WorldWideScience

Sample records for cylindrical acs support

  1. Free Vibration of Partially Supported Cylindrical Shells

    Directory of Open Access Journals (Sweden)

    S. Mirza

    1995-01-01

    Full Text Available The effects of detached base length on the natural frequencies and modal shapes of cylindrical shell structures were investigated in this work. Some of the important applications for this type of problem can be found in the cracked fan and rotor blades that can be idealized as partially supported shells with varying unsupported lengths. A finite element model based on small deflection linear theory was developed to obtain numerical solutions for this class of problems. The numerical results were generated for shallow shells and some of the degenerate cases are compared with other results available in the literature. The computations presented here involve a wide range of variables: material properties, aspect ratios, support conditions, and radius to base ratio.

  2. Dynamic stability of simply supported composite cylindrical shells under partial axial loading

    Science.gov (United States)

    Dey, Tanish; Ramachandra, L. S.

    2015-09-01

    The parametric vibration of a simply supported composite circular cylindrical shell under periodic partial edge loadings is discussed in this article. Donnell's nonlinear shallow shell theory considering first order shear deformation theory is used to model the shell. The applied partial edge loading is represented in terms of a Fourier series and stress distributions within the cylindrical shell are determined by prebuckling analysis. The governing equations of the dynamic instability of shells are derived in terms of displacements (u-v-w) and rotations (φx, φθ). Employing the Galerkin and Bolotin methods the dynamic instability regions are computed. Using the expression for the stress function derived in this paper, the pre-buckling stresses in the cylindrical shell due to partial loading can be calculated explicitly. Numerical results are presented to show the influence of radius-to-thickness ratio, different partial edge loading distributions and shear deformation on the dynamic instability regions. The linear and nonlinear responses in the stable and unstable regions are presented to bring out the characteristic features of the dynamic instability regions, such as the existence of beats, its dependence on forcing frequency and effect of nonlinearity on the response. The effect of dynamic load amplitude on the nonlinear response is also studied. It is found that for higher values of dynamic loading, the shell exhibits chaotic behavior.

  3. Vibrations of unmoment non-closed orthotropic cylindrical shell with simple support boundary conditions at three edges

    Directory of Open Access Journals (Sweden)

    Ghulghazaryan G.R.

    2007-06-01

    Full Text Available Vibrations of unmoment non-closed orthotropic cylindrical shell with arbitrary plane directing curve and with simple support boundary conditions at three edges are studied. The dispersion and characteristic equations for finding the values of dimensionless characteristics of eigenfrequency and the coefficient of dumping of the corresponding vibration form are obtained. Calculations were carried out for shells with directing curve in the form of parabola with different values of curvature and different length of generator.

  4. Dynamic Reliability Evaluation of Double-Layer Cylindrical Latticed Shell under Multi-Support Excitations

    Institute of Scientific and Technical Information of China (English)

    柳春光; 李会军

    2010-01-01

    To overcome the excessive computational cost and/or bad accuracy of traditional approaches,the probabilistic density evolution method(PDEM) is introduced.The dynamic reliability of a double-layer cylindrical latticed shell is evaluated by applying PDEM and Monte Carlo Method(MCM) respectively,and four apparent wave velocities(100 m/s,500 m/s,800 m/s and 1 200 m/s) and five thresholds(0.1 m,0.2 m,0.3 m,0.4 m and 0.5 m) are taken into consideration.Only the difference between threshold and maximal deformation...

  5. Nonlinear Vibrations of FGM Cylindrical Panel with Simply Supported Edges in Air Flow

    Directory of Open Access Journals (Sweden)

    Y. X. Hao

    2015-01-01

    Full Text Available Chaotic and periodic motions of an FGM cylindrical panel in hypersonic flow are investigated. The cylindrical panel is also subjected to in-plane external loads and a linear temperature variation in the thickness direction. The temperature dependent material properties of panel which are assumed to be changed through the thickness direction only can be determined by a simple power distribution in terms of the volume fractions. With Hamilton’s principle for an elastic body, a nonlinear dynamical model based on Reddy’s first-order shear deformation shell theory and von Karman type geometric nonlinear relationship is derived in the form of partial equations. A third-order piston theory is adopted to evaluate the hypersonic aerodynamic load. Here, Galerkin’s method is employed to discretize this continuous nonlinear dynamic system to ordinary differential governing equations involving two degrees of freedom. The chaotic and periodic response are studied by the direct numerical simulation method for influences of different Mach number and the value of in-plane load. The bifurcations, Poincare section, waveform, and phase plots are presented.

  6. Grid support of a wind farm with active stall wind turbines and AC grid connection

    DEFF Research Database (Denmark)

    Hansen, Anca Daniela; Sørensen, Poul Ejnar; Iov, F.

    2006-01-01

    One of the main concerns in the grid integration of large wind farms is their ability to behave as active controllable components in the power system. This article presents the design of a new integrated power control system for a wind farm made up exclusively of active stall wind turbines with AC...... grid connection. The designed control system has the task of enabling such a wind farm to provide the best grid support. It is based on two control levels: a supervisory control level, which controls the power production of the whole farm by sending out reference signals to each individual wind turbine......, and a local control level, which ensures that the reference power signals at the wind turbine level are reached. The ability of active stall wind farms with AC grid connection to control the power production to the reference power ordered by the operators is assessed and discussed by means of simulations....

  7. Thermal analysis of the influence of the support in the superficial treatment by plasma of cylindrical samples

    Energy Technology Data Exchange (ETDEWEB)

    Belisio, A.S.; Lima, J.A.; Alves Junior, C. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Programa de Pos-Graduacao em Engenharia Mecanica]. E-mails: abelisio@yahoo.com.br; jalima@dem.ufrn.br; alvesjr@dem.ufrn.br

    2008-07-01

    Different of the conventional processes of heating, that is, transport, convection, and radiation, heat transfer in heating process by plasma also occur also by collisions of particles, in other words, through the transfer heat motion ions for the surface of the sample, the kinetic energy, and potential those particles, as well as the enthalpy of the chemical reactions involved in the surface. In thermal plasmas, that transfer can to be simplified initially through general energy balance between plasma and samples. However, existent models of temperature distribution are in its majority unidimensional and it do not analyze, mainly, support influence on sample in the heating process by r plasma. In that way, with the mark of analyzing the temperature distribution in the samples submitted to polarization voltage of 706 V, 744 V and 790 V, as well as process heating support influence analysis those samples, the present work developed a code computational for a transient (2D-t) two-dimensional model, destined to the simulation of the heat transfer during heating phases and cooling in superficial process of treatment by plasma in cylindrical samples of copper, being considered the configuration of hollow cathode and the presence of a support. The model computational serves as a tool in the predict of the final properties of treated samples, well as in the specification of the parameters of the heating processes by plasma. In the developed model was considered that the physical samples properties were variable, functions of the temperature field. The results obtained through simulation are leaning and validated in experimental and theoretical data available in the literature, as well as, in information of tests accomplished in Lab Plasma/ UFRN. (author)

  8. Are BVS suitable for ACS patients? Support from a large single center real live registry

    NARCIS (Netherlands)

    C. Felix (Cordula); Y. Onuma (Yoshinobu); J.M. Fam (Jiang Ming); R. Diletti (Roberto); Y. Ishibashi (Yuki); A. Karanasos (Antonios); B. Everaert (Bert); N.M. van Mieghem (Nicolas); J. Daemen (Joost); P.P.T. de Jaegere (Peter); F. Zijlstra (Felix); E.S. Regar (Eveline); R.J.M. van Geuns (Robert Jan)

    2016-01-01

    textabstractObjectives To investigate one-year outcomes after implantation of a bioresorbable vascular scaffold (BVS) in patients presenting with acute coronary syndrome (ACS) compared to stable angina patients. Background Robust data on the outcome of BVS in the setting of ACS is still scarce.

  9. Hispanic residential ethnic density and depression in post-ACS patients: Re-thinking the role of social support

    Science.gov (United States)

    Denton, Ellen-ge D.; Shaffer, Jonathan A.; Alcantara, Carmela; Clemow, Lynn; Brondolo, Elizabeth

    2014-01-01

    Objective The ethnic density hypothesis suggests that ethnic density confers greater social support and consequently protects against depressive symptoms in ethnic minority individuals. However, the potential benefits of ethnic density have not been examined in individuals who are facing a specific and salient life stressor. We examined the degree to which the effects of Hispanic ethnic density on depressive symptoms are explained by socioeconomic resources and social support. Methods Patients with acute coronary syndrome (ACS, N = 472) completed the Beck Depression Inventory (BDI) and measures of demographics, ACS clinical factors and disease severity, and perceived social support. Neighborhood characteristics, including median income, number of single-parent households, and Hispanic ethnic density, were extracted from the American Community Survey Census (2005 – 2009) for each patient using his/her geocoded address. Results In a linear regression analysis adjusted for demographic and clinical factors, Hispanic ethnic density was positively associated with depressive symptoms (β = .09, SE = .04, p = .03). However, Hispanic density was no longer a significant predictor of depressive symptoms when measures of neighborhood socioeconomic disadvantage were controlled. In addition, the effects of Hispanic density were not the same for all groups. The relationship of Hispanic density on depressive symptoms was moderated by nativity status. Among US-born patients with ACS, there was a significant positive relationship between Hispanic density and depressive symptoms, and social support significantly mediated this effect. There was no observed effect of Hispanic density to depressive symptoms for foreign-born ACS patients. Discussion Although previous research suggests that ethnic density may be protective against depression, our data suggest that among patients with ACS, living in a community with a high concentration of Hispanic individuals is associated with

  10. Confirmation of hydroxyl radicals ({sup •} OH) generated in the presence of TiO{sub 2} supported on AC under microwave irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhaohong, E-mail: lnuhjhx@163.com [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Ning [Experiment Center of Environmental Monitoring of Liaoning Province, Shenyang 110161 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

    2014-08-15

    Graphical abstract: - Highlights: • Generation of {sup •} OH in MW integrated with loaded TiO{sub 2}/AC system was confirmed. • Confirmation of {sup •} OH was conducted using radical scavenger such as BHT, MT and VC. • More {sup •} OH was formed using anatase TiO{sub 2}/AC than rutile TiO{sub 2}/AC under MW irradiation. • Effect of mass ratio, irradiation time, catalyst dose and DPCI on {sup •} OH was studied. - Abstract: In order to study the degradation mechanism of technology of microwave (MW) combined with TiO{sub 2} supported on activated carbon (TiO{sub 2}/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ({sup •} OH). In addition, the influence of some parameters such as TiO{sub 2} mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of {sup •} OH were examined. The results showed that the {sup •} OH could be generated under MW combined with loaded TiO{sub 2}/AC. Also, anatase TiO{sub 2}/AC can generate more {sup •} OH radicals than rutile TiO{sub 2}/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO{sub 2}/AC coupled with MW technology.

  11. Cup Cylindrical Waveguide Antenna

    Science.gov (United States)

    Acosta, Roberto J.; Darby, William G.; Kory, Carol L.; Lambert, Kevin M.; Breen, Daniel P.

    2008-01-01

    The cup cylindrical waveguide antenna (CCWA) is a short backfire microwave antenna capable of simultaneously supporting the transmission or reception of two distinct signals having opposite circular polarizations. Short backfire antennas are widely used in mobile/satellite communications, tracking, telemetry, and wireless local area networks because of their compactness and excellent radiation characteristics. A typical prior short backfire antenna contains a half-wavelength dipole excitation element for linear polarization or crossed half-wavelength dipole elements for circular polarization. In order to achieve simultaneous dual circular polarization, it would be necessary to integrate, into the antenna feed structure, a network of hybrid components, which would introduce significant losses. The CCWA embodies an alternate approach that entails relatively low losses and affords the additional advantage of compactness. The CCWA includes a circular cylindrical cup, a circular disk subreflector, and a circular waveguide that serves as the excitation element. The components that make it possible to obtain simultaneous dual circular polarization are integrated into the circular waveguide. These components are a sixpost polarizer and an orthomode transducer (OMT) with two orthogonal coaxial ports. The overall length of the OMT and polarizer (for the nominal middle design frequency of 2.25 GHz) is about 11 in. (approximately equal to 28 cm), whereas the length of a commercially available OMT and polarizer for the same frequency is about 32 in. (approximately equal to 81 cm).

  12. Confirmation of hydroxyl radicals (•OH) generated in the presence of TiO2 supported on AC under microwave irradiation.

