postrevascularization improvement of late nonreversible defects are probably overestimated by this study because of referral biases. The cardiac counts and target to background ratios from late redistribution studies resulted in satisfactory cardiac images for visual interpretation. For optimal assessment of the extent of viable myocardium by thallium-201 scintigraphic studies, late redistribution imaging should be performed when nonreversible defects are observed on 4 h redistribution images

Mechanisms of thallium-201 myocardial accumulation

International Nuclear Information System (INIS)

Wackers, F.J.Th.; Samson, G.

1980-01-01

The practical advantages of 201 Tl over other suitable myocardial imaging agents such as potassium-43 ( 43 K), rubidium-81 ( 81 Rb), and cesium-129 ( 129 Cs), are its relatively low energy photons which makes it possible to employ high-resolution low-energy collimators and its physical half-life of 73 hr which provides sufficiently long shelf-life for practical clinical imaging. Toxicological considerations do not play a role using 201 Tl as thallous chloride. The concentration of thallous chloride in a dose of 2 mCi of 201 Tl is less than 4μg. The LD 50 of thallous chloride is a factor 10 4 more. The minimal lethal dose in man is reported to be 12 mg/kg. The kinetics of 201 Tl, its tissue distributions and radiation doses are assessed, and the effect of cardiac drugs on thallium-201 uptake are discussed. (Auth.)

Removal of 99mTc and 201Tl by means of Lemna Gibba

International Nuclear Information System (INIS)

Fernandez R, E.; Carreno de L, M. C.; Cuevas S, J. C.; Hernadez T, U. O.; Monroy G, F.

2012-10-01

In this work the capacity of the water macrophyte Lemna gibba coming from San Pedro Tultepec in the Mexico State was studied to remove the radioisotopes 99m Tc and 201 Tl, in order to show the capacity of this macrophyte for to treat some radioactive waste flowing that could contain this radioisotopes type. The removal capacity of 99m Tc and 201 Tl of the macrophyte Lemna gibba was determined using the batch method. In accordance with the values of the obtained K d , the Lemna gibba with a size of particle diameter among 1mm - 300 μm presents a better adsorption of 99m Tc. The 201 Tl is adsorbed better in the bioadsorbent when it has a size of particle diameter <150μm. (Author)

LCCT-derived three-level three-phase inverters

DEFF Research Database (Denmark)

Shults, Tatiana; Husev, Oleksandr; Blaabjerg, Frede

2017-01-01

Solutions for a family of the novel three-level neutral-point-clamped (NPC) inductor-capacitor-capacitor-transformer (LCCT)-derived three-phase inverters are described and compared. Component design guidelines and steady state analysis, current and voltage waveforms are given. The authors......' simulation results confirm the theoretical predictions. It was found that an asymmetrical three-level NPC LCCT-derived inverter with a single diode in the impedance source network is the most promising solution. Experimental results for an asymmetrical three-level NPC LCCT-derived inverter with a single...

π-Conjugated organic-based devices with different layered structures produced by the neutral cluster beam deposition method and operating conduction mechanism

International Nuclear Information System (INIS)

Seo, Hoon-Seok; Oh, Jeong-Do; Kim, Dae-Kyu; Shin, Eun-Sol; Choi, Jong-Ho

2012-01-01

The authors report on the systematic characterization of structural effects of organic complementary inverters based on two π-conjugated organic molecules, pentacene and copper hexadecafluorophthalocyanine (F 16 CuPc). Three classes of inverters with different layered structures in top-contact configuration were produced using the neutral cluster beam deposition method. Their voltage transfer characteristics, gain curves and hysteresis behaviour were characterized with respect to their thickness. Class I inverters, with generic structures of single-layered, p-and n-type (200/180 Å) transistors, exhibited high gains of 12.8 ± 1.0 with sharp inversions. Their two constituent transistors, with hole and electron mobilities of 0.38 cm 2 V -1 s -1 and 7.0 × 10 -3 cm 2 V -1 s -1 , respectively, showed well-coupled carrier conduction during operation. The behaviour of class II and III inverters, with layered heterojunction structures, was independent of upper-layer thickness and did not show hysteresis. The better performances of class II inverters, which showed high gains of 14.4 ± 1.1, were rationalized partly in terms of decreased mobility differences between their constituent transistors. Heterojunction geometries can be applied to obtain high-performance, fast-switching inverters by avoiding direct exposure of the air-sensitive transistors to ambient conditions. The inverters' general operating conduction mechanism is also discussed.

Method for inverting reflection trace data from 3-D and 4-D seismic surveys and identifying subsurface fluid and pathways in and among hydrocarbon reservoirs based on impedance models

Science.gov (United States)

He, W.; Anderson, R.N.

1998-08-25

A method is disclosed for inverting 3-D seismic reflection data obtained from seismic surveys to derive impedance models for a subsurface region, and for inversion of multiple 3-D seismic surveys (i.e., 4-D seismic surveys) of the same subsurface volume, separated in time to allow for dynamic fluid migration, such that small scale structure and regions of fluid and dynamic fluid flow within the subsurface volume being studied can be identified. The method allows for the mapping and quantification of available hydrocarbons within a reservoir and is thus useful for hydrocarbon prospecting and reservoir management. An iterative seismic inversion scheme constrained by actual well log data which uses a time/depth dependent seismic source function is employed to derive impedance models from 3-D and 4-D seismic datasets. The impedance values can be region grown to better isolate the low impedance hydrocarbon bearing regions. Impedance data derived from multiple 3-D seismic surveys of the same volume can be compared to identify regions of dynamic evolution and bypassed pay. Effective Oil Saturation or net oil thickness can also be derived from the impedance data and used for quantitative assessment of prospective drilling targets and reservoir management. 20 figs.

Single InAs/GaSb nanowire low-power CMOS inverter.

Science.gov (United States)

Dey, Anil W; Svensson, Johannes; Borg, B Mattias; Ek, Martin; Wernersson, Lars-Erik

2012-11-14

III-V semiconductors have so far predominately been employed for n-type transistors in high-frequency applications. This development is based on the advantageous transport properties and the large variety of heterostructure combinations in the family of III-V semiconductors. In contrast, reports on p-type devices with high hole mobility suitable for complementary metal-oxide-semiconductor (CMOS) circuits for low-power operation are scarce. In addition, the difficulty to integrate both n- and p-type devices on the same substrate without the use of complex buffer layers has hampered the development of III-V based digital logic. Here, inverters fabricated from single n-InAs/p-GaSb heterostructure nanowires are demonstrated in a simple processing scheme. Using undoped segments and aggressively scaled high-κ dielectric, enhancement mode operation suitable for digital logic is obtained for both types of transistors. State-of-the-art on- and off-state characteristics are obtained and the individual long-channel n- and p-type transistors exhibit minimum subthreshold swings of SS = 98 mV/dec and SS = 400 mV/dec, respectively, at V(ds) = 0.5 V. Inverter characteristics display a full signal swing and maximum gain of 10.5 with a small device-to-device variability. Complete inversion is measured at low frequencies although large parasitic capacitances deform the waveform at higher frequencies.

24 CFR 125.201 - Administrative Enforcement Initiative.

Science.gov (United States)

2010-04-01

... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...

Advanced Energy Validated Photovoltaic Inverter Technology at NREL | Energy

Science.gov (United States)

Inverter Technology at NREL Advanced Energy Industries-NREL's first partner at the Energy Systems Integration Facility (ESIF)-validated its advanced photovoltaic (PV) inverter technology using the ESIF's computer screen in a laboratory, with power inverter hardware in the background Photo by Dennis Schroeder

33 CFR 135.201 - Applicability.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Applicability. 135.201 Section 135.201 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...

Photovoltaic power generating system; Sanso zetsuengata taiyoko inverter

Energy Technology Data Exchange (ETDEWEB)

Nojima, T; Nakashima, T; Muta, Y; Takase, K; Hirayama, K [Nishimu Electronics Industries Co. Ltd., Saga (Japan)

1996-10-27

Nishimu Electronics Industries Co., Ltd. has developed a new series of inverters of three phase photovoltaic power generating system with the output ranging from 10 kVA to 50 kVA. For these inverters, the inverter and the system interconnection protector were integrated to make them smaller, lighter and cheaper. Stand-alone operation function was also added. The DC input voltage ranges were between 240 and 400 V for the crystalline solar cell, and between 170 and 400 V for the amorphous one. From the viewpoint of control of inverters, the inverters are generally controlled by the voltage-type current control method during the interconnection operation, while they must be controlled by the voltage-type voltage control method during the stand-alone operation which is the same as the UPS usually operated alone. For the present inverters, two control circuits for the interconnection operation and for the stand-alone operation were prepared. The control circuits for interconnection and stand-alone operations were switched using a cam-operation switch for change-over of operation. The results of the system interconnection verification tests satisfied the criteria of Japan`s Electronic Products Test Center. 3 refs., 4 figs., 2 tabs.

Insulating gallium oxide layer produced by thermal oxidation of gallium-polar GaN: Insulating gallium oxide layer produced by thermal oxidation of gallium-polar GaN

Energy Technology Data Exchange (ETDEWEB)

Hossain, T. [Kansas State Univ., Manhattan, KS (United States); Wei, D. [Kansas State Univ., Manhattan, KS (United States); Nepal, N. [Naval Research Lab. (NRL), Washington, DC (United States); Garces, N. Y. [Naval Research Lab. (NRL), Washington, DC (United States); Hite, J. K. [Naval Research Lab. (NRL), Washington, DC (United States); Meyer, H. M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Eddy, C. R. [Naval Research Lab. (NRL), Washington, DC (United States); Baker, Troy [Nitride Solutions, Wichita, KS (United States); Mayo, Ashley [Nitride Solutions, Wichita, KS (United States); Schmitt, Jason [Nitride Solutions, Wichita, KS (United States); Edgar, J. H. [Kansas State Univ., Manhattan, KS (United States)

2014-02-24

We report the benefits of dry oxidation of n -GaN for the fabrication of metal-oxide-semiconductor structures. GaN thin films grown on sapphire by MOCVD were thermally oxidized for 30, 45 and 60 minutes in a pure oxygen atmosphere at 850 °C to produce thin, smooth GaO_x layers. Moreover, the GaN sample oxidized for 30 minutes had the best properties. Its surface roughness (0.595 nm) as measured by atomic force microscopy (AFM) was the lowest. Capacitance-voltage measurements showed it had the best saturation in accumulation region and the sharpest transition from accumulation to depletion regions. Under gate voltage sweep, capacitance-voltage hysteresis was completely absent. The interface trap density was minimum (D_it = 2.75×10¹⁰ cm^–2eV^–1) for sample oxidized for 30 mins. These results demonstrate a high quality GaO_x layer is beneficial for GaN MOSFETs.

Accelerating development of advanced inverters :

Energy Technology Data Exchange (ETDEWEB)

Neely, Jason C.; Gonzalez, Sigifredo; Ropp, Michael; Schutz, Dustin

2013-11-01

The high penetration of utility interconnected photovoltaic (PV) systems is causing heightened concern over the effect that variable renewable generation will have on the electrical power system (EPS). These concerns have initiated the need to amend the utility interconnection standard to allow advanced inverter control functionalities that provide: (1) reactive power control for voltage support, (2) real power control for frequency support and (3) better tolerance of grid disturbances. These capabilities are aimed at minimizing the negative impact distributed PV systems may have on EPS voltage and frequency. Unfortunately, these advanced control functions may interfere with island detection schemes, and further development of advanced inverter functions requires a study of the effect of advanced functions on the efficacy of antiislanding schemes employed in industry. This report summarizes the analytical, simulation and experimental work to study interactions between advanced inverter functions and anti-islanding schemes being employed in distributed PV systems.

Film Grain-Size Related Long-Term Stability of Inverted Perovskite Solar Cells.

Science.gov (United States)

Chiang, Chien-Hung; Wu, Chun-Guey

2016-09-22

The power conversion efficiency (PCE) of the perovskite solar cell is high enough to be commercially viable. The next important issue is the stability of the device. This article discusses the effect of the perovskite grain-size on the long-term stability of inverted perovskite solar cells. Perovskite films composed of various sizes of grains were prepared by controlling the solvent annealing time. The grain-size related stability of the inverted cells was investigated both in ambient atmosphere at relative humidity of approximately 30-40 % and in a nitrogen filled glove box (H 2 Operovskite film having the grain size larger than 1 μm (D-10) decreases less than 10 % with storage in a glove box and less than 15 % when it was stored under an ambient atmosphere for 30 days. However, the cell using the perovskite film composed of small (∼100 nm) perovskite grains (D-0) exhibits complete loss of PCE after storage under the ambient atmosphere for only 15 days and a PCE loss of up to 70 % with storage in the glove box for 30 days. These results suggest that, even under H 2 O-free conditions, the chemical- and thermal-induced production of pin holes at the grain boundaries of the perovskite film could be the reason for long-term instability of inverted perovskite solar cells. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

46 CFR 201.7 - Information; special instructions.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Information; special instructions. 201.7 Section 201.7 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE General Information (Rule 1) § 201.7 Information; special instructions. Information...

14 CFR 1203.201 - Information security objectives.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives of...

Thallium-201 chloride dynamic analysis using thallium-201 chloride and sodium iodide-131 thyroid subtraction scintigraphy

Energy Technology Data Exchange (ETDEWEB)

Morimoto, Setsuo; Hiraki, Yoshio; Togami, Izumi [Okayama Univ. (Japan). School of Medicine

1984-10-01

The mechanism of /sup 201/Tl chloride accumulation is unclear in thyroid gland and thyroid tumor. This report examines 108 patients that received thyroid scintigraphy examinations with both /sup 201/Tl chloride and sodium /sup 131/I. The patients were diagnosed clinically and histologically whenever possible. The ROI were obtained by subtraction imaging with both isotopes and by subtraction positive and negative areas of imaging. Dynamic curves were obtained for /sup 201/Tl chloride per square unit of each ROI. The dynamic curve in the radioiodide-accumulated area was examined. The data indicate that the clearance rate of /sup 201/Tl chloride (T/sub 15/) was correlated with the sodium /sup 131/I uptake rate at 24 h (r=0.70).

Leakage current measurement in transformerless PV inverters

DEFF Research Database (Denmark)

Kerekes, Tamas; Sera, Dezso; Mathe, Laszlo

2012-01-01

Photovoltaic (PV) installations have seen a huge increase during the last couple of years. Transformerless PV inverters are gaining more share of the total inverter market, due to their high conversion efficiency, small weight and size. Nevertheless safety should have an important role in case...... of these tranformerless systems, due to the missing galvanic isolation. Leakage and fault current measurement is a key issue for these inverter topologies to be able to comply with the required safety standards. This article presents the test results of two different current measurement sensors that were suggested...

Static Characteristics of the Ferroelectric Transistor Inverter

Science.gov (United States)

Mitchell, Cody; Laws, crystal; MacLeond, Todd C.; Ho, Fat D.

2010-01-01

The inverter is one of the most fundamental building blocks of digital logic, and it can be used as the foundation for understanding more complex logic gates and circuits. This paper presents the characteristics of an inverter circuit using a ferroelectric field-effect transistor. The voltage transfer characteristics are analyzed with respect to varying parameters such as supply voltage, input voltage, and load resistance. The effects of the ferroelectric layer between the gate and semiconductor are examined, and comparisons are made between the inverters using ferroelectric transistors and those using traditional MOSFETs.

Performance of Thallium-201 Electrocardiography-gated Myocardial Perfusion Single Photon Emission Computed Tomography to Assess Left Ventricular Function

Directory of Open Access Journals (Sweden)

Guang-Uei Hung

2005-05-01

Full Text Available This study evaluated the performance of gated single photon emission computed tomography (SPECT with thallium-201 (201Tl in assessing left ventricular ejection fraction (LVEF, end-diastolic volume (EDV, and end-systolic volume (ESV in Taiwanese by determining repeatability and correlation with two-dimensional (2D echocardiography. A total of 18 patients underwent two sequential gated SPECT acquisitions within 30 minutes in the resting state to assess repeatability. Another 28 patients who underwent gated SPECT and 2D echocardiography within 7 days were included for comparison. The two sequential measurements were well correlated with respect to LVEF, EDV, and ESV (r = 0.97, 0.95, and 0.97, respectively, all p < 0.0001. Bland-Altman analysis revealed that two standard deviations of the absolute difference between the two sequential measurements for LVEF, EDV, and ESV were 6.4%, 16.8 mL, and 8.6 mL, respectively. For LVEF, EDV, and ESV, correlations between redistribution 201Tl-gated SPECT and echocardiography were also excellent (all r = 0.83, p < 0.0001. LVEF was similar with 201Tl-gated SPECT and echocardiography, but EDV and ESV were significantly higher with echocardiography (p < 0.05. Our study revealed that 201Tl-gated SPECT has high repeatability and excellent correlation with echocardiography for the assessment of LVEF and volumes in Taiwanese. These results support the clinical application of gated SPECT in routine 201Tl myocardial perfusion imaging in Taiwanese.

40 CFR 266.201 - Definitions.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Definitions. 266.201 Section 266.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF SPECIFIC HAZARDOUS WASTES AND SPECIFIC TYPES OF HAZARDOUS WASTE MANAGEMENT...

Main: PPD201 [AT Atlas

Lifescience Database Archive (English)

Full Text Available PPD201 PPD2 Overexpression of mammal origin membrane protein by high-density cultur...roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...

46 CFR 201.144 - Offer of proof.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...

48 CFR 201.303 - Publication and codification.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Publication and codification. 201.303 Section 201.303 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Regulations 201.303 Publication and codification. (a)(i) The DFARS is codified under chapter 2 in title 48...

An All-Solution-Based Hybrid CMOS-Like Quantum Dot/Carbon Nanotube Inverter.

Science.gov (United States)

Shulga, Artem G; Derenskyi, Vladimir; Salazar-Rios, Jorge Mario; Dirin, Dmitry N; Fritsch, Martin; Kovalenko, Maksym V; Scherf, Ullrich; Loi, Maria A

2017-09-01

The development of low-cost, flexible electronic devices is subordinated to the advancement in solution-based and low-temperature-processable semiconducting materials, such as colloidal quantum dots (QDs) and single-walled carbon nanotubes (SWCNTs). Here, excellent compatibility of QDs and SWCNTs as a complementary pair of semiconducting materials for fabrication of high-performance complementary metal-oxide-semiconductor (CMOS)-like inverters is demonstrated. The n-type field effect transistors (FETs) based on I - capped PbS QDs (V th = 0.2 V, on/off = 10 5 , S S-th = 114 mV dec -1 , µ e = 0.22 cm 2 V -1 s -1 ) and the p-type FETs with tailored parameters based on low-density random network of SWCNTs (V th = -0.2 V, on/off > 10 5 , S S-th = 63 mV dec -1 , µ h = 0.04 cm 2 V -1 s -1 ) are integrated on the same substrate in order to obtain high-performance hybrid inverters. The inverters operate in the sub-1 V range (0.9 V) and have high gain (76 V/V), large maximum-equal-criteria noise margins (80%), and peak power consumption of 3 nW, in combination with low hysteresis (10 mV). © 2017 The Authors. Published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Distributed Storage Inverter and Legacy Generator Integration Plus Renewables Solution for Microgrids

Science.gov (United States)

2015-07-01

inverter (advantage of short term storage) and enables microgrid upgrade of legacy generator assets (integration of inverter and generator controllers ...today. The storage inverter controls and hardware are also leveraged to provide an islanding inverter ( microgrid compatibility) for renewable...transiently rated inverters, integration with legacy generator controls , and microgrid compatible inverters for PV. Key system design drivers are lowering

Low voltage ride-through of single-phase transformerless photovoltaic inverters

DEFF Research Database (Denmark)

Yang, Yongheng; Blaabjerg, Frede; Wang, Huai

2013-01-01

Transformerless photovoltaic (PV) inverters are going to be more widely adopted in order to achieve high efficiency, as the penetration level of PV systems is continuously booming. However, problems may arise in highly PV-integrated distribution systems. For example, a sudden stoppage of all PV...... discussed. The selected inverters are the full-bridge inverter with bipolar modulation, full-bridge inverter with DC bypass and the Highly Efficient and Reliable Inverter Concept (HERIC). A 1 kW single-phase grid-connected PV system is analyzed to verify the discussions. The tests confirmed that, although...