    Science.gov (United States)

    Zhang, Zhaohong; Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun; Yu, Ning; Dionysiou, Dionysios D

    2014-08-15

    In order to study the degradation mechanism of technology of microwave (MW) combined with TiO2 supported on activated carbon (TiO2/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ((•)OH). In addition, the influence of some parameters such as TiO2 mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of (•)OH were examined. The results showed that the (•)OH could be generated under MW combined with loaded TiO2/AC. Also, anatase TiO2/AC can generate more (•)OH radicals than rutile TiO2/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO2/AC coupled with MW technology.

  13. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  14. Microfabricated cylindrical ion trap

    Science.gov (United States)

    Blain, Matthew G.

    2005-03-22

    A microscale cylindrical ion trap, having an inner radius of order one micron, can be fabricated using surface micromachining techniques and materials known to the integrated circuits manufacturing and microelectromechanical systems industries. Micromachining methods enable batch fabrication, reduced manufacturing costs, dimensional and positional precision, and monolithic integration of massive arrays of ion traps with microscale ion generation and detection devices. Massive arraying enables the microscale cylindrical ion trap to retain the resolution, sensitivity, and mass range advantages necessary for high chemical selectivity. The microscale CIT has a reduced ion mean free path, allowing operation at higher pressures with less expensive and less bulky vacuum pumping system, and with lower battery power than conventional- and miniature-sized ion traps. The reduced electrode voltage enables integration of the microscale cylindrical ion trap with on-chip integrated circuit-based rf operation and detection electronics (i.e., cell phone electronics). Therefore, the full performance advantages of microscale cylindrical ion traps can be realized in truly field portable, handheld microanalysis systems.

  15. Cylindrically Polarized Nondiffracting Optical Pulses

    CERN Document Server

    Ornigotti, Marco; Szameit, Alexander

    2016-01-01

    We extend the concept of radially and azimuthally polarized optical beams to the polychromatic domain by introducing cylindrically polarized nondiffracting optical pulses. In particular, we discuss in detail the case of cylindrically polarized X-waves, both in the paraxial and nonparaxial regime. The explicit expressions for the electric and magnetic fields of cylindrically polarized X-waves is also reported.

  16. Cylindrical geometry hall thruster

    Science.gov (United States)

    Raitses, Yevgeny; Fisch, Nathaniel J.

    2002-01-01

    An apparatus and method for thrusting plasma, utilizing a Hall thruster with a cylindrical geometry, wherein ions are accelerated in substantially the axial direction. The apparatus is suitable for operation at low power. It employs small size thruster components, including a ceramic channel, with the center pole piece of the conventional annular design thruster eliminated or greatly reduced. Efficient operation is accomplished through magnetic fields with a substantial radial component. The propellant gas is ionized at an optimal location in the thruster. A further improvement is accomplished by segmented electrodes, which produce localized voltage drops within the thruster at optimally prescribed locations. The apparatus differs from a conventional Hall thruster, which has an annular geometry, not well suited to scaling to small size, because the small size for an annular design has a great deal of surface area relative to the volume.

  17. Code Verification of Magnetized Cylindrical Liner Implosions

    Science.gov (United States)

    Hess, Mark; Weis, Matthew; Martin, Matthew; Sefkow, Adam; Nakhleh, Charles; Lau, Y. Y.

    2012-10-01

    We investigate the physics of magnetized cylindrical liner implosions with existing MHD codes to verify code accuracy, as well as to understand parametric behavior on figures-of-merit, e.g. radial liner velocity, for designing experiments. In our problem, we assume that there exists a 1-D metallic cylindrical liner with an initial axial magnetic seed field imposed in the system. The liner radially implodes due to a specified drive current while the effects of liner pressure and magnetic seed field compression oppose the implosion. This problem is of importance for future magnetized liner fusion experiments, e.g. MagLIF [1].[4pt]Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. [4pt] [1] S.A. Slutz et al, Phys. Plasmas 17, 056303 (2010).

  18. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  19. Cylindrically symmetric dust spacetime

    CERN Document Server

    Senovilla, J M M; Senovilla, Jose M. M.; Vera, Raul

    2000-01-01

    We present an explicit exact solution of Einstein's equations for an inhomogeneous dust universe with cylindrical symmetry. The spacetime is extremely simple but nonetheless it has new surprising features. The universe is ``closed'' in the sense that the dust expands from a big-bang singularity but recollapses to a big-crunch singularity. In fact, both singularities are connected so that the whole spacetime is ``enclosed'' within a single singularity of general character. The big-bang is not simultaneous for the dust, and in fact the age of the universe as measured by the dust particles depends on the spatial position, an effect due to the inhomogeneity, and their total lifetime has no non-zero lower limit. Part of the big-crunch singularity is naked. The metric depends on a parameter and contains flat spacetime as a non-singular particular case. For appropriate values of the parameter the spacetime is a small perturbation of Minkowski spacetime. This seems to indicate that flat spacetime may be unstable agai...

  20. Cylindrically symmetric dust spacetime

    Science.gov (United States)

    Senovilla, José M. M.

    2000-07-01

    We present an explicit exact solution of Einstein's equations for an inhomogeneous dust universe with cylindrical symmetry. The spacetime is extremely simple but nonetheless it has surprising new features. The universe is `closed' in the sense that the dust expands from a big-bang singularity but recollapses to a big-crunch singularity. In fact, both singularities are connected so that the whole spacetime is `enclosed' within a single singularity of general character. The big-bang is not simultaneous for the dust, and in fact the age of the universe as measured by the dust particles depends on the spatial position, an effect due to the inhomogeneity, and their total lifetime has no non-zero lower limit. Part of the big-crunch singularity is naked. The metric depends on a parameter and contains flat spacetime as a non-singular particular case. For appropriate values of the parameter the spacetime is a small perturbation of Minkowski spacetime. This seems to indicate that flat spacetime may be unstable against some global non-vacuum perturbations.

  1. 高压交流电机定子绕组端部固定结构研究%Study on the End Winding Support for Stator of HV AC Motor

    Institute of Scientific and Technical Information of China (English)

    宁苏辉; 梁锐; 祁世发

    2001-01-01

    高压交流电机定子绕组端部固定存在薄弱环节,会引起绕组端部电击穿。通过研究,提出了新型高压电机定子绕组端部固定结构。%The stator end-winding support of HV AC motor exists weakness leading to electric break-down. Accordingly, this paper put forwards a new type of support system.

  2. Telescoping cylindrical piezoelectric fiber composite actuator assemblies

    Science.gov (United States)

    Allison, Sidney G. (Inventor); Shams, Qamar A. (Inventor); Fox, Robert L. (Inventor); Fox, legal representative, Christopher L. (Inventor); Fox Chattin, legal representative, Melanie L. (Inventor)

    2010-01-01

    A telescoping actuator assembly includes a plurality of cylindrical actuators in a concentric arrangement. Each cylindrical actuator is at least one piezoelectric fiber composite actuator having a plurality of piezoelectric fibers extending parallel to one another and to the concentric arrangement's longitudinal axis. Each cylindrical actuator is coupled to concentrically-adjacent ones of the cylindrical actuators such that the plurality of cylindrical actuators can experience telescopic movement. An electrical energy source coupled to the cylindrical actuators applies actuation energy thereto to generate the telescopic movement.

  3. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  4. Dismantling OPAL's cylindrical magnet core

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    Lifting a handling device for dismounting the pressure bells, which are inside the cylindrical magnet coil on the central section of OPAL, on the right part of the photo. OPAL was a detector on the LEP accelerator, which ran from 1989 to 2000.

  5. Optics Demonstrations Using Cylindrical Lenses

    Science.gov (United States)

    Ivanov, Dragia; Nikolov, Stefan

    2015-01-01

    In this paper we consider the main properties of cylindrical lenses and propose several demonstrational experiments that can be performed with them. Specifically we use simple glasses full of water to demonstrate some basic geometrical optics principles and phenomena. We also present some less standard experiments that can be performed with such…

  6. Filling of charged cylindrical capillaries

    NARCIS (Netherlands)

    Das, Siddhartha; Chanda, Sourayon; Eijkel, J.C.T.; Tas, N.R.; Chakraborty, Suman; Mitra, Sushanta K.

    2014-01-01

    We provide an analytical model to describe the filling dynamics of horizontal cylindrical capillaries having charged walls. The presence of surface charge leads to two distinct effects: It leads to a retarding electrical force on the liquid column and also causes a reduced viscous drag force because

  7. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  8. Improved cylindrical mirror energy analyzer

    Science.gov (United States)

    Baranova, L. A.

    2017-03-01

    A study has been carried out of the electron-optical properties of improved design of the cylindrical mirror energy analyzer. Both external and internal electrodes of the analyzer are divided into three isolated parts, whereby the potentials on the individual parts can be regulated independently from each other. In symmetric operating mode at identical potentials on the side parts of the electrodes, a significant increase has been obtained in resolving power and light-gathering power of the analyzer compared to the standard design of the cylindrical mirror. In asymmetric operating mode, which is implemented in a linear potential distribution on the external electrode, the conditions have been found under which the linear dispersion of the analyzer increases several times.

  9. Cylindrical solutions in mimetic gravity

    Energy Technology Data Exchange (ETDEWEB)

    Momeni, Davood; Myrzakulov, Kairat; Myrzakulov, Ratbay [Eurasian National University, Eurasian International Center for Theoretical Physics and Department of General and Theoretical Physics, Astana (Kazakhstan); Raza, Muhammad [COMSATS Institute of Information Technology, Department of Mathematics, Sahiwal (Pakistan)

    2016-06-15

    This paper is devoted to investigate cylindrical solutions in mimetic gravity. The explicit forms of the metric of this theory, namely mimetic-Kasner (say) have been obtained. In this study we have noticed that the Kasner's family of exact solutions needs to be reconsidered under this type of modified gravity. A no-go theorem is proposed for the exact solutions in the presence of a cosmological constant. (orig.)

  10. Cylindrical Collapse and Gravitational Waves

    CERN Document Server

    Herrera, L

    2005-01-01

    We study the matching conditions for a collapsing anisotropic cylindrical perfect fluid, and we show that its radial pressure is non zero on the surface of the cylinder and proportional to the time dependent part of the field produced by the collapsing fluid. This result resembles the one that arises for the radiation - though non-gravitational - in the spherically symmetric collapsing dissipative fluid, in the diffusion approximation.

  11. Cylindrical Piezoelectric Fiber Composite Actuators

    Science.gov (United States)

    Allison, Sidney G.; Shams, Qamar A.; Fox, Robert L.

    2008-01-01

    The use of piezoelectric devices has become widespread since Pierre and Jacques Curie discovered the piezoelectric effect in 1880. Examples of current applications of piezoelectric devices include ultrasonic transducers, micro-positioning devices, buzzers, strain sensors, and clocks. The invention of such lightweight, relatively inexpensive piezoceramic-fiber-composite actuators as macro fiber composite (MFC) actuators has made it possible to obtain strains and displacements greater than those that could be generated by prior actuators based on monolithic piezoceramic sheet materials. MFC actuators are flat, flexible actuators designed for bonding to structures to apply or detect strains. Bonding multiple layers of MFC actuators together could increase force capability, but not strain or displacement capability. Cylindrical piezoelectric fiber composite (CPFC) actuators have been invented as alternatives to MFC actuators for applications in which greater forces and/or strains or displacements may be required. In essence, a CPFC actuator is an MFC or other piezoceramic fiber composite actuator fabricated in a cylindrical instead of its conventional flat shape. Cylindrical is used here in the general sense, encompassing shapes that can have circular, elliptical, rectangular or other cross-sectional shapes in the planes perpendicular to their longitudinal axes.

  12. Cylindrical wormholes with positive cosmological constant

    CERN Document Server

    Richarte, Mart'\\in G

    2013-01-01

    We construct cylindrical, traversable wormholes with finite radii by taking into account the cut-and-paste procedure for the case of cosmic string manifolds with a positive cosmological constant. Under reasonable assumptions about the equation of state of the matter located at the shell, we find that the wormhole throat undergoes a monotonous evolution provided it moves at a constant velocity. In order to explore the dynamical nonlinear behaviour of the wormhole throat, we consider that the matter at the shell is supported by anisotropic Chaplygin gas, anti-Chaplygin gas, or a mixed of Chaplygin and anti-Chaplygin gases implying that wormholes could suffer an accelerated expansion or contraction but the oscillatory behavior seems to be forbidden.

  13. Cylindrical wormholes with positive cosmological constant

    Science.gov (United States)

    Richarte, Martín G.