Low Voltage Ride-Through of Single-Phase Transformerless Photovoltaic Inverters

DEFF Research Database (Denmark)

Yang, Yongheng; Blaabjerg, Frede; Wang, Huai

2014-01-01

Transformerless photovoltaic (PV) inverters are going to be more widely adopted in order to achieve high efficiency, as the penetration level of PV systems is continuously booming. However, problems may arise in highly PV-integrated distribution systems. For example, a sudden stoppage of all PV...... are also discussed. The selected inverters are the full-bridge inverter with bipolar modulation, full-bridge inverter with DC bypass and the Highly Efficient and Reliable Inverter Concept (HERIC). A 1 kW singlephase grid-connected PV system is analyzed to verify the discussions. The tests confirmed that...

7 CFR 1430.201 - Administration.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...

Hawaiian Electric Advanced Inverter Test Plan - Result Summary

Energy Technology Data Exchange (ETDEWEB)

Hoke, Anderson; Nelson, Austin; Prabakar, Kumaraguru; Nagarajan, Adarsh

2016-10-14

This presentation is intended to share the results of lab testing of five PV inverters with the Hawaiian Electric Companies and other stakeholders and interested parties. The tests included baseline testing of advanced inverter grid support functions, as well as distribution circuit-level tests to examine the impact of the PV inverters on simulated distribution feeders using power hardware-in-the-loop (PHIL) techniques. hardware-in-the-loop (PHIL) techniques.

46 CFR 201.117 - Inclusion in record.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

7 CFR 201.1 - Meaning of words.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Definitions § 201.1 Meaning of words. Words in the regulations in this part in the singular form...

20 CFR 201.1 - Words and phrases.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Words and phrases. 201.1 Section 201.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DEFINITIONS § 201.1 Words and phrases. For the purposes of the regulations in this chapter, except where the...

3D RECONSTRUCTION OF ANCIENT EGYPTIAN ROCK-CUT TOMBS: THE CASE OF M.I.D.A.N.05.

OpenAIRE

Nabil, M.; Betrò, M.; Metwally, M. N.

2013-01-01

In this paper we present an on-going work to reconstruct a 3D model of M.I.D.A.N.05., an ancient Egyptian tomb located in Luxor. The reconstruction aims at producing a high quality 3D model of the tomb to help in archaeological investigation and other scientific uses. We present details about the different stages of the used reconstruction pipeline, the results so far, and the evaluation of the results in view of the project objectives.

3D RECONSTRUCTION OF ANCIENT EGYPTIAN ROCK-CUT TOMBS: THE CASE OF M.I.D.A.N.05.

Directory of Open Access Journals (Sweden)

M. Nabil

2013-07-01

Full Text Available In this paper we present an on-going work to reconstruct a 3D model of M.I.D.A.N.05., an ancient Egyptian tomb located in Luxor. The reconstruction aims at producing a high quality 3D model of the tomb to help in archaeological investigation and other scientific uses. We present details about the different stages of the used reconstruction pipeline, the results so far, and the evaluation of the results in view of the project objectives.

Design optimization of transformerless grid-connected PV inverters including reliability

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2012-01-01

Of the Electricity (LCOE) generated during the PV system lifetime period is minimized. The LCOE is calculated also considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating that compared...... to the non-optimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless Photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal values and types of the PV inverter components are calculated such that the PV inverter Levelized Cost...

Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

such that the PV inverter LCOE generated during the PV system lifetime period is minimized. The LCOE is also calculated considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating...... that compared to the nonoptimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated...

Quality control 201TlCl solution obtained at IPEN-CNEN/SP through the direct method of 201Tl preparation

International Nuclear Information System (INIS)

Fernandes, L.; Silva, C.P.G. da.

1991-09-01

The radiopharmaceutical 201 TlCl is used in Nuclear medicine for myocardial visualization. The solution of 201 TlCl was prepared using 201 Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of 200 Tl, 201 Tl and 202 Tl; the chemical identification of 201 Tl +1 ; the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility, pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of thallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of 201 Tl with 200 Tl and 202 Tl its use in human beings is not possible unless enriched 202 Hg is used as target of irradiation. (author)

Comparison of 201Tl solution sources in UK hospitals, 2001

International Nuclear Information System (INIS)

Baker, M.; Woods, M.

2001-01-01

During recent years, concerns have been raised within the nuclear medicine field about the accuracy of activity measurements for 201 Tl. And indeed, NPL calibrations repeatedly indicated that the level of impurities present in such samples and the significant amount of activity adsorbed onto the glass wall of the container could produce erroneous results. In addition, the standard P6 vials, in which 201 Tl solution had been previously supplied, were recently replaced with the new ''10R Type 1 plus'' Schott vials. To assess the magnitude of these effects on the accuracy of clinical measurements of the activity of 201 Tl, an intercomparison exercise was conducted between the National Physical Laboratory (NPL), Nycomed-Amersham (NA) and the UK hospital physics community. The majority of the 273 reported results were within the ± 10 % limit of accuracy that hospitals aim to achieve for diagnosis, biased high. The tendency to overestimate the activity was more evident for syringe measurements. The exercise also revealed that the adsorption losses experienced with P6 vials had been solved by the introduction of the 10R vials, but individual calibrators need to be recalibrated for this new container. (author)

Closed-loop waveform control of boost inverter

DEFF Research Database (Denmark)

Zhu, Guo Rong; Xiao, Cheng Yuan; Wang, Haoran

2016-01-01

The input current of single-phase inverter typically has an AC ripple component at twice the output frequency, which causes a reduction in both the operating lifetime of its DC source and the efficiency of the system. In this paper, the closed-loop performance of a proposed waveform control method...... to eliminate such a ripple current in boost inverter is investigated. The small-signal stability and the dynamic characteristic of the inverter system for input voltage or wide range load variations under the closed-loop waveform control method are studied. It is validated that with the closedloop waveform...... control, not only was stability achieved, the reference voltage of the boost inverter capacitors can be instantaneously adjusted to match the new load, thereby achieving improved ripple mitigation for a wide load range. Furthermore, with the control and feedback mechanism, there is minimal level of ripple...

49 CFR 234.201 - Location of plans.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...

41 CFR 50-201.1101 - Minimum wages.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...

Distortion and regulation characterization of a Mapham inverter

Science.gov (United States)

Sundberg, Richard C.; Brush, Andrew S.; Button, Robert M.; Patterson, Alexander G.

1989-01-01

Output voltage Total Harmonic Distortion (THD) of a 20kHz, 6kVA Mapham resonant inverter is characterized as a function of its switching-to-resonant frequency ratio, f sub s/f sub r, using the EASY5 engineering analysis system. EASY5 circuit simulation results are compared with hardware test results to verify the accuracy of the simulations. The effects of load on the THD versus f sub s/f sub r ratio is investigated for resistive, leading, and lagging power factor load impedances. The effect of the series output capacitor on the Mapham inverter output voltage distortion and inherent load regulation is characterized under loads of various power factors and magnitudes. An optimum series capacitor value which improves the inherent load regulation to better than 3 percent is identified. The optimum series capacitor value is different than the value predicted from a modeled frequency domain analysis. An explanation is proposed which takes into account the conduction overlap in the inductor pairs during steady-state inverter operation, which decreases the effective inductance of a Mapham inverter. A fault protection and current limit method is discussed which allows the Mapham inverter to operate into a short circuit, even when the inverter resonant circuit becomes overdamped.

48 CFR 33.201 - Definitions.

Science.gov (United States)

2010-10-01

.... Alternative dispute resolution (ADR) means any type of procedure or combination of procedures voluntarily used... REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.201 Definitions. As used in this subpart... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 33.201...

9 CFR 201.3 - Authority.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS....3 Authority. The Administrator shall perform such duties as the Secretary may require in enforcing...

42 CFR 93.201 - Allegation.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Allegation. 93.201 Section 93.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

27 CFR 40.201 - Inventories.

Science.gov (United States)

2010-04-01

... PROCESSED TOBACCO Operations by Manufacturers of Tobacco Products Inventories and Reports § 40.201 Inventories. Every manufacturer of tobacco products shall make true and accurate inventories on Form 5210.9... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Inventories. 40.201...

A new Zero Voltage Switching three-level NPC inverter

DEFF Research Database (Denmark)

He, Ning; Chen, Yenan; Xu, Dehong

2015-01-01

A novel Zero Voltage Switching (ZVS) three-level NPC inverter topology using a new ZVS Space Vector Modulation (SVM) scheme is proposed. A detailed operation analysis of ZVS three-level NPC inverter is given. The ZVS condition of the proposed ZVS inverter is derived and it can be achieved of all...

Non-classical logic inverter coupling a ZnO nanowire-based Schottky barrier transistor and adjacent Schottky diode.

Science.gov (United States)

Hosseini Shokouh, Seyed Hossein; Raza, Syed Raza Ali; Lee, Hee Sung; Im, Seongil

2014-08-21

On a single ZnO nanowire (NW), we fabricated an inverter-type device comprising a Schottky diode (SD) and field-effect transistor (FET), aiming at 1-dimensional (1D) electronic circuits with low power consumption. The SD and adjacent FET worked respectively as the load and driver, so that voltage signals could be easily extracted as the output. In addition, NW FET with a transparent conducting oxide as top gate turned out to be very photosensitive, although ZnO NW SD was blind to visible light. Based on this, we could achieve an array of photo-inverter cells on one NW. Our non-classical inverter is regarded as quite practical for both logic and photo-sensing due to its performance as well as simple device configuration.