    2013-07-01

    We construct cylindrical, traversable wormholes with finite radii by taking into account the cut-and-paste procedure for the case of cosmic string manifolds with a positive cosmological constant. Under reasonable assumptions about the equation of state of the matter located at the shell, we find that the wormhole throat undergoes a monotonous evolution provided it moves at a constant velocity. In order to explore the dynamical nonlinear behavior of the wormhole throat, we consider that the matter of the shell is supported by anisotropic Chaplygin gas, anti-Chaplygin gas, or a mixture of Chaplygin and anti-Chaplygin gases, implying that wormholes could suffer an accelerated expansion or contraction, but that oscillatory behavior seems to be forbidden.

  14. Study of Cylindrical Honeycomb Solar Collector

    Directory of Open Access Journals (Sweden)

    Atish Mozumder

    2014-01-01

    Full Text Available We present the results of our investigation on cylindrical honeycomb solar collector. The honeycomb has been fabricated with transparent cellulose triacetate polymer sheets. Insulation characteristics of the honeycomb were studied by varying the separation between the honeycomb and the absorber plate. The optimal value of the separation was found to be 3.3 mm for which the heat transfer coefficient is 3.06 W m−2 K−1. This supports result of previous similar experiments. Further we test the honeycomb through a field experiment conducted in Delhi (28.6°N, 77°E and found that when the incident angle of the solar radiation is within 20° then the performance of the system with the honeycomb is better than the one without the honeycomb.

  15. Analysis on Forced Vibration of Thin-Wall Cylindrical Shell with Nonlinear Boundary Condition

    Directory of Open Access Journals (Sweden)

    Qiansheng Tang

    2016-01-01

    Full Text Available Forced vibration of thin-wall cylindrical shell under nonlinear boundary condition was discussed in this paper. The nonlinear boundary was modeled as supported clearance in one end of shell and the restraint was assumed as linearly elastic in the radial direction. Based on Sanders’ shell theory, Lagrange equation was utilized to derive the nonlinear governing equations of cylindrical shell. The displacements in three directions were represented by beam functions and trigonometric functions. In the study of nonlinear dynamic responses of thin-wall cylindrical shell with supported clearance under external loads, the Newmark method is used to obtain time history, frequency spectrum plot, phase portraits, Poincare section, bifurcation diagrams, and three-dimensional spectrum plot with different parameters. The effects of external loads, supported clearance, and support stiffness on nonlinear dynamics behaviors of cylindrical shell with nonlinear boundary condition were discussed.

  16. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  17. Buckling Characteristics of Cylindrical Pipes

    Institute of Scientific and Technical Information of China (English)

    Toshiaki Sakurai

    2015-01-01

    This paper describes the buckling pattern of the body frame by energy absorbed efficiency of crashworthiness related toresearch of the buckling characteristics of aluminum cylindrical pipes with various diameters formed mechanical tools. Experimentswere performed by the quasi-static test without lubrication between specimen and equipment. According to the change in the radiusversus thickness of the specimen, the buckling phenomena are transformed from folding to bellows and the rate of energy absorptionis understood. In crashworthiness, frames are characterized by the folding among three patterns from the absorbed energy efficiencypoint of view and weight reduction. With the development of new types of transport such as electric vehicles, innovated bodystructure should be designed.

  18. Calculation of AC loss in two-layer superconducting cable with equal currents in the layers

    Science.gov (United States)

    Erdogan, Muzaffer

    2016-12-01

    A new method for calculating AC loss of two-layer SC power transmission cables using the commercial software Comsol Multiphysics, relying on the approach of the equal partition of current between the layers is proposed. Applying the method to calculate the AC-loss in a cable composed of two coaxial cylindrical SC tubes, the results are in good agreement with the analytical ones of duoblock model. Applying the method to calculate the AC-losses of a cable composed of a cylindrical copper former, surrounded by two coaxial cylindrical layers of superconducting tapes embedded in an insulating medium with tape-on-tape and tape-on-gap configurations are compared. A good agreement between the duoblock model and the numerical results for the tape-on-gap cable is observed.

  19. Improvement of superconducting cylindrical linear induction motor; Chodendo entokeitan ichiji rinia yudo mota no tokusei kaizen

    Energy Technology Data Exchange (ETDEWEB)

    Kikuma, T.; Tomita, M.; Ishiyama, A. [Waseda Univ., Tokyo (Japan)

    1999-11-10

    For the purpose of we examining the effect of characteristics and ac loss under real machine operating environment of the alternating current superconductivity winding for a realization of the superconductive AC machine vessel, cylindrical shortness first linear guiding motor which used NbTi/CuNi superconducting cable for the primary winding was produced experimentally. The coil number was increased from 6 in 14 this time, and the optimization of the primary current was done, and the improvement on characteristics was attempted. Here, starting torque characteristics, quenching detection protection control circuit are reported. (NEDO)

  20. Evaluation of transmitting performance of cylindrical polycapillary

    Science.gov (United States)

    Xiaoyan, Lin; Yude, Li; Guotai, Tan; Tianxi, Sun

    2007-03-01

    Based on a detailed ray-tracing code for capillary optics, a MATLAB program for the simulation of X-ray transmission in a cylindrical polycapillary is described. The simulated and experimental results for the spatial distributions and power density gain of the X-rays in the beam guided through a cylindrical polycapillary are in good agreement, and the results show that the spatial distribution of the X-rays in the beam guided through a cylindrical polycapillary is uneven.

  1. Ingestion of cylindrical batteries and its management.

    Science.gov (United States)

    Tien, Tony; Tanwar, Sudeep

    2017-01-17

    In contrast to the ingestion of coin batteries, the ingestion of cylindrical batteries is an uncommon medical presentation. Owing to their larger size, cylindrical battery ingestion can lead to serious complications including intestinal haemorrhage, bowel obstruction, bowel perforation, peritonitis and even death. We discuss the case of a 17-year-old girl who presented after swallowing three cylindrical batteries. Her medical history included depression and previous battery ingestion that required surgical removal. During this presentation however, these ingested batteries were removed endoscopically at oesophagogastroduodenoscopy and ileocolonoscopy. The patient was subsequently discharged without complication. This paper discusses the complications and management of cylindrical battery ingestion. 2017 BMJ Publishing Group Ltd.

  2. Support for a special symposium to highlight the research of early career women physical chemists at the 2011 fall ACS nationall meeting, Aug 28-Sept

    Energy Technology Data Exchange (ETDEWEB)

    Geraldine Richmond

    2012-12-19

    The symposium was well attended during the 4-day symposium. The invited speakers were primarily women in early career stage (~4-8 years) with a few senior women and men as invited speakers or session chairs. Included in each day was a Poster Session for graduate students and a lunch in which the turn out was strong and the posters presented encouraged much of dialogue with the invited speakers, guests and others attending the ACS meeting and wanted to discuss the student’s research and meet with the speakers. Most all speakers and participants were very positive about the sessions and expressed that the funding to cover some expenses made it possible for them to attend the conference and the poster session luncheon. There was a total of 51 presenters, below are the speakers and their abstracts, in order presented:

  3. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  4. Turbulence in the cylindrical slab

    Energy Technology Data Exchange (ETDEWEB)

    Gentle, K. W.; Rowan, W. L.; Williams, C. B.; Brookman, M. W. [Institute of Fusion Studies, University of Texas at Austin, Austin, Texas 78712 (United States)

    2014-09-15

    The cylindrical slab was the first and simplest model of intrinsically unstable microturbulence. The Helimak is an experimental realization of this model. Although finite, it is sufficiently large to escape boundary effects, with dimensionless parameters similar to those of a tokamak edge or scrape off layer. The essential drive is interchange-like, a pressure gradient with unfavorable magnetic curvature, leading to a non-linearly saturated state of large-amplitude turbulence, Δn{sub rms}/n ∼ 0.5. The nonlinear processes governing this saturation are unique, unlike any of those posited for the much weaker turbulence typical of confined plasma, e.g., in a tokamak. Neither linear stability theory, quasi-linear theory, zonal flows, nor flow shear stabilization is consistent with the observations. The mechanisms determining the non-linearly saturated state constitute an important challenge to our understanding of strongly nonlinear systems.

  5. The Casimir Torque on a Cylindrical Gear

    CERN Document Server

    Vaidya, Varun

    2013-01-01

    We utilize Effective Field Theory(EFT) techniques to calculate the casimir torque on a cylindrical gear in the presence of a polarizable but neutral object. We present results for the energy and torque as a function of angle for a gear with multiple cogs, as well as for the case of a concentric cylindrical gear.

  6. Casimir torque on a cylindrical gear

    Science.gov (United States)

    Vaidya, Varun

    2014-08-01

    I utilize effective field theory(EFT) techniques to calculate the Casimir torque on a cylindrical gear in the presence of a polarizable but neutral object and present results for the energy and torque as a function of angle for a gear with multiple cogs, as well as for the case of a concentric cylindrical gear.

  7. Synthesis of Phased Cylindrical Arc Antenna Arrays

    Directory of Open Access Journals (Sweden)

    Hussein Rammal

    2009-01-01

    Full Text Available This paper describes a new approach to synthesize cylindrical antenna arrays controlled by the phase excitation, to synthesize directive lobe and multilobe patterns with steered zero. The proposed method is based on iterative minimization of a function that incorporates constraints imposed in each direction. An 8-element cylindrical antenna has been simulated and tested for various types of beam configurations.

  8. On cylindrical near-field scanning techniques

    DEFF Research Database (Denmark)

    Appel-Hansen, Jørgen

    1980-01-01

    The agreement between the coupling equations obtained in the literature by using the reciprocity theorem and the scattering matrix formulation is demonstrated. The field is expanded in cylindrical vector wave functions and the addition theorem for these functions is used. The communication may se...... serve as a tutorial introduction to the cylindrical scanning techniques....

  9. A Potential Model for Cylindrical Pores

    Institute of Scientific and Technical Information of China (English)

    张现仁; 汪文川

    2001-01-01

    An analytical potential for cylindrical pores has been derived by introducing a variational method into the integration for the calculation of the interaction energy between the wall molecules and a test molecule, all of which are represented by Lennard-Jones potential. The model proposed gives good fit to the results from the cylindrical surface model and the pseudoatom model. To test the potential proposed rigorously, we have carried out grand canonical ensemble Monte Carlo(GCMC) simulation of nitrogen in the MCM-41 pore at 77 K, and compared the simulated adsorption isotherm with the experimental data reported in the literature. The simulated isotherm from our model is in almost qualitative agreement with experiment. Consequently, the model proposed provides an explicit and accurate description of cylindrical pores represented by the Lennard-Jones potential. Moreover, the model can be easily applied to a variety of cylindrical pores, ranging from cylindrical surface to finite thickness walls, in both theoretical studies and computer simulations.

  10. Cylindrical air flow reversal barrier

    Energy Technology Data Exchange (ETDEWEB)

    Woznica, C.; Rodziewicz, M.

    1988-06-01

    Describes an innovative design introduced in the ZMP mine in Zory for quick reversal of ventilation air flow. Geologic mining conditions at the 705 m deep horizon, where the barrier was built, are described. According to the design used until now, a reversal system consisted of safety barriers, ventilation air locks, a ventilation bridge and stopping needed in case of a fire when air flow direction must be reversed. Nine air locks and an expensive concrete ventilation bridge were needed and the air locks had to be operated at 8 points of the region to effect reversal. The new design consists of a 2-storey cylindrical barrier which also fulfills the function of a ventilation bridge. It can be manually or remotely operated by a mechanical or pneumatic system. Tests showed that the new barrier permits immediate air flow reversal while retaining 60% of the original air, which is important in the case of fire and methane hazards. It permits improved seam panelling and splitting of pillars and brings an economy of about 40 million zlotys in construction cost. Design and operation of the barrier is illustrated and ventilation air circulation is explained. 7 figs.

  11. Nonlinear dynamical behavior of shallow cylindrical reticulated shells

    Institute of Scientific and Technical Information of China (English)

    WANG Xin-zhi; LIANG Cong-xing; HAN Ming-jun; YEH Kai-yuan; WANG Gang

    2007-01-01

    By using the method of quasi-shells , the nonlinear dynamic equations of three-dimensional single-layer shallow cylindrical reticulated shells with equilateral triangle cell are founded. By using the method of the separating variable function, the transverse displacement of the shallow cylindrical reticulated shells is given under the conditions of two edges simple support. The tensile force is solved out from the compatible equations, a nonlinear dynamic differential equation containing second and third order is derived by using the method of Galerkin. The stability near the equilibrium point is discussed by solving the Floquet exponent and the critical condition is obtained by using Melnikov function. The existence of the chaotic motion of the single-layer shallow cylinmapping.