EVALUATION OF VARIOUS UNIPOLAR MULTICARRIER PWM STRATEGIES FOR FIVE LEVEL FLYING CAPACITOR INVERTER

Directory of Open Access Journals (Sweden)

B. SHANTHI

2012-06-01

Full Text Available This paper presents the comparison of unipolar multicarrier Pulse Width Modulation (PWM techniques for the Flying Capacitor Multi Level Inverter (FCMLI. Due to switch combination redundancies, there are certain degrees of freedom to generate the five level AC output voltage. This paper presents the use of Control Freedom Degree (CFD combination. The effectiveness of the PWM strategies developed using CFD are demonstrated by simulation and experimentation. The results indicate that the multilevel inverter triggered by the developed USHPWM strategy exhibits reduced harmonics. PWM strategies developed are implemented in real time using dSPACE/Real Time Interface (RTI. The simulation and experimental output closely match with each other validating the strategies presented.

Voltage Balancing Control of Diode-Clamped Multilevel Inverter

Directory of Open Access Journals (Sweden)

ŞCHIOP Adrian

2013-10-01

Full Text Available In this paper is developed a control scheme for mono-phase diode clamped inverter to achieve balancing voltages on inverter capacitors. First, it develops a control scheme without taking into account the need to balance voltage on two capacitors. It examines the effects on the output voltage inverter, and then it realizes two control schemes that will balance the voltages. The simulations of control schemes were performed in OrCAD Pspice.

Characterization of cartilaginous tumors with 201Tl scintigraphy

International Nuclear Information System (INIS)

Higuchi, Takahiro; Taki, Junichi; Sumiya, Hisashi; Kinuya, Seigo; Nakajima, Kenichi; Tonami, Norihisa

2005-01-01

Histological diagnosis and grading of cartilaginous tumors are closely correlated with patient prognosis; consequently, they are essential elements. We attempted to clarify the characteristics of 201 Tl uptake in various histological types of cartilaginous tumors and to assess its clinical value. Twenty-two cases with histologically proven cartilaginous tumors (3 enchondromas, 15 conventional chondrosarcomas (grade I=9, II=5, III=1), 3 mesenchymal chondrosarcomas, and 1 de-differentiated chondrosarcoma) were examined retrospectively. Planar 201 Tl images were recorded 15 mm following intravenous injection of 201 Tl (111 MBq). 201 Tl uptake in the tumor was evaluated visually employing a five-grade scoring system: 0=no appreciable uptake, 1=faint uptake above the background level, 2=moderate uptake, 3=intense uptake but lower than heart uptake and 4=uptake higher than heart uptake. 201 Tl uptake scores were 0 in 3 of 3 enchondromas, 9 of 9 grade I, and 4 of 5 grade II conventional chondrosarcomas. 201 Tl uptake scores were 1 among 1 of 5 grades II and a grade III conventional chondrosarcoma. Mesenchymal chondrosarcoma and de-differentiated chondrosarcoma displayed 201 Tl uptake scores of 2 or 3. Absence of elevated 201 Tl uptake in cartilaginous tumors was indicative of enchondroma or low-grade conventional chondrosarcoma. However, in instances in which 201 Tl uptake is obvious, high-grade chondrosarcoma or variant types should be considered. (author)

17 CFR 201.240 - Settlement.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.240 Section... of Practice Initiation of Proceedings and Prehearing Rules § 201.240 Settlement. (a) Availability... party to a proceeding already instituted, may, at any time, propose in writing an offer of settlement...

15 CFR 280.201 - Violations.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Violations. 280.201 Section 280.201 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... otherwise, fasteners that are required by the applicable consensus standard or standards to bear an insignia...

48 CFR 50.201 - Definitions.

Science.gov (United States)

2010-10-01

... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 50.201...

47 CFR 201.2 - Definitions.

Science.gov (United States)

2010-10-01

... private sector must become engaged in the interests of national survival and recovery. (g) National... (47 U.S.C. 606), as amended. (j) Private sector means those sectors of non-government entities that... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2...

Broadband chirality and asymmetric transmission in ultrathin 90°-twisted Babinet-inverted metasurfaces

Science.gov (United States)

Shi, J. H.; Ma, H. F.; Guan, C. Y.; Wang, Z. P.; Cui, T. J.

2014-04-01

A broadband asymmetric transmission of linearly polarized waves with totally suppressed copolarization transmission is experimentally demonstrated in ultrathin 90°-twisted Babinet-inverted metasurfaces constructed by an array of asymmetrically split ring apertures. The only accessible direction-dependent cross-polarization transmission is allowed in this anisotropic chiral metamaterial. Through full-wave simulation and experiment results, the bilayered Babinet-inverted metasurface reveals broadband artificial chirality and asymmetric transmission, with a transmission contrast that is better than 17.7 dB within a 50% relative bandwidth for two opposite directions. In particular, we can modify polarization conversion efficiency and the bandwidth of asymmetric transmission via parametric study.

Analysis of the Measurement and Modeling of a Digital Inverter Based on a Ferroelectric Transistor

Science.gov (United States)

MacLeod, Todd C.; Phillips, Thomas A.; Sayyah, Rana; Ho, Fat D.

2009-01-01

The use of ferroelectric materials for digital memory devices is widely researched and implemented, but ferroelectric devices also possess unique characteristics that make them have interesting and useful properties in digital circuits. Because ferroelectric transistors possess the properties of hysteresis and nonlinearity, a digital inverter containing a FeFET has very different characteristics than one with a traditional FET. This paper characterizes the properties of the measurement and modeling of a FeFET based digital inverter. The circuit was set up using discrete FeFETs. The purpose of this circuit was not to produce a practical integrated circuit that could be inserted directly into existing digital circuits, but to explore the properties and characteristics of such a device and to look at possible future uses. Input and output characteristics are presented, as well as timing measurements. Comparisons are made between the ferroelectric device and the properties of a standard digital inverter. Potential benefits and possible uses of such a device are presented.

Simulation of Fuzzy Adaptive PI Controlled Grid Interactive Inverter

Directory of Open Access Journals (Sweden)

Necmi ALTIN

2009-03-01

Full Text Available In this study, a voltage source grid interactive inverter is modeled and simulated in MATLAB/Simulink. Inverter is designed as current controlled and a fuzzy-PI current controller used for the generation of switching pattern to shape the inverter output current. The grid interactive inverter consists of a line frequency transformer and a LC type filter. Galvanic isolation between the grid and renewable energy source is obtained by the line frequency transformer and LC filter is employed to filter the high frequency harmonic components in current waveform due to PWM switching and to reduce the output current THD. Results of the MATLAB/Simulink simulation show that inverter output current is in sinusoidal waveform and in phase with line voltage, and current harmonics are in the limits of international standards (

46 CFR 201.20 - Attorneys at law.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State or...

10 CFR 830.201 - Performance of work.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Performance of work. 830.201 Section 830.201 Energy DEPARTMENT OF ENERGY NUCLEAR SAFETY MANAGEMENT Safety Basis Requirements § 830.201 Performance of work. A contractor must perform work in accordance with the safety basis for a hazard category 1, 2, or 3 DOE nuclear...

9 CFR 201.1 - Meaning of words.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.1 Meaning of words. Words used in this part in the singular form shall be deemed to import the...

Inverted L osteotomy: a new approach via intraoral access through the advances of virtual surgical planning and custom fixation

Directory of Open Access Journals (Sweden)

Peter B. Franco, DMD

2016-03-01

Full Text Available We introduce a novel surgical approach via intraoral access to the Inverted L osteotomy utilizing virtual surgical planning (VSP and patient-specific customized mandibular fixation. VSP in orthognathic surgery has been well documented in its ability to increase preoperative and intraoperative efficiency, decrease cost and operating room time, and improve predictability and patient outcomes. In addition to occlusal splints, the adjunctive cutting guides and reference templates generated through computer-aided design and computer-aided manufacturing further aids in the precise transfer of the virtual plan to the intraoperative procedure. As the application of VSP is becoming more prevalent in the surgical treatment dentofacial deformities, 3-D virtual planning is moving beyond cutting jigs and guides and into the fabrication of patient-specific customized mandibular reconstruction plates in both the orthognathic and reconstructive arenas. Orthognathic surgery can be essential for the establishment of sound function and ideal esthetics for individuals who possess a dentofacial deformity. VSP and customized mandibular reconstruction plates have great potential to help safely guide the inverted L osteotomy and produce predictable functional and esthetic results while improving efficiency preoperatively as well as intraoperatively.

Stable Inverted Low-Bandgap Polymer Solar Cells with Aqueous Solution Processed Low-Temperature ZnO Buffer Layers

Directory of Open Access Journals (Sweden)

Chunfu Zhang

2016-01-01

Full Text Available Efficient inverted low-bandgap polymer solar cells with an aqueous solution processed low-temperature ZnO buffer layer have been investigated. The low-bandgap material PTB-7 is employed so that more solar light can be efficiently harvested, and the aqueous solution processed ZnO electron transport buffer layer is prepared at 150°C so that it can be compatible with the roll-to-roll process. Power conversion efficiency (PCE of the inverted device reaches 7.12%, which is near the control conventional device. More importantly, the inverted device shows a better stability, keeping more than 90% of its original PCE after being stored for 625 hours, while PCE of the conventional device is only 75% of what it was. In addition, it is found that the ZnO thin film annealed in N2 can obviously increase PCE of the inverted device further to 7.26%.

Triple inverter pierce oscillator circuit suitable for CMOS

Science.gov (United States)

Wessendorf,; Kurt, O [Albuquerque, NM

2007-02-27

An oscillator circuit is disclosed which can be formed using discrete field-effect transistors (FETs), or as a complementary metal-oxide-semiconductor (CMOS) integrated circuit. The oscillator circuit utilizes a Pierce oscillator design with three inverter stages connected in series. A feedback resistor provided in a feedback loop about a second inverter stage provides an almost ideal inverting transconductance thereby allowing high-Q operation at the resonator-controlled frequency while suppressing a parasitic oscillation frequency that is inherent in a Pierce configuration using a "standard" triple inverter for the sustaining amplifier. The oscillator circuit, which operates in a range of 10 50 MHz, has applications for use as a clock in a microprocessor and can also be used for sensor applications.

Integrated Inverter For Driving Multiple Electric Machines

Science.gov (United States)

Su, Gui-Jia [Knoxville, TN; Hsu, John S [Oak Ridge, TN

2006-04-04

An electric machine drive (50) has a plurality of inverters (50a, 50b) for controlling respective electric machines (57, 62), which may include a three-phase main traction machine (57) and two-phase accessory machines (62) in a hybrid or electric vehicle. The drive (50) has a common control section (53, 54) for controlling the plurality of inverters (50a, 50b) with only one microelectronic processor (54) for controlling the plurality of inverters (50a, 50b), only one gate driver circuit (53) for controlling conduction of semiconductor switches (S1-S10) in the plurality of inverters (50a, 50b), and also includes a common dc bus (70), a common dc bus filtering capacitor (C1) and a common dc bus voltage sensor (67). The electric machines (57, 62) may be synchronous machines, induction machines, or PM machines and may be operated in a motoring mode or a generating mode.

3D Modelling and Printing Technology to Produce Patient-Specific 3D Models.

Science.gov (United States)

Birbara, Nicolette S; Otton, James M; Pather, Nalini

2017-11-10

A comprehensive knowledge of mitral valve (MV) anatomy is crucial in the assessment of MV disease. While the use of three-dimensional (3D) modelling and printing in MV assessment has undergone early clinical evaluation, the precision and usefulness of this technology requires further investigation. This study aimed to assess and validate 3D modelling and printing technology to produce patient-specific 3D MV models. A prototype method for MV 3D modelling and printing was developed from computed tomography (CT) scans of a plastinated human heart. Mitral valve models were printed using four 3D printing methods and validated to assess precision. Cardiac CT and 3D echocardiography imaging data of four MV disease patients was used to produce patient-specific 3D printed models, and 40 cardiac health professionals (CHPs) were surveyed on the perceived value and potential uses of 3D models in a clinical setting. The prototype method demonstrated submillimetre precision for all four 3D printing methods used, and statistical analysis showed a significant difference (p3D printed models, particularly using multiple print materials, were considered useful by CHPs for preoperative planning, as well as other applications such as teaching and training. This study suggests that, with further advances in 3D modelling and printing technology, patient-specific 3D MV models could serve as a useful clinical tool. The findings also highlight the potential of this technology to be applied in a variety of medical areas within both clinical and educational settings. Copyright © 2017 Australian and New Zealand Society of Cardiac and Thoracic Surgeons (ANZSCTS) and the Cardiac Society of Australia and New Zealand (CSANZ). Published by Elsevier B.V. All rights reserved.

An SCR inverter for electric vehicles

Science.gov (United States)

Latos, T.; Bosack, D.; Ehrlich, R.; Jahns, T.; Mezera, J.; Thimmesch, D.

1980-01-01

An inverter for an electric vehicle propulsion application has been designed and constructed to excite a polyphase induction motor from a fixed propulsion battery source. The inverter, rated at 35kW peak power, is fully regenerative and permits vehicle operation in both the forward and reverse directions. Thyristors are employed as the power switching devices arranged in a dc bus commutated topology. This paper describes the major role the controller plays in generating the motor excitation voltage and frequency to deliver performance similar to dc systems. Motoring efficiency test data for the controller are presented. It is concluded that an SCR inverter in conjunction with an ac induction motor is a viable alternative to present dc vehicle propulsion systems on the basis of performance and size criteria.

Neonatal nonepileptic myoclonus is a prominent clinical feature of KCNQ2 gain-of-function variants R201C and R201H

DEFF Research Database (Denmark)

Mulkey, Sarah B; Ben-Zeev, Bruria; Nicolai, Joost

2017-01-01

OBJECTIVE: To analyze whether KCNQ2 R201C and R201H variants, which show atypical gain-of-function electrophysiologic properties in vitro, have a distinct clinical presentation and outcome. METHODS: Ten children with heterozygous, de novo KCNQ2 R201C or R201H variants were identified worldwide...... patients had encephalopathy from birth and presented with prominent startle-like myoclonus, which could be triggered by sound or touch. In seven patients, electroencephalography (EEG) was performed in the neonatal period and showed a burst-suppression pattern. However, myoclonus did not have an EEG...... respiratory failure and/or chronic hypoventilation), hypomyelination, reduced brain volume, and profound developmental delay. One patient had a later onset, and sequencing indicated that a low abundance (~20%) R201C variant had arisen by postzygotic mosaicism. SIGNIFICANCE: Heterozygous KCNQ2 R201C and R201H...

21 CFR 201.61 - Statement of identity.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...

GC-MS analysis of ethanol solution with D2O as solvent implanted by low energy N+

International Nuclear Information System (INIS)

Shi Huaibin; Shao Chunlin; Yu Zengliang

2001-10-01

Low energy ions were produced by N 2 glow-discharge. The positive ones were accelerated into ethanol solution with D 2 O as solvent to induce chemical reactions. GC-MS analysis showed that DCH 2 CH 2 OH, HOCH 2 CH 2 OD were produced by such kind of implantation. Thus, it was proved that the reaction was mainly caused by radicals generated by decomposition of water molecules, D . and . OD played an important role in the process. Meanwhile, CH 3 COOD and HOCH 2 CH 2 ND 2 were also found in the products, so it was concluded that the reaction was carried out under an oxidative atmosphere, which was thought to be probably related to . OD radicals, too. The capture of D from D 2 O by N + to form . ND 2 radicals was not only an initial step to produce HOCH 2 CH 2 ND 2 but also served as a probable pattern for 'nitrogen deposition'. All these were helpful to reveal the mechanism of the reaction induced by low energy N + implanting into solution samples

KK -theory and spectral flow in von Neumann algebras

DEFF Research Database (Denmark)

Kaad, Jens; Nest, Ryszard; Rennie, Adam

2012-01-01

We present a definition of spectral flow for any norm closed ideal J in any von Neumann algebra N. Given a path of selfadjoint operators in N which are invertible in N/J, the spectral flow produces a class in Ko (J). Given a semifinite spectral triple (A, H, D) relative to (N, t) with A separable...

Quantitative stress-redistribution planar T1-201 scintigraphy: Assessment of the extent of hypoperfused myocardium by relationship to angiographic findings

International Nuclear Information System (INIS)

Bassir, R.; Maddahi, J.; Garcia, E.

1984-01-01

The size of hypoperfused myocardium (HM) in coronary artery (CA) disease (D) potentially provides a prognostic index that may not be accurately assess by conventional angiographic classification. The authors studied 62 consecutive patients (pts) with planar stress-redistribution T1-201 scintigraphy (T1-201) and coronary arteriography who did not have prior myocardial infarction and achieved 85% predicted maximum heart rate on exercise. Of 62 pts, 42 had CAD (>50% stenosis). For T1-201 quantification of the size of HM, maximum count circumferential profiles of initial distribution and % washout were obtained and compared to previously established normal limits. The area enclosed between the normal limits and the abnormal portion of the pt's profiles represented a quantitative T1-201 jeopardy score (JS). Despite increasing T1-201 JS from 1 to 3 vessel (V) and left-main (LM) D, significant overlap between the different angiographic groups was observed; of 45 pts with mild JS (<300), 14 (31%) had 3VD and/or LMD. The angiographic extent of CAD was also analyzed using a method (CLASS) proposed by Gensini et al based on the CA territory, location and severity of stenosis, and collateral circulation. T1-201 JS correlated significantly with CLASS (r=.78, p<.01). Of the 45 pts with mild JS, only 5 (11%) had severe CLASS score. Thus, the size of the hypoperfused myocardium by quantitative stress- and redistribution T1-201 correlates better with a more complex angiographic estimate of myocardium at risk than conventional 1, 2, and 3 vessel disease classification

Small-angle neutron polarization for the /sup 2/H(d vector,n vector)/sup 3/He reaction near Esub(d) = 8MeV

Energy Technology Data Exchange (ETDEWEB)

Tornow, W.; Woye, W.; Mack, G. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Walter, R.L.; Floyd, C.E.; Guss, P.P.; Byrd, R.C. (Duke Univ., Durham, NC (USA). Dept. of Physics; Triangle Universities Nuclear Lab., Durham, NC (USA))

1981-12-15

Considerable improvement in the quality of analyzing power experiments performed with polarized fast neutrons has been achieved during the last few years by using neutrons from the polarization transfer reaction /sup 2/H(d vector,n vector)/sup 3/He at a reaction angle of theta = 0/sup 0/. To compromise in these experiments between intensity problems and finite geometry corrections, it is desirable in some instances to subtend a full-width angle ..delta..theta of 20/sup 0/ (lab) centered about theta = 0/sup 0/. In order to investigate the suitability of this reaction as a source of polarized neutrons for cases where the scatterer is close to the neutron source, the neutron polarization of the reaction /sup 2/H(d vector,n vector)/sup 3/He has been studied with ..delta..theta of about 3/sup 0/ in 3/sup 0/ steps out to theta = 20/sup 0/ (lab). An incident deuteron energy near 8 MeV was chosen to yield outgoing neutrons at 11.0 MeV, a typical energy for neutron analyzing power experiments. It is found that the effective neutron polarization, a combination of the two polarizations measured when the direction of the deuteron polarization is inverted or flipped at the polarized ion source, is large and nearly constant for angles between theta = 0/sup 0/ and theta = 10/sup 0/ (lab).

Top-gate hybrid complementary inverters using pentacene and amorphous InGaZnO thin-film transistors with high operational stability

Directory of Open Access Journals (Sweden)

J. B. Kim

2012-03-01

Full Text Available We report on the operational stability of low-voltage hybrid organic-inorganic complementary inverters with a top-gate bottom source-drain geometry. The inverters are comprised of p-channel pentacene and n-channel amorphous InGaZnO thin-film transistors (TFTs with bi-layer gate dielectrics formed from an amorphous layer of a fluoropolymer (CYTOP and a high-k layer of Al2O3. The p- and n- channel TFTs show saturation mobility values of 0.1 ± 0.01 and 5.0 ± 0.5 cm2/Vs, respectively. The individual transistors show high electrical stability with less than 6% drain-to-source current variations after 1 h direct current (DC bias stress. Complementary inverters yield hysteresis-free voltage transfer characteristics for forward and reverse input biases with static DC gain values larger than 45 V/V at 8 V before and after being subjected to different conditions of electrical stress. Small and reversible variations of the switching threshold voltage of the inverters during these stress tests are compatible with the observed stability of the individual TFTs.