  12. On the incompressibility of cylindrical origami patterns

    CERN Document Server

    Bös, Friedrich; Gottesman, Omer; Wardetzky, Max

    2015-01-01

    We investigate the axial compressibility of origami cylinders, i.e., cylindrical structures folded from rectangular sheets of paper. We prove, using geometric arguments, that a general fold pattern only allows for a finite number of isometric cylindrical embeddings. Therefore, compressibility of such structures requires stretching the material or deforming the folds. Our result complements the celebrated "bellows theorem" and extends it to the setting of cylindrical origami whose top and bottom are not necessarily rigid, and severely restricts the space of constructions that must be searched when designing new types of origami-based rigid-foldable deployable structures and metamaterials.

  13. Cylindrical-shaped nanotube field effect transistor

    KAUST Repository

    Hussain, Muhammad Mustafa

    2015-12-29

    A cylindrical-shaped nanotube FET may be manufactured on silicon (Si) substrates as a ring etched into a gate stack and filled with semiconductor material. An inner gate electrode couples to a region of the gate stack inside the inner circumference of the ring. An outer gate electrode couples to a region of the gate stack outside the outer circumference of the ring. The multi-gate cylindrical-shaped nanotube FET operates in volume inversion for ring widths below 15 nanometers. The cylindrical-shaped nanotube FET demonstrates better short channel effect (SCE) mitigation and higher performance (I.sub.on/I.sub.off) than conventional transistor devices. The cylindrical-shaped nanotube FET may also be manufactured with higher yields and cheaper costs than conventional transistors.

  14. Multimode interaction in axially excited cylindrical shells

    OpenAIRE

    2014-01-01

    Cylindrical shells exhibit a dense frequency spectrum, especially near the lowest frequency range. In addition, due to the circumferential symmetry, frequencies occur in pairs. So, in the vicinity of the lowest natural frequencies, several equal or nearly equal frequencies may occur, leading to a complex dynamic behavior. So, the aim of the present work is to investigate the dynamic behavior and stability of cylindrical shells under axial forcing with multiple equal or nearly equal natural fr...

  15. View factors of cylindrical spiral surfaces

    Science.gov (United States)

    Lebedev, Vladimir A.; Solovjov, Vladimir P.

    2016-03-01

    Analytical expressions are presented for the view factors (radiative configuration factors) associated with the flat right cylindrical spiral surface. Such cylindrical spiral systems are widely applied as electrical resistance heating elements for lighting devices, electronic radio tubes, high-speed gas flow heaters, and other appliances used for scientific, industrial and domestic purposes. Derivation of the view factors is based on the invariant principles and the results presented in Lebedev (2000, 2003,1988) [1-3].

  16. Cylindrical Helix Spline Approximation of Spatial Curves

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this paper, we present a new method for approximating spatial curves with a G1 cylindrical helix spline within a prescribed tolerance. We deduce the general formulation of a cylindrical helix,which has 11 freedoms. This means that it needs 11 restrictions to determine a cylindrical helix. Given a spatial parametric curve segment, including the start point and the end point of this segment, the tangent and the principal normal of the start point, we can always find a cylindrical segment to interpolate the given direction and position vectors. In order to approximate the known parametric curve within the prescribed tolerance, we adopt the trial method step by step. First, we must ensure the helix segment to interpolate the given two end points and match the principal normal and tangent of the start point, and then, we can keep the deviation between the cylindrical helix segment and the known curve segment within the prescribed tolerance everywhere. After the first segment had been formed, we can construct the next segment. Circularly, we can construct the G1 cylindrical helix spline to approximate the whole spatial parametric curve within the prescribed tolerance. Several examples are also given to show the efficiency of this method.

  17. 交流主动磁轴承电主轴线性二次型最优控制%Linear quadratic optimal control of electric spindle supported by AC active magnetic bearings

    Institute of Scientific and Technical Information of China (English)

    朱熀秋; 黄振跃; 阮颖; 张维煜; 杨益飞

    2012-01-01

    Aiming at an electric spindle supported by AC active magnetic bearings (AMBs), designing controllers of the AMBs using the linear quadratic optimal control theory is proposed. The basic structure and operation principle of an electric spindle supported by AMBs were expounded, and a state equation of the electric spindle supported by the AMBs was set up. Based on introduction of the linear quadratic optimal control theory, centralized and decentralized parameter controllers of the electric spindle supported by the AMBs were designed. The simulation analysis and comparison between the centralized and decentralized parameter controllers was completed by Matlab software. The simulation test results show that the decentralized controllers designed by linear quadratic optimal control theory operate well under the rotor speed of 20 000 r/min of the electric spindle supported by AMBs, and the rotor is suspended steadily. The electric spindle supported by AMBs operates according to the perfect performance indicator, and the control system of the AMBs has good dynamic and static operation performance.%针对交流主动磁轴承电主轴,提出采用线性二次型最优控制理论设计磁轴承控制器.阐述了一种交流主动磁轴承支承的电主轴结构和工作原理,建立了电主轴系统的状态方程.在介绍线性二次型最优控制理论的基础上,采用线性二次型最优控制理论设计了5自由度交流磁轴承电主轴分散和集中参数控制器,并用Matlab软件对集中和分散控制器进行仿真和性能比较.仿真实验结果表明,交流主动磁轴承电主轴转子在20 000 r/min以下运行,采用线性二次型最优控制理论设计的分散控制器,能够实现转子稳定悬浮,交流主动磁轴承电主轴能够按理想的指标运行,并且具有良好的动、静态性能.

  18. Characteristics of Cylindrical Microwave Plasma Source at Low Pressure

    Science.gov (United States)

    Park, Seungil; Youn, S.; Kim, S. B.; Yoo, S. J.

    2016-10-01

    A microwave plasma source with a cylindrical resonance cavity has been proposed to generate the plasma at low pressure. This plasma source consists of magnetron, waveguide, antenna, and cavity. The microwave generating device is a commercial magnetron with 1 kW output power at the frequency of 2.45 GHz. The microwave is transmitted through the rectangular waveguide with the whistle shape, and coupled to the cavity by the slot antenna. The resonant mode of the cylindrical cavity is the TE111 mode. The operating pressure is between 0.1 Torr and 0.3 Torr with the Argon and nitrogen gas. The electron temperature and electron number density of argon plasma were measured with the optical emission spectroscopy measurement. And Ar1s5 metastable density was measured using tunable diode laser absorption spectroscopy (TDLAS). The plasma diagnostic results of a cylindrical microwave plasma source would be described in this study. This work was supported by R&D Program of ``Plasma Advanced Technology for Agriculture and Food (Plasma Farming)'' through the National Fusion Research Institute of Korea (NFRI) funded by the Government funds.

  19. Research on cylindrical indexing cam’s unilateral machining

    Directory of Open Access Journals (Sweden)

    Junhua Chen

    2015-08-01

    Full Text Available The cylindrical cam ridge of the indexer is a spatial curved surface, which is difficult to design and machine. The cylindrical cam has some defects after machining because conventional machining methods have inaccuracies. This article aims at proposing a precise way to machine an indexing cam, using basic motion analysis and analytic geometry approach. Analytical methodology is first applied in the cam’s motion analysis, to obtain an error-free cam follower’s trajectory formula, and then separate the continuous trajectory curve by thousandth resolution, to create a three-dimensional discrete trajectory curve. Planar formulae and spherical formulae can be built on the loci. Based on the machine principle, the cutting cutter’s position and orientation will be taken into account. This article calculates the formula set as presented previously and obtains the ultimate cutter path coordinate value. The new error-free cutter path trajectory is called the unilateral machining trajectory. The earned results will compile into numerical control processing schedule. This processing methodology gives a convenient and precision way to manufacture a cylindrical indexing cam. Experimental results are also well supported.

  20. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  1. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  2. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  3. Independence-friendly cylindric set algebras

    CERN Document Server

    Mann, Allen L

    2007-01-01

    Independence-friendly logic is a conservative extension of first-order logic that has the same expressive power as existential second-order logic. In her Ph.D. thesis, Dechesne introduces a variant of independence-friendly logic called IFG logic. We attempt to algebraize IFG logic in the same way that Boolean algebra is the algebra of propositional logic and cylindric algebra is the algebra of first-order logic. We define independence-friendly cylindric set algebras and prove two main results. First, every independence-friendly cylindric set algebra over a structure has an underlying Kleene algebra. Moreover, the class of such underlying Kleene algebras generates the variety of all Kleene algebras. Hence the equational theory of the class of Kleene algebras that underly an independence-friendly cylindric set algebra is finitely axiomatizable. Second, every one-dimensional independence-friendly cylindric set algebra over a structure has an underlying monadic Kleene algebra. However, the class of such underlyin...

  4. ACTIVE CONTROL OF THE PIEZOELASTIC LAMINATED CYLINDRICAL SHELL'S VIBRATION UNDER HYDROSTATIC PRESSURE

    Institute of Scientific and Technical Information of China (English)

    李红云; 林启荣; 刘正兴; 王超

    2003-01-01

    The control of the piezoelastic laminated cylindrical shell's vibration under hydrostatic pressure was discussed. From Hamilton's principle nonlinear dynamic equations of the piezoelastic laminated cylindrical shell were derived. Based on which, the dynamic equations of a closed piezoelastic cylindrical shell under hydrostatic pressure are obtained. An analytical solution was presented for the case of vibration of a simply supported piezoelastic laminated cylindrical shell under hydrostatic pressure. Using veloctity feedback control, a model for active vibration control of the laminated cylindrical shell with piezoelastic sensor/ actuator is established. Numerical results show that, the static deflection of the cylindrical shell can be changed when voltages with suitable value and direction are applied on the piezoelectric layers. For the dynamic response problem of the system, the larger the gain is, the more the vibration of the system is suppressed in the vicinity of the resonant zone. This presents a potential way to actively reduce the harmful effect of the resonance on the system and verify the feasibility of the active vibration control model.

  5. ICT platform for support AC circuits study

    OpenAIRE

    Moisés Luis San Martín Ojeda; Eduardo Pedro Parra Gonzalo; Moisés Blanco Caballero; Alberto Sánchez Lite; Jose Andrés Serrano Sanz; Maria Isabel Jiménez Gómez; Manuel García García

    2014-01-01

    [EN] The software used for making educational tools allows analyze the engineering phenomena in a more complete and explained way, by means of simulation and experimentation. It is necessary to know the equations about the behaviour of the object under study for the generation of these tools, and to solve them through the right software, obtaining the output values from the input values. With this software it is possible to realize new studies only modifying the parameters of the ...

  6. Vibration of in-vacuo elliptic cylindrical shells

    Science.gov (United States)

    Boisvert, Jeffrey E.; Hayek, Sabih I.

    2003-10-01

    The equations of motion for the vibration of elliptic cylindrical shells of constant thickness were derived using a Galerkin approach. The elastic strain energy density used in this derivation has seven independent kinematic variables: three displacements, two thickness-shear, and two thickness-stretch. The resulting seven coupled algebraic equations are symmetric and positive definite. The shell has a constant thickness, h, finite length, L, and is simply supported at its ends, (z=0,L), where z is the axial coordinate. The elliptic cross-section is defined by the shape parameter, a, and the half-length of the major axis, l. The modal solutions are expanded in a doubly infinite series of comparison functions in terms of circular functions in the angular and axial coordinates. The natural frequencies and the mode shapes were obtained by the Galerkin method. Numerical results were obtained for several h/l and L/l ratios, and various shape parameters, including the limiting case of a simply supported cylindrical shell (a=100). [Work supported by ONR and the Navy/ASEE Summer Faculty Program.

  7. Electronic Quantum Confinement in Cylindrical Potential Well

    CERN Document Server

    Baltenkov, A S

    2016-01-01

    The effects of quantum confinement on the momentum distribution of electrons confined within a cylindrical potential well have been analyzed. The motivation is to understand specific features of the momentum distribution of electrons when the electron behavior is completely controlled by the parameters of a non-isotropic potential cavity. It is shown that studying the solutions of the wave equation for an electron confined in a cylindrical potential well offers the possibility to analyze the confinement behavior of an electron executing one- or two-dimensional motion in the three-dimensional space within the framework of the same mathematical model. Some low-lying electronic states with different symmetries have been considered and the corresponding wave functions have been calculated; the behavior of their nodes and their peak positions with respect to the parameters of the cylindrical well has been analyzed. Additionally, the momentum distributions of electrons in these states have been calculated. The limi...

  8. Cylindrical electrochemical cells with a diaphragm seal

    Energy Technology Data Exchange (ETDEWEB)

    Georgopoulos, P.