31 CFR 31.201 - Definitions.

Science.gov (United States)

2010-07-01

... agency agreement between a private sector entity and the Treasury for services under the TARP, other than... Stabilization Act of 2008. Key individual means an individual providing services to a private sector entity who... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 31.201 Section 31.201...

High efficiency H6 single-phase transformerless grid-tied PV inverter with proposed modulation for reactive power generation

Science.gov (United States)

Almasoudi, Fahad M.; Alatawi, Khaled S.; Matin, Mohammad

2017-08-01

Implementation of transformerless inverters in PV grid-tied system offer great benefits such as high efficiency, light weight, low cost, etc. Most of the proposed transformerless inverters in literature are verified for only real power application. Currently, international standards such as VDE-AR-N 4105 has demanded that PV grid-tied inverters should have the ability of controlling a specific amount of reactive power. Generation of reactive power cannot be accomplished in single phase transformerless inverter topologies because the existing modulation techniques are not adopted for a freewheeling path in the negative power region. This paper enhances a previous high efficiency proposed H6 trnasformerless inverter with SiC MOSFETs and demonstrates new operating modes for the generation of reactive power. A proposed pulse width modulation (PWM) technique is applied to achieve bidirectional current flow through freewheeling state. A comparison of the proposed H6 transformerless inverter using SiC MOSFETs and Si MOSFTEs is presented in terms of power losses and efficiency. The results show that reactive power control is attained without adding any additional active devices or modification to the inverter structure. Also, the proposed modulation maintains a constant common mode voltage (CM) during every operating mode and has low leakage current. The performance of the proposed system verifies its effectiveness in the next generation PV system.

Automatic load sharing in inverter modules

Science.gov (United States)

Nagano, S.

1979-01-01

Active feedback loads transistor equally with little power loss. Circuit is suitable for balancing modular inverters in spacecraft, computer power supplies, solar-electric power generators, and electric vehicles. Current-balancing circuit senses differences between collector current for power transistor and average value of load currents for all power transistors. Principle is effective not only in fixed duty-cycle inverters but also in converters operating at variable duty cycles.

Base drive for paralleled inverter systems

Science.gov (United States)

Nagano, S. (Inventor)

1980-01-01

In a paralleled inverter system, a positive feedback current derived from the total current from all of the modules of the inverter system is applied to the base drive of each of the power transistors of all modules, thereby to provide all modules protection against open or short circuit faults occurring in any of the modules, and force equal current sharing among the modules during turn on of the power transistors.

Six transformer based asymmetrical embedded Z-source inverters

DEFF Research Database (Denmark)

Wei, Mo; Poh Chiang, Loh; Chi, Jin

2013-01-01

Embedded/Asymmetrical embedded Z-source inverters were proposed to maintain smooth input current/voltage across the dc source and within the impedance network, remain the shoot-through feature used to boost up the dc-link voltage without adding bulky filter at input side. This paper introduces a ...... a class of transformer based asymmetrical embedded Z-source inverters which keep the smooth input current and voltage while achieving enhanced voltage boost capability. The presented inverters are verified by laboratory prototypes experimentally....

Designing a Smaller Power Inverter: the Google Littlebox Challenge - Text

Science.gov (United States)

Version | Energy Systems Integration Facility | NREL Designing a Smaller Power Inverter: the Google Littlebox Challenge - Text Version er Power Inverter: the Google Littlebox Challenge - Text Version Below is the text version for the Designing a Smaller Power Inverter: the Google Littlebox

Study of two-dimensional hole gas at Si/SiGe/Si inverted interface

International Nuclear Information System (INIS)

Sadeghazdeh, M.A.; Mironov, O.A.; Parry, C.P.; Philips, P.J.; Parker, E.H.C.; Wahll, T.E.; Emeleus, C.J.

1998-01-01

We have studied the transport of two-dimensional hole gas (2DHG) at the inverted interface of a strained Si 0.8 Ge 0.2 quantum well. By application of bias voltage to a Schottky gate on top of this inverted heterostructure the 2DHG density n s can be controlled, in the range of (1.5-5.2)x10 11 cm -2 . At temperature T = 033 K, the Hall mobility is 4650 cm 2 V -1 s -1 at the maximum carrier density. For lower sheet densities (n s 11 cm -2 ) the system undergoes a transition from a weak to strongly localised phase of significantly reduced mobility. From low temperature Shubnikov-de Haas oscillation measurements we have extracted the hole effective masses m* = (0.25 → 0.28)m o and the ratio of transport to quantum lifetimes α = (0.92 → 0.85) for the corresponding carrier density change of n s = (5.2 → 2.5)x10 11 cm -2 . These results can be explained in terms of the abnormal movement of the hole wave function towards the interface with decreasing n s , short range interface roughness scattering. (author)

Clearance of thallium-201 from the peripheral blood: comparison of immediate and standard thallium-201 reinjection

International Nuclear Information System (INIS)

Eck-Smit, B.L.F. van; Wall, E.E. van der; Verhoeven, P.P.A.M.; Poots, S.; Zwinderman, A.H.; Pauwels, E.K.J.

1996-01-01

We investigated whether the kinetics of thallium-201 would differ between the standard stress-redistribution-reinjection approach and the stress-immediate reinjection approach. In 53 patients with undiagnosed chest pain, 75 MBq (2 mCi) 201 Tl was injected at maximal exercise. In 26 patients (group I), 37 MBq (1 mCi) 201 Tl was reinjected immediately after completing the exercise images and in 27 patients (group II), 37 MBq (1 mCi) 201 Tl was reinjected after completing 3-h redistribution images. Mean peak 201 Tl blood activity after exercise was 17.7±12.5 kBq/ml (4.8±3.4 mCi/ml) for group I versus 16.4±9.2 kBq/ml (4.4±2.5 mCi/ml) for group II (NS). The relative increase in 201 Tl blood activity after reinjection of half the initial dose [37 MBq (1 mCi)] exceeded 50% of the initial peak in both groups. The relative amount of 201 Tl delivered to the myocardium was assessed by the area under the curve after both exercise and reinjection, and was 117%±72% for group I and 112%±73% for group II (NS). Blood clearance of 201 Tl was at least biexponential. Mean early decay constants (λ 1 ) after exercise and reinjection were 0.30±0.18 min -1 and 0.22±0.046 min -1 resp. for group I, and 0.30±0.12 min -1 and 0.24±0.07 min -1 resp. for group II. For both procedures no significant differences were found between λ 1 after exercise and λ 1 after injection. The mean late clearance (λ 2 ) from the blood was 0.032±0.056 min -1 and 0.012±0.012 min -1 resp. for group I, and 0.036±0.030 min -1 and 0.014±0.014 min -1 resp. for group II. Also, no significant differences were found between λ 2 after exercise for both groups and between λ 2 after reinjection for both groups. (orig./MG)

201Tl scintigraphy in the evaluation of palpable and nonpalpable breast lesions: correlation with mammography and ultrasonography

International Nuclear Information System (INIS)

Vural, G.; Atasever, T.; Oezdemir, A.; Oeznur, I.; Karabacak, N.I.; Goekcora, N.; Isik, S.; Uenlue, M.

1997-01-01

Tl-201 scintigraphy were performed in sixty-eight patients with 70 breast abnormalities (51 palpable, 19 nonpalpable) and compared with mammography and ultrasonography (US). Early (15 min) and late (3 h) images of the breasts were obtained following the injection of 111 MBq (3 mCi) of Tl-201. Visual and semiquantitative interpretation was performed. Final diagnosis confirmed 52 malignant breast lesions and 18 benign conditions. Tl-201 visualized 47 of 52 (90%) overall malignant lesions. Thirty-eight of 40 (95%) palpable and 9 of 12 (75%) nonpalpable breast cancers were detected by Tl-201 scintigraphy. The smallest mass lesion detected by Tl-201 measured 1.5x1.0 cm. Eleven breast lesions were interpreted as indeterminate by mammography and/or sonography. Tl-201 scintigraphy excluded malignancy in 7 of 8 (88%) patients with benign breast lesions interpreted as indeterminate. Five of the 18 (28%) benign breast lesions showed Tl-201 uptake. None of the fibroadenoma and fibrocystic changes accumulated Tl-201. Tl-201 scintigraphy, mammography and ultrasonography showed 90%, 92%, 85% overall sensitivity and 72%, 56%, 61% overall specificity respectively. Twenty-one of the 28 (75%) axillary nodal metastatic sites were also detected by Tl-201. In malignant and benign lesions, early and late lesion/contralateral normal side (L/N) ratios were 1.58±0.38 (mean±SD) and 1.48±0.32 (p>0.05), 1.87±0.65 and 1.34±0.20 (p 0.05). (orig./MG) [de

An inverter/controller subsystem optimized for photovoltaic applications

Science.gov (United States)

Pickrell, R. L.; Merrill, W. C.; Osullivan, G.

1978-01-01

Conversion of solar array dc power to ac power stimulated the specification, design, and simulation testing of an inverter/controller subsystem tailored to the photovoltaic power source characteristics. This paper discusses the optimization of the inverter/controller design as part of an overall Photovoltaic Power System (PPS) designed for maximum energy extraction from the solar array. The special design requirements for the inverter/controller include: (1) a power system controller (PSC) to control continuously the solar array operating point at the maximum power level based on variable solar insolation and cell temperatures; and (2) an inverter designed for high efficiency at rated load and low losses at light loadings to conserve energy. It must be capable of operating connected to the utility line at a level set by an external controller (PSC).

An SCR inverter with an integral battery charger for electric vehicles

Science.gov (United States)

Thimmeach, D.

1983-01-01

The feasibility of incorporating an onboard battery charger into the inverter previously developed under a NASA contract is successfully demonstrated. The rated output power of the resulting isolated battery charger is 3.6 kW at 220 Vac with an 86 percent efficiency and a 95 percent power factor. Also achieved are improved inverter efficiency (from 90 to 93 percent at 15 kW motor shaft power), inverter peak power capability (from 26 to 34 kW), and reduced weight and volume of the combined inverter/charger package (47 kg, 49 x 44 x 24 cm). Some major conclusions are that using the inverter commutation circuitry to perform the battery charging function is advantageous, and that the input-commutated thyristor inverter has the potential to be an excellent inverter and battery charger for use in electric vehicle applications.