    1993-07-13

    A cylindrical electrochemical cell is described comprising an anode, a cathode and electrolyte contained in a cylindrical container, the container having an open end and a closed end; wherein the open end of the container is sealed with a seal assembly comprising: (a) a disc-shaped seal member, made from an electrically insulative material, having an outer edge wall connected via a base to a centrally located cylindrical hub that defines an orifice; which base has a ventable diaphragm portion and a nonventable diaphragm portion that is thicker than the ventable diaphragm portion; and wherein the ventable diaphragm portion joins the hub at an interface and becomes gradually thicker in the direction away from the interface toward the outer edge wall so that the ventable diaphragm portion is thinnest at the interface; and (b) a current collector extending through the orifice defined by the hub into the cell's interior to contact one of the cell's electrodes.

  9. Cylindrical polarization symmetry for nondestructive nanocharacterization

    Science.gov (United States)

    Zhan, Qiwen

    2003-07-01

    Recently there is an increasing interest in laser beams with radial symmetry in polarization. Due to the cylindrical symmetry in polarization, these beams have unique focusing properties, which may find wide applications in a variety of nanometer scale applications, including high-resolution metrology, high-density data storage, and multi-functional optical microtool. In this paper, simple method of generating cylindrically polarized beams is presented and their potential applications to nondestructive nano-characterization are discussed. A high resolution surface plasmon microscope and a surface plasmon enhanced apertureless near-field scanning optical microscope are proposed. An automatic scanning microellipsometer that uses the cylindrical symmetry to enhance the signal-to-noise-ratio in high-spatial-resolution ellipsometric measurement will also be presented.

  10. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  11. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  12. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  13. Research on cylindrical shell vibration reduction systems

    Institute of Scientific and Technical Information of China (English)

    XING Xiao-liang; WANG Min-qing

    2008-01-01

    Longitudinal and horizontal vibration must both be reduced in an effective vibration isolation system. We present a cylindrical shell vibration isolator as a dynamic system composed of four springs and dampers. Vibration is directly produced by the motion of machinery, and more is subsequently generated by harmonic frequencies within their structure. To test the effectiveness of our isolator, we first determined equations for the transmission of vibration from the machine to its cylindrical shell. Damping effects produced by the vibration parameters of our system are then analyzed.

  14. DISPERSION OF CYLINDRICAL PARTICLES IN TURBULENT FLOWS

    Institute of Scientific and Technical Information of China (English)

    GAO Zhen-yu; LIN Jian-zhong

    2004-01-01

    With consideration of the Stokes drag and virtual mass force, the equations for mean and fluctuating velocities in rotation and translation were given for rigid cylindrical particles moving in a turbulent flow. Then the rotational and translational dispersion coefficients of particle were derived. The relationships between the dispersion coefficients and flow length scale as well as particle characteristic parameters were analyzed. The resulting dispersion coefficients were proved to decrease as the particle length increases. The conclusions are helpful for the further research on the motion of cylindrical particles in turbulent flows.

  15. Stability of generic cylindrical thin shell wormholes

    CERN Document Server

    Mazharimousavi, S Habib; Amirabi, Z

    2014-01-01

    We revisit the stability analysis of cylindrical thin shell wormholes which have been studied in literature so far. Our approach is more systematic and in parallel to the method which is used in spherically symmetric thin shell wormholes. The stability condition is summarized as the positivity of the second derivative of an effective potential at the equilibrium radius, i.e. $V^{\\prime \\prime}\\left(a_{0}\\right) >0$. This may serve as the master equation in all stability problems for the cylindrical thin-shell wormholes.

  16. RESONANCE RADIATION OF SUBMERGED INFINITE CYLINDRICAL SHELL

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The resonance sound radiation from submerged infinite elastic cylindrical shell, excited by internal harmonic line force, is investigated. The shell radiation power is presented in terms of resonant modal radiation derived from resonance radiation theory (RRT). The resonance radiation formulae are derived from classical Rayleigh normal mode solution, which are useful for understanding the mechanism of sound radiation from submerged shells. As an example, numerical calculation of a thin steel cylindrical shell is done by using these two methods. It seems that the results of RRT solutions are in good agreement with that of Rayleigh normal mode solutions.

  17. Static cylindrical symmetry and conformal flatness

    CERN Document Server

    Herrera, L; Marcilhacy, G; Santos, N O

    2004-01-01

    We present the whole set of equations with regularity and matching conditions required for the description of physically meaningful static cylindrically symmmetric distributions of matter, smoothly matched to Levi-Civita vacuum spacetime. It is shown that the conformally flat solution with equal principal stresses represents an incompressible fluid. It is also proved that any conformally flat cylindrically symmetric static source cannot be matched through Darmois conditions to the Levi-Civita spacetime. Further evidence is given that when the Newtonian mass per unit length reaches 1/2 the spacetime has plane symmetry.

  18. POLARON IN CYLINDRICAL AND SPHERICAL QUANTUM DOTS

    Directory of Open Access Journals (Sweden)

    L.C.Fai

    2004-01-01

    Full Text Available Polaron states in cylindrical and spherical quantum dots with parabolic confinement potentials are investigated applying the Feynman variational principle. It is observed that for both kinds of quantum dots the polaron energy and mass increase with the increase of Frohlich electron-phonon coupling constant and confinement frequency. In the case of a spherical quantum dot, the polaron energy for the strong coupling is found to be greater than that of a cylindrical quantum dot. The energy and mass are found to be monotonically increasing functions of the coupling constant and the confinement frequency.

  19. Micromagnetic simulations of cylindrical magnetic nanowires

    KAUST Repository

    Ivanov, Yurii P.

    2015-05-27

    This chapter reviews micromagnetic simulations of cylindrical magnetic nanowires and their ordered arrays. It starts with a description of the theoretical background of micromagnetism. The chapter discusses main magnetization reversal modes, domain wall types, and state diagrams in cylindrical nanowires of different types and sizes. The results of the hysteresis process in individual nanowires and nanowire arrays also are presented. Modeling results are compared with experimental ones. The chapter also discusses future trends in nanowire applications in relation to simulations, such as current-driven dynamics, spintronics, and spincaloritronics. The main micromagnetic programs are presented and discussed, together with the corresponding links.

  20. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  1. Metastable magnetic domain walls in cylindrical nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Ferguson, C.A.; MacLaren, D.A.; McVitie, S., E-mail: Stephen.McVitie@glasgow.ac.uk

    2015-05-01

    The stability of the asymmetric domain wall (ATDW) in soft magnetic cylindrical nanowires and nanotubes is investigated using micromagnetic simulations. Our calculated phase diagram shows that for cylindrical permalloy nanowires, the transverse domain wall (TDW) is the ground state for radii below 20 nm whilst the Bloch point wall (BPW) is favoured in thicker wires. The ATDW stabilises only as a metastable state but with energy close to that of the BPW. Characterisation of the DW spin structures reveals that the ATDW has a vortex-like surface spin state, in contrast to the divergent surface spins of the TDW. This results in lowering of surface charge above the critical radius. For both cylindrical nanotubes and nanowires we find that ATDWs only appear to exist as metastable static states and are particularly suppressed in nanotubes due to an increase in magnetostatic energy. - Highlights: • We simulate the micromagnetic structures of domain walls in cylindrical nanowires. • A phase diagram identifies ground and metastable states. • Asymmetric transverse walls are metastable in nanowires but suppressed in tubes. • Unrolling surface magnetisation aids visualisation of asymmetry and chirality. • We predict experimental discrimination based on magnetic charge distribution.

  2. Cylindrical vortex wake model: right cylinder

    DEFF Research Database (Denmark)

    Branlard, Emmanuel; Gaunaa, Mac

    2015-01-01

    to recall results from 1D momentum theory. It is shown that a superposition of concentric cylindrical systems predicts the independence of annuli, which is assumed in blade element theory and stream-tube analyses. A simple example of application for the estimation of the velocity deficit upstream of a wind...

  3. Magnetic guns with cylindrical permanent magnets

    DEFF Research Database (Denmark)

    Vokoun, David; Beleggia, Marco; Heller, Luděk

    2012-01-01

    The motion of a cylindrical permanent magnet (projectile) inside a tubular permanent magnet, with both magnets magnetized axially, illustrates nicely the physical principles behind the operation of magnetic guns. The force acting upon the projectile is expressed semi-analytically as derivative...

  4. New photoelectric method for inside cylindricity measurement

    Science.gov (United States)

    Yu, Houyun; Zhao, Zhuanping; Zhao, Ye; Xu, Meijian

    2007-12-01

    Cylindricity is an important parameter in the evaluation for a cylindraceous workpiece. It has a direct effect on the precision of assembly and rotation. However it is difficult to carry out inside cylindricity measurement for a large workpiece (length: 2~3m, diameter >200mm), in which the spindle's straightness and measuring table's motion error deserve consideration. In this paper, a new error separation method is presented based on the application of precise photoelectric inspecting technique. And the two errors will be directly measured according to the deviation of facula. During the measurement, the workpiece is installed erectly on the base to minimize its distortion. Laser collimation initializes the measuring needle and gives real-time state of the measuring table. Two kinds of coordinates are used for error compensation, i.e. absolute and imaging coordinates. In the end, the least squares cylinder is used to calculate the cylindricity after all point data of each section are modified. Overall structure design and detailed measuring steps are also listed. Thus, the models of error compensation and cylindricity evaluation are obtained. Simulation results prove them correct with a satisfying precision.

  5. Deformation of cylindrical shells under thermal shock

    Energy Technology Data Exchange (ETDEWEB)

    Aptukov, V.N. (Institut Mekhaniki Sploshnykh Sred, Perm (USSR))

    1990-06-01

    The deformation and fracture behavior of cylindrical shells under conditions of a nonsymmetric thermal shock is investigated numerically using a two-dimensional formulation. In particular, attention is given to the effect of the shell thickness on the deformation and fracture characteristics. Some computational difficulties associated with the solution of problems of this type are examined. 16 refs.

  6. The double explosive layer cylindrical compaction method

    NARCIS (Netherlands)

    Stuivinga, M.E.C.; Verbeek, H.J.; Carton, E.P.

    1999-01-01

    The standard cylindrical configuration for shock compaction is useful for the compaction of composite materials which have some plastic behavior. It can also be used to densify hard ceramics up to about 85% of the theoretical density (TMD), when low detonation velocity explosives (2-4 km s-1) are us

  7. A large acceptance cylindrical drift chamber detector

    Energy Technology Data Exchange (ETDEWEB)

    Ambrose, D.A. [Texas Univ., Austin, TX (United States); Bachman, M.G. [Texas Univ., Austin, TX (United States); Coffey, W.P. [Texas Univ., Austin, TX (United States); Glass, G. [Texas Univ., Austin, TX (United States); McNaughton, K.H. [Texas Univ., Austin, TX (United States); Riley, P.J. [Texas Univ., Austin, TX (United States); Adams, D.L. [Rice University, Houston, TX 77251 (United States); Gaussiran, T.L. [Rice University, Houston, TX 77251 (United States); Hungerford, E.V. [University of Houston, Houston, TX 77204 (United States); Lan, K.A. [University of Houston, Houston, TX 77204 (United States); Johnston, K. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); McNaughton, M.W. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Penttila, S.I. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Supek, I. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    1995-10-01

    This paper describes a large acceptance cylindrical drift chamber detector designed and built for the study of the np{yields}pp{pi}{sup -} reaction at neutron beam energies in the range 500-800 MeV. Details of construction, electronics, testing, and detection efficiencies and resolutions are presented. (orig.).

  8. Shear stresses around circular cylindrical openings

    NARCIS (Netherlands)

    Hoogenboom, P.C.J.; Van Weelden, C.; Blom, C.M.B.

    2010-01-01

    In this paper stress concentrations are studied around circular cylindrical openings or voids in a linear elastic continuum. The loading is such that a uniform shear stress occurs in the continuum, which is disturbed by the opening. The shear stress is in the direction of the centre axis of the open

  9. Antibubbles and fine cylindrical sheets of air

    KAUST Repository

    Beilharz, D.

    2015-08-14

    Drops impacting at low velocities onto a pool surface can stretch out thin hemispherical sheets of air between the drop and the pool. These air sheets can remain intact until they reach submicron thicknesses, at which point they rupture to form a myriad of microbubbles. By impacting a higher-viscosity drop onto a lower-viscosity pool, we have explored new geometries of such air films. In this way we are able to maintain stable air layers which can wrap around the entire drop to form repeatable antibubbles, i.e. spherical air layers bounded by inner and outer liquid masses. Furthermore, for the most viscous drops they enter the pool trailing a viscous thread reaching all the way to the pinch-off nozzle. The air sheet can also wrap around this thread and remain stable over an extended period of time to form a cylindrical air sheet. We study the parameter regime where these structures appear and their subsequent breakup. The stability of these thin cylindrical air sheets is inconsistent with inviscid stability theory, suggesting stabilization by lubrication forces within the submicron air layer. We use interferometry to measure the air-layer thickness versus depth along the cylindrical air sheet and around the drop. The air film is thickest above the equator of the drop, but thinner below the drop and up along the air cylinder. Based on microbubble volumes, the thickness of the cylindrical air layer becomes less than 100 nm before it ruptures.

  10. Sedimentation of Rigid Cylindrical Particles with Mechanical Contacts

    Institute of Scientific and Technical Information of China (English)

    LIN Jian-Zhong; WANG Ye-Long; James A. Olsen

    2005-01-01

    @@ A collision model of two cylindrical particles is put forward. Based on the model the sedimentation of rigid cylindrical particles with mechanical contacts is simulated numerically by using the lattice Boltzmann method.

  11. Numerical Simulation of Large Diameter Cylindrical Structure Slamming

    Institute of Scientific and Technical Information of China (English)

    XU Jing; WANG De-yu

    2008-01-01

    The water entry of large diameter cylindrical structure is studied by applying numerical simulation method. The processes of different diameter cylindrical structures impacting water with various constant velocities are calculated numerically. Thereafter, analyzed are the distribution of slamming pressure on structure during slamming course and the influence of slamming velocity and cylindrical diameter on slamming process. Furthermore, presented herein is an equation being used to forecast the peak slamming force on a large diameter cylindrical structure.

  12. Dynamic buckling of elastic-plastic cylindrical shells and axial stress waves

    Institute of Scientific and Technical Information of China (English)

    徐新生; 苏先樾; 王仁

    1995-01-01

    The mechanism for bifurcation of elastic-plastic buckling of the semi-infinite cylindrical shell under impacting axial loads is proposed based on the theory of stress wave. Numerical results on three kinds of end supports and step and impulse loads are given.

  13. Nonlinear dynamics of initially imperfect functionally graded circular cylindrical shell under complex loads

    Science.gov (United States)

    Liu, Y. Z.; Hao, Y. X.; Zhang, W.; Chen, J.; Li, S. B.

    2015-07-01

    The nonlinear vibration of a simply supported FGM cylindrical shell with small initial geometric imperfection under complex loads is studied. The effects of radial harmonic excitation, compressive in-plane force combined with supersonic aerodynamic and thermal loads are considered. The small initial geometric imperfection of the cylindrical shell is characterized in the form of the sine-type trigonometric functions. The effective material properties of this FGM cylindrical shell are graded in the radial direction according to a simple power law in terms of the volume fractions. Based on Reddy's third-order shear deformation theory, von Karman-type nonlinear kinematics and Hamilton's principle, the nonlinear partial differential equation that controls the shell dynamics is derived. Both axial symmetric and driven modes of the cylindrical shell deflection pattern are included. Furthermore, the equations of motion can be reduced into a set of coupled nonlinear ordinary differential equations by applying Galerkin's method. In the study of the nonlinear dynamics responses of small initial geometric imperfect FGM cylindrical shell under complex loads, the 4th order Runge-Kutta method is used to obtain time history, phase portraits, bifurcation diagrams and Poincare maps with different parameters. The effects of external loads, geometric imperfections and volume fractions on the nonlinear dynamics of the system are discussed.

  14. A three-dimensional elasticity solution of functionally graded piezoelectric cylindrical panels

    Science.gov (United States)

    Sedighi, M. R.; Shakeri, M.

    2009-05-01

    This research presents an exact solution of finitely long, simply supported, orthotropic, functionally graded piezoelectric (FGP), cylindrical shell panels under pressure and electrostatic excitation. The FGP cylindrical panel is first divided into linearly inhomogeneous elements (LIEs). The general solution of governing partial differential equations of the LIEs is obtained by separation of variables. The highly coupled partial differential equations are reduced to ordinary differential equations with variable coefficients by means of appropriate trigonometric expansion of displacements and electric potential in circumferential and axial directions. The resulting governing ordinary differential equations are solved by the Galerkin finite element method. In this procedure the quadratic shape function is used in each element. The present method is applied to several benchmark problems. The coupled electromechanical effect on the structural behavior of functionally graded piezoelectric cylindrical shell panels is evaluated. The influence of the material property gradient index on the variables of electric and mechanical fields is studied. Finally some results are compared with published results.

  15. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Science.gov (United States)

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  16. Variable-focus cylindrical liquid lens array

    Science.gov (United States)

    Zhao, Wu-xiang; Liang, Dong; Zhang, Jie; Liu, Chao; Zang, Shang-fei; Wang, Qiong-hua

    2013-06-01

    A variable-focus cylindrical liquid lens array based on two transparent liquids of different refractive index is demonstrated. An elastic membrane divides a transparent reservoir into two chambers. The two chambers are filled with liquid 1 and liquid 2, respectively, which are of different refractive index. The micro-clapboards help liquid 1, liquid 2 and the elastic membrane form a cylindrical lens array. Driving these two liquids to flow can change the shape of the elastic membrane as well as the focal length. In this design, the gravity effect of liquid can be overcome. A demo lens array of positive optical power is developed and tested. Moreover, a potential application of the proposed lens array for autostereoscopic 3D displays is emphasized.

  17. Determination of Coil Inductances Cylindrical Iron Nucleus

    Directory of Open Access Journals (Sweden)

    Azeddine Mazouz

    2014-03-01

    Full Text Available The paper describes the investigation and development of a structure and performance characteristics of a coil iron nucleus cylindrical (C.I.N.C. The coil iron nucleus cylindrical is a nonlinear electro radio in which the moving of the nucleus in a sense or in other causes change in inductance and can reach extreme values at the superposition of nucleus and coil centers. The variation of the inductance and the degree of freedom of movement of the nucleus can lead to a device with electromechanical conversion The aim of this paper is the determination and visualization of self inductance and mutual of the (C.I.N.C based on geometric dimensions and the displacement of the nucleus.  

  18. Ion distributions in plane and cylindrical chambers.

    Science.gov (United States)

    Rosen, R; George, E P

    1975-11-01

    The ion chamber equations of Thomson include both ion recombination and space-charge terms. Neglecting the space-charge term, an exact solution is obtained for the ion densities across a plane ionization chamber. The method is extended to the cylindrical chamber, and examples are given of the expected ion distributions in both geometries. Current-voltage relationships are derived for both chambers and compared with those of other workers. If the space-charge term is retained, the ion chamber equations for both geometries are not soluble in closed form. The cylindrical chamber is considered and a computer solution is obtained for the ion distributions and current. Comparison with the nonspace-charge solution shows that while there is only a small difference in the current-voltage relationship, a significant difference can occur in the ion concentrations.

  19. Buckling optimisation of sandwich cylindrical panels

    Science.gov (United States)

    Abouhamzeh, M.; Sadighi, M.

    2016-06-01

    In this paper, the buckling load optimisation is performed on sandwich cylindrical panels. A finite element program is developed in MATLAB to solve the governing differential equations of the global buckling of the structure. In order to find the optimal solution, the genetic algorithm Toolbox in MATLAB is implemented. Verifications are made for both the buckling finite element code and also the results from the genetic algorithm by comparisons to the results available in literature. Sandwich cylindrical panels are optimised for the buckling strength with isotropic or orthotropic cores with different boundary conditions. Results are presented in terms of stacking sequence of fibers in the face sheets and core to face sheet thickness ratio.

  20. Crack problem in a long cylindrical superconductor

    Science.gov (United States)

    Yong, Hua-Dong; Zhou, You-He; Zeng, Jun

    2008-12-01

    In this work, the general problem of a center crack in a long cylindrical superconductor is studied. The dependence of the stress intensity factor on the parameters, including the crack length and the applied field, is investigated. We presented a simple model in which the effect of the crack on the critical current is taken into account. It is assumed that the crack forms a perfect barrier to the flow of current. The Bean model and the Kim model are considered for the critical state. Based on the complex potential and boundary collocation methods, the stress intensity factor under the magnetic field is obtained for a long cylindrical superconductor containing a central crack. The results show that the crack length and the applied field have significant effects on the fracture behavior of the superconductor.

  1. Surface superconductivity in thin cylindrical Bi nanowire.

    Science.gov (United States)

    Tian, Mingliang; Wang, Jian; Ning, Wei; Mallouk, Thomas E; Chan, Moses H W

    2015-03-11

    The physical origin and the nature of superconductivity in nanostructured Bi remains puzzling. Here, we report transport measurements of individual cylindrical single-crystal Bi nanowires, 20 and 32 nm in diameter. In contrast to nonsuperconducting Bi nanoribbons with two flat surfaces, cylindrical Bi nanowires show superconductivity below 1.3 K. However, their superconducting critical magnetic fields decrease with their diameter, which is the opposite of the expected behavior for thin superconducting wires. Quasiperiodic oscillations of magnetoresistance were observed in perpendicular fields but were not seen in the parallel orientation. These results can be understood by a model of surface superconductivity with an enhanced surface-to-bulk volume in small diameter wires, where the superconductivity originates from the strained surface states of the nanowires due to the surface curvature-induced stress.

  2. Acoustic mode coupling of two facing, shallow cylindrical cavities

    Science.gov (United States)

    McCarthy, Philip; Ekmekci, Alis

    2016-11-01

    Cavity mode excitation by grazing flows is a well-documented source for noise generation. Similarly to their rectangular equivalents, single cylindrical cavities have been shown to exhibit velocity dependent self-sustaining feedback mechanisms that produce significant tonal noise. The present work investigates the effect of cavity mode coupling on the tonal noise generation for two facing, shallow cylindrical cavities. This geometric arrangement may occur for constrained flows, such as those within ducts, silencers or between aircraft landing gear wheels. For the latter configuration, the present study has observed that the tonal frequency dependence upon the freestream Mach number, associated with the single cavity feedback mechanism, no longer holds true. Instead, two simultaneously present and distinct large amplitude tones that are independent (in frequency) of speed, propagate to the far field. These two, fixed frequency tones are attributable to the first order transverse mode, and the first order transverse and azimuthal modes for the two combined cavities and the volume between them. Altering either the cavity aspect ratio or the inter-cavity spacing thus changes the acoustic resonant volume and translates the centre frequencies of the observed tones correspondingly. The authors would like to thank Bombardier and Messier-Bugatti-Dowty for their continued support.

  3. Natural frequency of a circular cylindrical shell filled with fluid

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Kyeong Hoon; Kim, Tae Wan; Kim, Kang Soo; Park, Keun Bae [Korea Atomic Energy Research Institute, Taejon (Korea)

    1998-08-01

    This report presents an analytical method for evaluating the free vibration of a circular cylindrical shell filled with bounded compressible fluid. The analytical method was developed by means of the finite Fourier series expansion method. The compressible fluid motion was determined by means of the linear velocity potential theory. To clarify the validity of the analytical method, the natural frequencies of a circular cylindrical shell with the clamped-clamped boundary condition, and filled with water, were obtained by the analytical method and the finite element method using a commercial ANSYS 5.2 software. Excellent agreement on the natural frequencies of the fluid-filled shell structure was found. The compressibility and density of fluid effects the normalized coupled natural frequencies were investigated. The density of fluid affects on all coupled natural frequencies of the shell,, whereas the compressibility and bounding of fluid affects mainly on the natural frequencies of lower circumferential modes. The theory developed in this report will be applicable to the dynamic analysis of a core support barrel in SMART integral reactor filled with coolant. (author). 15 refs., 14 figs., 1 tab.

  4. Expansion-free Cylindrically Symmetric Models

    CERN Document Server

    Sharif, M

    2013-01-01

    This paper investigates cylindrically symmetric distribution of an-isotropic fluid under the expansion-free condition, which requires the existence of vacuum cavity within the fluid distribution. We have discussed two family of solutions which further provide two exact models in each family. Some of these solutions satisfy Darmois junction condition while some show the presence of thin shell on both boundary surfaces. We also formulate a relation between the Weyl tensor and energy density.

  5. Rarefied gas flow in a cylindrical annulus

    Science.gov (United States)

    Lo, S. S.; Loyalka, S. K.; Storvick, T. S.

    1983-09-01

    The Hansen-Morse model of the linearized Wang Chang-Uhlenbeck equation is used to study the thermal transpiration and mechanocaloric effects for rarefied polyatomic gases in a cylindrical annulus, where boundary conditions are characterized by diffuse reflection. Phenomenological coefficients at all degrees of rarefaction are reported for physical parameters that represent helium, hydrogen, carbon dioxide, and air. Comparisons with isothermal flow data are given.