Small product, big renaissance. Module current inverters: Revival of an obsolescent technology; Kleines Produkt, grosser Neuanfang. Der Modulwechselrichter war tot, jetzt koennte seine Renaissance bevorstehen

Energy Technology Data Exchange (ETDEWEB)

Bosworth, Melissa; Podewils, Christoph

2009-10-15

Module current inverters were among the first inventions in the short history of photovoltaic conversion. They convert d.c. modules into a.c. modules and were very popular in the mid-nineties. As solar systems became bigger, however, the market demanded stronger, central current inverters. By 2005, module current inverters were no longer offered by manufacturers as they had high failure rates and low efficiencies. Now, they are having a comeback. (orig.)

Stable inverted polymer/fullerene solar cells using a cationic polythiophene modified PEDOT:PSS cathodic interface

Energy Technology Data Exchange (ETDEWEB)

Rider, David A.; Worfolk, Brian J.; Buriak, Jillian M. [Department of Chemistry, University of Alberta, Edmonton, Alberta (Canada); NRC National Institute for Nanotechnology, Edmonton, Alberta (Canada); Harris, Kenneth D.; Shahbazi, Kevin; Fleischauer, Michael D. [NRC National Institute for Nanotechnology, Edmonton, Alberta (Canada); Lalany, Abeed [Department of Electrical and Computer Engineering, University of Alberta, Edmonton (Canada); Brett, Michael J. [NRC National Institute for Nanotechnology, Edmonton, Alberta (Canada); Department of Electrical and Computer Engineering, University of Alberta, Edmonton (Canada)

2010-08-09

A cationic and water-soluble polythiophene [poly[3-(6-pyridiniumylhexyl)thiophene bromide](P3PHT{sup +}Br{sup -})] is synthesized and used in combination with anionic poly(3,4-ethylenedioxythiophene):poly(p-styrenesulfonate) (PEDOT:PSS){sup -} to produce hybrid coatings on indium tin oxide (ITO). Two coating strategies are established: i) electrostatic layer-by-layer assembly with colloidal suspensions of (PEDOT:PSS){sup -}, and ii) modification of an electrochemically prepared (PEDOT:PSS){sup -} film on ITO. The coatings are found to modify the work function of ITO such that it could act as a cathode in inverted 2,5-diyl-poly(3-hexylthiophene) (P3HT)/[6,6]-phenyl-C{sub 61}-butyric acid methyl ester (PCBM) polymer photovoltaic cells. The interfacial modifier created from the layer-by-layer assembly route is used to produce efficient inverted organic photovoltaic devices (power conversion efficiency {proportional_to}2%) with significant long-term stability in excess of 500 h. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

Inverter-based successive approximation capacitance-to-digital converter

KAUST Repository

Omran, Hesham; Alhoshany, Abdulaziz; Salama, Khaled N.

2017-01-01

offset voltage will result in signal-dependent and parasitic-dependent conversion errors, which necessitates an op-amp-based implementation. The inverter-based SAR CDC contemplated herein provides robust, energy-efficient, and fast operation. The inverter

First-in-Human Clinical Trial of Oral ONC201 in Patients with Refractory Solid Tumors.

Science.gov (United States)

Stein, Mark N; Bertino, Joseph R; Kaufman, Howard L; Mayer, Tina; Moss, Rebecca; Silk, Ann; Chan, Nancy; Malhotra, Jyoti; Rodriguez, Lorna; Aisner, Joseph; Aiken, Robert D; Haffty, Bruce G; DiPaola, Robert S; Saunders, Tracie; Zloza, Andrew; Damare, Sherri; Beckett, Yasmeen; Yu, Bangning; Najmi, Saltanat; Gabel, Christian; Dickerson, Siobhan; Zheng, Ling; El-Deiry, Wafik S; Allen, Joshua E; Stogniew, Martin; Oster, Wolfgang; Mehnert, Janice M

2017-08-01

Purpose: ONC201 is a small-molecule selective antagonist of the G protein-coupled receptor DRD2 that is the founding member of the imipridone class of compounds. A first-in-human phase I study of ONC201 was conducted to determine its recommended phase II dose (RP2D). Experimental Design: This open-label study treated 10 patients during dose escalation with histologically confirmed advanced solid tumors. Patients received ONC201 orally once every 3 weeks, defined as one cycle, at doses from 125 to 625 mg using an accelerated titration design. An additional 18 patients were treated at the RP2D in an expansion phase to collect additional safety, pharmacokinetic, and pharmacodynamic information. Results: No grade >1 drug-related adverse events occurred, and the RP2D was defined as 625 mg. Pharmacokinetic analysis revealed a C max of 1.5 to 7.5 μg/mL (∼3.9-19.4 μmol/L), mean half-life of 11.3 hours, and mean AUC of 37.7 h·μg/L. Pharmacodynamic assays demonstrated induction of caspase-cleaved keratin 18 and prolactin as serum biomarkers of apoptosis and DRD2 antagonism, respectively. No objective responses by RECIST were achieved; however, radiographic regression of several individual metastatic lesions was observed along with prolonged stable disease (>9 cycles) in prostate and endometrial cancer patients. Conclusions: ONC201 is a selective DRD2 antagonist that is well tolerated, achieves micromolar plasma concentrations, and is biologically active in advanced cancer patients when orally administered at 625 mg every 3 weeks. Clin Cancer Res; 23(15); 4163-9. ©2017 AACR . ©2017 American Association for Cancer Research.

Asymmetric split-gate ambipolar transistor and its circuit application to complementary inverter

NARCIS (Netherlands)

Yoo, H.; Smits, E.C.P.; van Breemen, A.J.J.M.; van der Steen, J.L.; Torricelli, F.; Ghittorelli, M.; Lee, J.; Gelinck, G.; Kim, J.-J.

2016-01-01

Using a concept of asymmetric side gate and main gate, it is shown that it is possible to realize unipolar transport (both p-type and n-type) in a thin-film transistor with a high-performance ambipolar polymer semiconductor. In a complementary inverter, this results in higher noise margin and DC

Efficiency analysis on a two-level three-phase quasi-soft-switching inverter

DEFF Research Database (Denmark)

Geng, Pan; Wu, Weimin; Huang, Min

2013-01-01

When designing an inverter, an engineer often needs to select and predict the efficiency beforehand. For the standard inverters, plenty of researches are analyzing the power losses and also many software tools are being used for efficiency calculation. In this paper, the efficiency calculation...... for non-conventional inverters with special shoot-through state is introduced and illustrated through the analysis on a special two-level three-phase quasi-soft-switching inverter. Efficiency comparison between the classical two-stage two-level three-phase inverter and the two-level three-phase quasi......-soft-switching inverter is carried out. A 10 kW/380 V prototype is constructed to verify the analysis. The experimental results show that the efficiency of the new inverter is higher than that of the traditional two-stage two- level three-phase inverter....

48 CFR 1536.201 - Evaluation of contracting performance.

Science.gov (United States)

2010-10-01

... performance. 1536.201 Section 1536.201 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality...

Effects of cross talk on dual energy SPECT imaging between [sup 123]I-BMIPP and [sup 201]Tl

Energy Technology Data Exchange (ETDEWEB)

Morita, Masato; Narita, Hitoshi; Yamamoto, Juro; Fukutake, Naoshige; Ohyanagi, Mitsumasa; Iwasaki, Tadaaki; Fukuchi, Minoru (Hyogo College of Medicine, Nishinomiya (Japan))

1994-01-01

The study was undertaken to determine how much cross talk influences the visual assessment of dual energy single photon emission computed tomographic (SPECT) images with iodine 123 beta-methyl-p-iodophenylpentadecanoic acid (I-123 BMIPP) and thallium-201 in 15 patients with acute myocardial infarction. After single SPECT with I-123 BMIPP was undertaken, simultaneous dual SPECT with I-123 BMIPP and Tl-201 were undertaken in all patients. Three patients also underwent single SPECT with Tl-201. I-123 BMIPP and Tl-201 uptake was graded in four-score for the comparison between single and dual SPECT images. There was good correlation between dual energy SPECT and both single I-123 BMIPP SPECT (pS=0.97) and single Tl-201 SPECT (pS=0.59). Uptake scores were increased on dual energy SPECT, compared with single I-123 SPECT (8 out of 132 segments) and single Tl-201 SPECT (12 out of 36 segments). Overall, there was a comparatively well correlation between single SEPCT with either I-123 BMIPP or Tl-201 and dual energy SPECT images. However, one tracer uptake sometimes increased in the other tracer defect areas. This was noticeable when I-123 BMIPP exerted an effect on Tl-201. (N.K.).

Modeling Single-Phase PV HB-ZVR Inverter Connected to Grid

DEFF Research Database (Denmark)

Guo, Yougui; Zeng, Ping; Zhu, Jieqiong

2011-01-01

PLECS is used to model the PV H-bridge zero voltage rectifier (HB-ZVR) inverter connected to grid and good results are obtained. First, several common topologies of PV inverters are introduced. Then the unipolar PWM control strategy is described for PV HB-ZVR inverter. Third, PLECS is briefly...... introduced. Fourth, the modeling of PV HB-ZVR inverter is presented with PLECS. Finally, a series of simulations are carried out. The simulation results tell us PLECS is very powerful tool to real power circuits and it is very easy to simulate LCL filter. They have also verified that the unipolar PWM control...... strategy is feasible to control the PV HB-ZVR inverter....

Tumor grade-related thallium-201 uptake in chondrosarcomas

International Nuclear Information System (INIS)

Kaya, G.C.; Demir, Y.; Ozkal, S.