  6. Shock initiated instabilities in underwater cylindrical structures

    Science.gov (United States)

    Gupta, Sachin; Matos, Helio; LeBlanc, James M.; Shukla, Arun

    2016-10-01

    An experimental investigation to understand the mechanisms of dynamic buckling instability in cylindrical structures due to underwater explosive loadings is conducted. In particular, the effects of initial hydrostatic pressure coupled with a dynamic pressure pulse on the stability of metallic cylindrical shells are evaluated. The experiments are conducted at varying initial hydrostatic pressures, below the critical buckling pressure, to estimate the threshold after which dynamic buckling will initiate. The transient underwater full-field deformations of the structures during shock wave loading are captured using high-speed stereo photography coupled with modified 3-D Digital Image Correlation (DIC) technique. Experimental results show that increasing initial hydrostatic pressure decreases the natural vibration frequency of the structure indicating loss in structural stiffness. DIC measurements reveal that the initial structural excitations primarily consist of axisymmetric vibrations due to symmetrical shock wave loading in the experiments. Following their decay after a few longitudinal reverberations, the primary mode of vibration evolves which continues throughout later in time. At the initial hydrostatic pressures below the threshold value, these vibrations are stable in nature. The analytical solutions for the vibration frequency and the transient response of cylindrical shell are discussed in the article by accounting for both (1) the added mass effect of the surrounding water and (2) the effect of initial stress on the shell imposed by the hydrostatic pressure. The analytical solutions match reasonably well with the experimental vibration frequencies. Later, the transient response of a cylindrical shell subjected to a general underwater pressure wave loading is derived which leads to the analytical prediction of dynamic stability.

  7. Machining Thin-Walled Cylindrical Parts

    Science.gov (United States)

    Cimbak, Joe; Spagnolo, Jim; Kraus, Dan

    1988-01-01

    Cylindrical walls only few thousandths of inch thick machined accurately and without tears or punctures with aid of beryllium copper mandrel. Chilled so it contracts, then inserted in cylinder. As comes to room temperature, mandrel expands and fits snugly inside cylinder. Will not allow part to slide and provides solid backup to prevent deflection when part machined by grinding wheel. When machining finished, cylinder-and-mandrel assembly inserted in dry ice, mandrel contracts and removed from part.

  8. Cylindric-like algebras and algebraic logic

    CERN Document Server

    Ferenczi, Miklós; Németi, István

    2013-01-01

    Algebraic logic is a subject in the interface between logic, algebra and geometry, it has strong connections with category theory and combinatorics. Tarski’s quest for finding structure in logic leads to cylindric-like algebras as studied in this book, they are among the main players in Tarskian algebraic logic. Cylindric algebra theory can be viewed in many ways:  as an algebraic form of definability theory, as a study of higher-dimensional relations, as an enrichment of Boolean Algebra theory, or, as logic in geometric form (“cylindric” in the name refers to geometric aspects). Cylindric-like algebras have a wide range of applications, in, e.g., natural language theory, data-base theory, stochastics, and even in relativity theory. The present volume, consisting of 18 survey papers, intends to give an overview of the main achievements and new research directions in the past 30 years, since the publication of the Henkin-Monk-Tarski monographs. It is dedicated to the memory of Leon Henkin.

  9. Simulation Analysis of Cylindrical Panoramic Image Mosaic

    Directory of Open Access Journals (Sweden)

    ZHU Ningning

    2017-04-01

    Full Text Available With the rise of virtual reality (VR technology, panoramic images are used more widely, which obtained by multi-camera stitching and take advantage of homography matrix and image transformation, however, this method will destroy the collinear condition, make it's difficult to 3D reconstruction and other work. This paper proposes a new method for cylindrical panoramic image mosaic, which set the number of mosaic camera, imaging focal length, imaging position and imaging attitude, simulate the mapping process of multi-camera and construct cylindrical imaging equation from 3D points to 2D image based on photogrammetric collinearity equations. This cylindrical imaging equation can not only be used for panoramic stitching, but also be used for precision analysis, test results show: ①this method can be used for panoramic stitching under the condition of multi-camera and incline imaging; ②the accuracy of panoramic stitching is affected by 3 kinds of parameter errors including focus, displacement and rotation angle, in which focus error can be corrected by image resampling, displacement error is closely related to object distance and rotation angle error is affected mainly by the number of cameras.

  10. Free vibration analysis of open circular cylindrical shells by the method of reverberation-ray matrix

    Directory of Open Access Journals (Sweden)

    Dong Tang

    2016-03-01

    Full Text Available This article is concerned with free vibration analysis of open circular cylindrical shells with either the two straight edges or the two curved edges simply supported and the remaining two edges supported by arbitrary classical boundary conditions. An analytical solution of the traveling wave form along the simply supported edges and the standing wave form along the remaining two edges is obtained based on the Flügge thin shell theory. With such a unidirectional traveling wave form solution, the method of reverberation-ray matrix is introduced to derive the equation of natural frequencies of the open circular cylindrical shell with various boundary conditions. Then, the golden section search algorithm is employed to obtain the natural frequencies of the open circular cylindrical shell. The calculation results are compared with those obtained by the finite element method and the method in available literature. Finally, the natural frequencies of the open circular cylindrical shell with various boundary conditions are calculated and the effects of boundary conditions on the natural frequencies are examined. The calculation results can be used as benchmark values for researchers to check their numerical methods and for engineers to design thin structures with shell components.

  11. Characteristics of Left-Right Spiral Hollow Cylindrical Roller

    Institute of Scientific and Technical Information of China (English)

    Liming Lu; Qiping Chen; Yujiang Qin

    2015-01-01

    Based on new rolling⁃sliding compound bearings, the wear between the one⁃way spiral hollow cylindrical roller and the ribs of the inner and outer ring of rolling⁃sliding compound bearings is reduced by innovational structural design. A new left⁃right spiral hollow cylindrical roller is proposed to replace the one⁃way spiral hollow cylindrical roller. The finite element analysis models of ordinary cylindrical rollers, one⁃way spiral hollow cylindrical rollers and left⁃right spiral hollow cylindrical rollers are respectively established by ABAQUS. The axial displacement of their center mass and the stress distribution of left⁃right spiral hollow cylindrical rollers are compared and analyzed. Theoretical study results show that this new left⁃right spiral hollow cylindrical roller not only inherits the advantages of one⁃way spiral hollow cylindrical rollers, but also avoids the axial offset and the serious wear of the one⁃way spiral hollow cylindrical roller. And the theory research conclusion is verified by the experiment. The left⁃right spiral hollow cylindrical roller has the advantages to overcome boundary stress concentration like logarithmic convex roller. The rolling⁃sliding compound bearings equipped with the new rollers can be better to adapt to the impact of vibration load.

  12. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  13. Response of long shallow cylindrical panels to radial line loads

    Science.gov (United States)

    Johnson, E. R.; Hyer, M. W.; Carper, D. M.

    1984-01-01

    The large displacement static response of shallow orthotropic panels subjected to lateral loading is examined both theoretically and experimentally. The panels are circular cylindrical open shells which are also thin and long. The straight edges are simply supported at a fixed distance apart, and the curved edges are free. The lateral load is a spatially uniform line load acting along the generator direction of the cylinder, and is directed radially inward toward the center of curvature. The load induces a circumferential thrust, and the panel can, and does, snap-through to an inverted configuration at the buckling load. The effect of load position on the response is also examined. The test panels discussed in the paper are /(90/0)3/S graphite-epoxy laminates. Nominal dimensions are a radius of 60 in., a thickness of 0.060 in., and an arc length of 12 in. Very good agreement between theory and experiment is achieved.

  14. Magneto-Rayleigh-Taylor growth and feedthrough in cylindrical liners

    Science.gov (United States)

    Weis, Matthew; Lau, Y. Y.; Gilgenbach, Ronald; Peterson, Kyle; Hess, Mark

    2013-10-01

    Cylindrical liner implosions in the MagLIF concept are susceptible to the magneto-Rayleigh-Taylor instability (MRT). The linearized ideal MHD equations are solved, including the presence of an axial magnetic field and the effects of sausage and kink modes. The eigenmode solution, using appropriate equilibrium profiles, allows an assessment of the local MRT growth rate and of the instantaneous feedthrough factor during the entire implosion process. Of particular interest will be the high convergence/stagnation phase, which is difficult to image experimentally. Strong axial magnetic fields can mitigate feedthrough and MRT growth, which may be useful at the fuel/liner interface during this phase of the MagLIF implosion. For the MRT growth rate and feedthrough factors, the LLNL code, HYDRA, is used to benchmark with the analytic theory, and with experiments on the Z-machine. This work was supported by DoE and NSF.

  15. Vibration of cylindrical shells of bimodulus composite materials

    Science.gov (United States)

    Bert, C. W.; Kumar, M.

    1982-03-01

    A theory is formulated for the small amplitude free vibration of thick, circular cylindrical shells laminated of bimodulus composite materials, which have different elastic properties depending upon whether the fiber-direction strain is tensile or compressive. The theory used is the dynamic, shear deformable (moderately thick shell) analog of the Sanders best first approximation thin shell theory. By means of tracers, the analysis can be reduced to that of various simpler shell theories, namely Love's first approximation, and Donnell's shallow shell theory. As an example of the application of the theory, a closed form solution is presented for a freely supported panel or complete shell. To validate the analysis, numerical results are compared with existing results for various special cases. Also, the effects of the various shell theories, thickness shear flexibility, and bimodulus action are investigated.

  16. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  17. Motion parallax in immersive cylindrical display systems

    Science.gov (United States)

    Filliard, N.; Reymond, G.; Kemeny, A.; Berthoz, A.

    2012-03-01

    Motion parallax is a crucial visual cue produced by translations of the observer for the perception of depth and selfmotion. Therefore, tracking the observer viewpoint has become inevitable in immersive virtual (VR) reality systems (cylindrical screens, CAVE, head mounted displays) used e.g. in automotive industry (style reviews, architecture design, ergonomics studies) or in scientific studies of visual perception. The perception of a stable and rigid world requires that this visual cue be coherent with other extra-retinal (e.g. vestibular, kinesthetic) cues signaling ego-motion. Although world stability is never questioned in real world, rendering head coupled viewpoint in VR can lead to the perception of an illusory perception of unstable environments, unless a non-unity scale factor is applied on recorded head movements. Besides, cylindrical screens are usually used with static observers due to image distortions when rendering image for viewpoints different from a sweet spot. We developed a technique to compensate in real-time these non-linear visual distortions, in an industrial VR setup, based on a cylindrical screen projection system. Additionally, to evaluate the amount of discrepancies tolerated without perceptual distortions between visual and extraretinal cues, a "motion parallax gain" between the velocity of the observer's head and that of the virtual camera was introduced in this system. The influence of this artificial gain was measured on the gait stability of free-standing participants. Results indicate that, below unity, gains significantly alter postural control. Conversely, the influence of higher gains remains limited, suggesting a certain tolerance of observers to these conditions. Parallax gain amplification is therefore proposed as a possible solution to provide a wider exploration of space to users of immersive virtual reality systems.

  18. Application of fuzzy GA for optimal vibration control of smart cylindrical shells

    Science.gov (United States)

    Jin, Zhanli; Yang, Yaowen; Kiong Soh, Chee

    2005-12-01

    In this paper, a fuzzy-controlled genetic-based optimization technique for optimal vibration control of cylindrical shell structures incorporating piezoelectric sensor/actuators (S/As) is proposed. The geometric design variables of the piezoelectric patches, including the placement and sizing of the piezoelectric S/As, are processed using fuzzy set theory. The criterion based on the maximization of energy dissipation is adopted for the geometric optimization. A fuzzy-rule-based system (FRBS) representing expert knowledge and experience is incorporated in a modified genetic algorithm (GA) to control its search process. A fuzzy logic integrated GA is then developed and implemented. The results of three numerical examples, which include a simply supported plate, a simply supported cylindrical shell, and a clamped simply supported plate, provide some meaningful and heuristic conclusions for practical design. The results also show that the proposed fuzzy-controlled GA approach is more effective and efficient than the pure GA method.

  19. Radiation of sound from unflanged cylindrical ducts

    Science.gov (United States)

    Hartharan, S. L.; Bayliss, A.