2010-01-01

Diagnosis of low-grade chondrosarcoma, especially discrimination between enchondroma and low-grade chondrosarcoma, may be difficult pathologically. The aim of this study was to evaluate the value of thallium-201 (Tl-201) scintigraphy in the diagnosis of chondrosarcoma and to investigate whether there was a correlation between Tl-201 uptake and tumor grade. We retrospectively evaluated 121 patients with pathologically proven bone and soft tissue tumors diagnosed between the years 1999 and 2007. All patients were followed by the Bone and Soft Tissue Tumor Working Group in our hospital. Twenty-three patients, mean age 44±15 (range 17-72) years, with a diagnosis of cartilaginous tumors were included. Increased Tl-201 uptake at the lesion sites greater than background was evaluated as malignant tumor. For the pathologic classification, a grading system (grade 1-3) based on the histopathologic findings was used. Pearson correlation coefficient was used to determine whether there was any correlation between Tl-201 uptake and tumor grade in chondrosarcoma. There were 7 enchondromas and 16 chondrosarcomas. Four of 16 patients with chondrosarcoma had lesions pathologically classified as grade 3, 5 as grade 2, and 7 had grade 1 chondrosarcoma. Increased Tl-201 uptake was observed in all patients with grade 3 chondrosarcoma and 2 patients with grade 2 chondrosarcoma. Of 10 patients with chondrosarcoma, 3 grade 2 chondrosarcomas and 7 grade 1 chondrosarcomas, there was no Tl-201 uptake in the tumor region. A significant correlation was found between Tl-201 uptake and tumor grade in chondrosarcoma (p=0.002, r=0.71). Only a few reports in literature have demonstrated false negative results in low-grade chondrosarcoma. Tl-201 uptake was related to tumor grade in chondrosarcoma. If there is a possibility of chondrosarcoma, Tl-201 scintigraphy should be reported with caution. (author)

27-Level DC–AC inverter with single energy source

International Nuclear Information System (INIS)

Tsang, K.M.; Chan, W.L.

2012-01-01

Highlights: ► This paper reports a novel 27-level DC–AC inverter using only single renewable energy source. ► The efficiency of the inverter is very high. The output waveform is almost sinusoidal. ► The cost is low as the number of power switches required is only 12. - Abstract: A novel design of multilevel DC–AC inverter using only single renewable energy source is presented in this paper. The proposed approach enables multilevel output to be realised by a few cascaded H-bridges and a single energy source. As an illustration, a 27-level inverter has been implemented based on three cascaded H-bridges with a single energy source and two capacitors. Using the proposed novel switching strategy, 27 levels can be realized and the two virtual energy sources can be well regulated. Experimental results are included to demonstrate the effectiveness of the proposed inverter.

Novel five-state latch using double-peak negative differential resistance and standard ternary inverter

Science.gov (United States)

Shin, Sunhae; Rok Kim, Kyung

2016-04-01

We propose complement double-peak negative differential resistance (NDR) devices with ultrahigh peak-to-valley current ratio (PVCR) over 106 by combining tunnel diode with conventional CMOS and its compact five-state latch circuit by introducing standard ternary inverter (STI). At the “high”-state of STI, n-type NDR device (tunnel diode with nMOS) has 1st NDR characteristics with 1st peak and valley by band-to-band tunneling (BTBT) and trap-assisted tunneling (TAT), whereas p-type NDR device (tunnel diode with pMOS) has second NDR characteristics from the suppression of diode current by off-state MOSFET. The “intermediate”-state of STI permits double-peak NDR device to operate five-state latch with only four transistors, which has 33% area reduction compared with that of binary inverter and 57% bit-density reduction compared with binary latch.

24 CFR 201.16 - Default provision.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default provision. 201.16 Section... PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.16 Default provision. The... default by the borrower. ...

Compensation techniques for non-linearities in H-bridge inverters

Directory of Open Access Journals (Sweden)

Daniel Zammit

2016-12-01

Full Text Available This paper presents compensation techniques for component non-linearities in H-bridge inverters as those used in grid-connected photovoltaic (PV inverters. Novel compensation techniques depending on the switching device current were formulated to compensate for the non-linearities in inverter circuits caused by the voltage drops on the switching devices. Both simulation and experimental results will be presented. Testing was carried out on a PV inverter which was designed and constructed for this research. Very satisfactory results were obtained from all the compensation techniques presented, however the exact compensation method was the most effective, providing the highest reduction in harmonics.

LLCL-Filter Based Single-Phase Grid-Tied Aalborg Inverter

DEFF Research Database (Denmark)

Wu, Weimin; Feng, Shuangshuang; Ji, Junhao

2014-01-01

The Aalborg Inverter is a new type of high efficient DC/AC grid-tied inverter, where the input DC voltage can vary in a wide range. Compared with the LCL-filter, the LLCL-filter can save the total inductance for the conventional voltage source inverter. In this paper, an LLCL-filter based Aalborg...... Inverter is proposed and its character is illustrated through the small signal analysis in both “Buck” and “Buck-Boost” mode. From the modeling, it can be seen that the resonant inductor in the capacitor loop has not brought extra control difficulties, whereas more inductance in the power loop can be saved...

Energy-Saving Inverter

Science.gov (United States)

Rippel, W. E.; Edwards, D. B.

1984-01-01

Commutation by field-effect transistor allows more efficient operation. High voltage field-effect transistor (FET) controls silicon controlled rectifiers (SCR's). Circuit requires only one capacitor and one inductor in commutation circuit: simpler, more efficient, and more economical than conventional inverters. Adaptable to dc-to-dc converters.

Blockade of N-methyl-D-aspartate induced convulsions by 1-aminocyclopropanecarboxylates

International Nuclear Information System (INIS)

Skolnick, P.; Marvizon, J.C.G.; Jackson, B.W.; Monn, J.A.; Rice, K.C.; Lewin, A.H.

1989-01-01

1-Aminocyclopropanecarboxylic acid is a potent and selective ligand for the glycine modulatory site on the N-methyl-D-aspartate receptor complex. This compound blocks the convulsions and deaths produced by N-methyl-D-aspartate in a dose dependent fashion. In contrast, 1-aminocyclopropanecarboxylic acid does not protect mice against convulsions induced by pentylenetetrazole, strychnine, bicuculline, or maximal electroshock, and does not impair motor performance on either a rotarod or horizontal wire at doses of up to 2 g/kg. The methyl- and ethyl- esters of 1-aminocyclopropanecarboxylic acid are 5- and 2.3-fold more potent, respectively, than the parent compound in blocking the convulsant and lethal effects of N-methyl-D-aspartate. However, these esters are several orders of magnitude less potent than 1-aminocyclopropanecarboxylic acid as inhibitors of strychnine-insensitive [ 3 H]glycine binding, indicating that conversion to the parent compound may be required to elicit an anticonvulsant action

Finishing report for the 'SolcelleInverter' project

Energy Technology Data Exchange (ETDEWEB)

Boekhoej Kjaer, S.

2005-03-01

The main objective for this research project was to develop an inverter for the AC module, where one PV module is equipped with its own dedicated inverter, and connected to the grid. A topology, among many different candidates, has been selected, based on analysis's. The inverter has been optimized in respect to cost, reliability, and efficiency, and a prototype has been build. (au)

19 CFR 201.149 - Program accessibility: Discrimination prohibited.

Science.gov (United States)

2010-04-01

.... 201.149 Section 201.149 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.149 Program accessibility: Discrimination... agency's facilities are inaccessible to or unusable by handicapped persons, be denied the benefits of, be...

48 CFR 36.201 - Evaluation of contractor performance.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of contractor performance. 36.201 Section 36.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements...

Evaluation of propagation methods, nitrogen fertilization and phenology in stevia in the Cauca Valley, Colombia Evaluación de métodos de propagación, fertilización nitrogenada y fenología de estevia en condiciones del Valle del Cauca

Directory of Open Access Journals (Sweden)

Bonilla Correa Carmen Rosa

2007-09-01

Full Text Available This research was carried out at the Experimental Center of the National University of Colombia (Palmira in order to know more about the cropping system of Stevia rebaudiana Bertoni. The research consisted of an evaluation of rooting process and growth of cuttings from basal and apical position of the stem. The results were obtained from three root sustrates (coal ship-sand, coal ship-compost and sand-compost and three different nitrogen sources (urea 46%N, compost 1.5% N and chicken manure 1% N. The results showed that the most productive sustrate was coal ship-sand 1:1 volume. The application of the nitrogen sources had no significant differences in accumulation of leaf dry matter. Phenological observation were as follows: emergence: 6 days after sowing (das, vegetative state: 17 das, flowering: 71 das, fructificatión: 115 das, senility: 169 das and shoot: 201 dísEn el Centro Experimental de la Universidad Nacional de Colombia sede Palmira se evaluó el prendimiento de estacas apicales y basales de Stevia rebaudiana en tres sustratos de enraizamiento (carbonilla-arena, carbonilla-compost y arena-compost y tres fuentes de nitrógeno (urea 46%N, compost 1.5%N y gallinaza 1% N. El mejor método de propagación fue la estaca apical en sustrato carbonilla-arena 1:1, volumen; las fuentes de nitrógeno no presentaron diferencias significativas en la acumulación de materia seca de hojas. Se diferenciaron los siguientes periodos fenológicos: Emergencia: 6 días después de la siembra (dís, Estado vegetativo: 17 dias, Floración: 71 dís, Fructificación: 115 dís, Senescencia: 169 dís y Rebrote: 201 dís

Complex analyses of inverted repeats in mitochondrial genomes revealed their importance and variability.

Science.gov (United States)

Cechová, Jana; Lýsek, Jirí; Bartas, Martin; Brázda, Václav

2018-04-01

The NCBI database contains mitochondrial DNA (mtDNA) genomes from numerous species. We investigated the presence and locations of inverted repeat sequences (IRs) in these mtDNA sequences, which are known to be important for regulating nuclear genomes. IRs were identified in mtDNA in all species. IR lengths and frequencies correlate with evolutionary age and the greatest variability was detected in subgroups of plants and fungi and the lowest variability in mammals. IR presence is non-random and evolutionary favoured. The frequency of IRs generally decreased with IR length, but not for IRs 24 or 30 bp long, which are 1.5 times more abundant. IRs are enriched in sequences from the replication origin, followed by D-loop, stem-loop and miscellaneous sequences, pointing to the importance of IRs in regulatory regions of mitochondrial DNA. Data were produced using Palindrome analyser, freely available on the web at http://bioinformatics.ibp.cz. vaclav@ibp.cz. Supplementary data are available at Bioinformatics online.

THE DETERMINATION OF DIFFUSION COEFFICIENT OF INVERT MATERIALS