    1983-01-01

    Calculations of sound radiated from unflanged cylindrical ducts are presented. The numerical simulation models the problem of an aero-engine inlet. The time dependent linearized Euler equations are solved from a state of rest until a harmonic solution is attained. A fourth order accurate finite difference scheme is used and solutions are obtained from a fully vectorized Cyber-203 computer program. Cases of both plane waves and spin modes are treated. Spin modes model the sound generated by a turbofan engine. Boundary conditions for both plane waves and spin modes are treated. Solutions obtained are compared with experiments conducted at NASA Langley Research Center.

  20. Free vibrations of circular cylindrical shells

    CERN Document Server

    Armenàkas, Anthony E; Herrmann, George

    1969-01-01

    Free Vibrations of Circular Cylindrical Shells deals with thin-walled structures that undergo dynamic loads application, thereby resulting in some vibrations. Part I discusses the treatment of problems associated with the propagation of plane harmonic waves in a hollow circular cylinder. In such search for solutions, the text employs the framework of the three-dimensional theory of elasticity. The text explains the use of tables of natural frequencies and graphs of representative mode shapes of harmonic elastic waves bounding in an infinitely long isotropic hollow cylinder. The tables are

  1. Kaluza-Klein Magnetized Cylindrical Wormhole

    CERN Document Server

    Hashemi, S Sedigheh

    2015-01-01

    A new exact vacuum solution in five dimensions, which describes a magnetized cylindrical wormhole in $3+1$ dimensions is presented. The magnetic field lines are stretched along the wormhole throat and are concentrated near to it. We study the motion of neutral and charged test particles under the influence of the magnetized wormhole. The effective potential for a neutral test particle around and across the magnetized wormhole has a repulsive character. The total magnetic flux on either side of the wormhole is obtained. We present analytic expressions which show regions in which the null energy condition is violated.

  2. Cellular Cell Bifurcation of Cylindrical Detonations

    Institute of Scientific and Technical Information of China (English)

    HAN Gui-Lai; JIANG Zong-Lin; WANG Chun; ZHANG Fan

    2008-01-01

    Cellular cell pattern evolution of cylindrically-diverging detonations is numerically simulated successfully by solving two-dimensional Euler equations implemented with an improved two-step chemical kinetic model. From the simulation, three cell bifurcation modes are observed during the evolution and referred to as concave front focusing, kinked and wrinkled wave front instability, and self-merging of cellular cells. Numerical research demonstrates that the wave front expansion resulted from detonation front diverging plays a major role in the cellular cell bifurcation, which can disturb the nonlinearly self-sustained mechanism of detonations and finally lead to cell bifurcations.

  3. A cylindrical furnace for absorption spectral studies

    Indian Academy of Sciences (India)

    R Venkatasubramanian

    2001-06-01

    A cylindrical furnace with three heating zones, capable of providing a temperature of 1100°C, has been fabricated to enable recording of absorption spectra of high temperature species. The temperature of the furnace can be controlled to ± 1°C of the set temperature. The salient feature of this furnace is that the material being heated can be prevented from depositing on the windows of the absorption cell by maintaining a higher temperature at both the ends of the absorption cell.

  4. Cylindrical metamaterial-based subwavelength antenna

    DEFF Research Database (Denmark)

    Erentok, Aycan; Kim, Oleksiy S.; Arslanagic, Samel

    2009-01-01

    A subwavelength monopole antenna radiating in the presence of a truncated cylindrical shell, which has a capped top face and is made of a negative permittivity metamaterial, is analyzed numerically by a method of moments for the volume-surface integral equation oil the one hand, and a finite...... element method on the other hand. It is shown that a center-fed truncated cylinder, in contrast to an infinite cylinder, provides subwavelength resonances, thus suggesting the possibility, of having a subwavelength antenna system....

  5. Stability analysis of cylindrical Vlasov equilibria

    Energy Technology Data Exchange (ETDEWEB)

    Short, R.W.

    1979-01-01

    A general method of stability analysis is described which may be applied to a large class of such problems, namely those which are described dynamically by the Vlasov equation, and geometrically by cylindrical symmetry. The method is presented for the simple case of the Vlasov-Poisson (electrostatic) equations, and the results are applied to a calculation of the lower-hybrid-drift instability in a plasma with a rigid rotor distribution function. The method is extended to the full Vlasov-Maxwell (electromagnetic) equations. These results are applied to a calculation of the instability of the extraordinary electromagnetic mode in a relativistic E-layer interacting with a background plasma.

  6. OPTIMAL THICKNESS OF A CYLINDRICAL SHELL

    Directory of Open Access Journals (Sweden)

    Paul Ziemann

    2015-01-01

    Full Text Available In this paper an optimization problem for a cylindrical shell is discussed. The aim is to look for an optimal thickness of a shell to minimize the deformation under an applied external force. As a side condition, the volume of the shell has to stay constant during the optimization process. The deflection is calculated using an approach from shell theory. The resulting control-to-state operator is investigated analytically and a corresponding optimal control problem is formulated. Moreover, necessary conditions for an optimal solution are stated and numerical solutions are presented for different examples.

  7. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  8. Forced Vibration Analysis for a FGPM Cylindrical Shell

    Directory of Open Access Journals (Sweden)

    Hong-Liang Dai

    2013-01-01

    Full Text Available This article presents an analytical study for forced vibration of a cylindrical shell which is composed of a functionally graded piezoelectric material (FGPM. The cylindrical shell is assumed to have two-constituent material distributions through the thickness of the structure, and material properties of the cylindrical shell are assumed to vary according to a power-law distribution in terms of the volume fractions for constituent materials, the exact solution for the forced vibration problem is presented. Numerical results are presented to show the effect of electric excitation, thermal load, mechanical load and volume exponent on the static and force vibration of the FGPM cylindrical shell. The goal of this investigation is to optimize the FGPM cylindrical shell in engineering, also the present solution can be used in the forced vibration analysis of cylindrical smart elements.

  9. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  10. Optical inspection system for cylindrical objects

    Science.gov (United States)

    Brenden, Byron B.; Peters, Timothy J.

    1989-01-01

    In the inspection of cylindrical objects, particularly O-rings, the object is translated through a field of view and a linear light trace is projected on its surface. An image of the light trace is projected on a mask, which has a size and shape corresponding to the size and shape which the image would have if the surface of the object were perfect. If there is a defect, light will pass the mask and be sensed by a detector positioned behind the mask. Preferably, two masks and associated detectors are used, one mask being convex to pass light when the light trace falls on a projection from the surface and the other concave, to pass light when the light trace falls on a depression in the surface. The light trace may be either dynamic, formed by a scanned laser beam, or static, formed by such a beam focussed by a cylindrical lens. Means are provided to automatically keep the illuminating receiving systems properly aligned.

  11. Vibration analysis of bimodulus laminated cylindrical panels

    Science.gov (United States)

    Khan, K.; Patel, B. P.; Nath, Y.

    2009-03-01

    This paper deals with the flexural vibration behavior of bimodular laminated composite cylindrical panels with various boundary conditions. The formulation is based on first order shear deformation theory and Bert's constitutive model. The governing equations are derived using finite element method and Lagrange's equation of motion. An iterative eigenvalue approach is employed to obtain the positive and negative half cycle free vibration frequencies and corresponding mode shapes. A detailed parametric study is carried out to study the influences of thickness ratio, aspect ratio, lamination scheme, edge conditions and bimodularity ratio on the free vibration characteristics of bimodulus angle- and cross-ply composite laminated cylindrical panels. It is interesting to observe that there is a significant difference between the frequencies of positive and negative half cycles depending on the panel parameters. Through the thickness distribution of modal stresses for positive half cycle is significantly different from that for negative half cycle unlike unimodular case wherein the stresses at a particular location in negative half cycle would be of same magnitude but of opposite sign of those corresponding to positive half cycle. Finally, the effect of bimodularity on the steady state response versus forcing frequency relation is studied for a typical case.

  12. Multimode interaction in axially excited cylindrical shells

    Directory of Open Access Journals (Sweden)

    Silva F. M. A.

    2014-01-01

    Full Text Available Cylindrical shells exhibit a dense frequency spectrum, especially near the lowest frequency range. In addition, due to the circumferential symmetry, frequencies occur in pairs. So, in the vicinity of the lowest natural frequencies, several equal or nearly equal frequencies may occur, leading to a complex dynamic behavior. So, the aim of the present work is to investigate the dynamic behavior and stability of cylindrical shells under axial forcing with multiple equal or nearly equal natural frequencies. The shell is modelled using the Donnell nonlinear shallow shell theory and the discretized equations of motion are obtained by applying the Galerkin method. For this, a modal solution that takes into account the modal interaction among the relevant modes and the influence of their companion modes (modes with rotational symmetry, which satisfies the boundary and continuity conditions of the shell, is derived. Special attention is given to the 1:1:1:1 internal resonance (four interacting modes. Solving numerically the governing equations of motion and using several tools of nonlinear dynamics, a detailed parametric analysis is conducted to clarify the influence of the internal resonances on the bifurcations, stability boundaries, nonlinear vibration modes and basins of attraction of the structure.

  13. Data fusion for cylindrical form measurements

    Science.gov (United States)

    Liu, Pei; Jusko, Otto; Tutsch, Rainer

    2015-12-01

    For high-precision form measurements of cylindrical workpieces form profiles such as roundness and straightness profiles are independently acquired via a bird-cage strategy. The 3D point cloud reconstructed by fusing these intersected profiles is meaningful in dimension and form assessment for cylinder, since enhanced accuracy can be achieved by fusion results. Moreover, it plays an important role as the input to other calculations. However, these data cannot be accurately aligned in form reconstruction, due to random absolute offsets in profiles and a lack of absolute positions. Therefore, we propose an approach to data fusion of these profiles to reconstruct cylindrical form. The uncertainties of the fused profile are evaluated, taking an individual contribution of a single profile and a global contribution of all profiles into account. The associated uncertainties are propagated using the Monte Carlo method. Experimental study results indicate that the data fusion procedure improves the accuracy of available datasets. After fusion, all available data points are capable of being used in the form assessment.

  14. Low distortion laser welding of cylindrical components

    Science.gov (United States)

    Kittel, Sonja

    2011-02-01

    Automotive components are for the most part cylindrical and thus the weld seams are of radial shape. Radial weld seams are usually produced by starting at a point on the component's surface rotating the component resulting in an overlap zone at the start/end of the weld. In this research, it is shown that the component's distortion strongly depends on the overlap of weld start and end. A correlation between overlap zone and distortion is verified by an experimental study. In order to reduce distortion generated by the overlap zone a special optics is used which allows shaping the laser beam into a ring shape which is then focused on the cylindrical surface and produces a radial ring weld seam simultaneously by one laser pulse. In doing this, the overlap zone is eliminated and distortion can be reduced. Radial weld seams are applied on precision samples and distortion is measured after welding. The distortion of the precision samples is measured by a tactile measuring method and a comparison of the results of welding with the ring optics to reference welds is done.

  15. Magnetostatic interactions and forces between cylindrical permanent magnets

    Energy Technology Data Exchange (ETDEWEB)

    Vokoun, David [Institute of Physics ASCR, v.v.i., Prague (Czech Republic)], E-mail: vokoun@fzu.cz; Beleggia, Marco [Institute for Materials Research, University of Leeds, Leeds LS2 9JT (United Kingdom); Heller, Ludek; Sittner, Petr [Institute of Physics ASCR, v.v.i., Prague (Czech Republic)

    2009-11-15

    Permanent magnets of various shapes are often utilized in magnetic actuators, sensors or releasable magnetic fasteners. Knowledge of the magnetic force is required to control devices reliably. Here, we introduce an analytical expression for calculating the attraction force between two cylindrical permanent magnets on the assumption of uniform magnetization. Although the assumption is not fulfilled exactly in cylindrical magnets, we obtain a very good agreement between the calculated and measured forces between two identical cylindrical magnets and within an array of NdFeB cylindrical magnets.

  16. Magnetostatic interactions and forces between cylindrical permanent magnets

    Science.gov (United States)

    Vokoun, David; Beleggia, Marco; Heller, Luděk; Šittner, Petr

    2009-11-01

    Permanent magnets of various shapes are often utilized in magnetic actuators, sensors or releasable magnetic fasteners. Knowledge of the magnetic force is required to control devices reliably. Here, we introduce an analytical expression for calculating the attraction force between two cylindrical permanent magnets on the assumption of uniform magnetization. Although the assumption is not fulfilled exactly in cylindrical magnets, we obtain a very good agreement between the calculated and measured forces between two identical cylindrical magnets and within an array of NdFeB cylindrical magnets.

  17. Unbalanced Cylindrical Magnetron for Accelerating Cavities Coating

    CERN Document Server

    Rosaz, Guillaume; Calatroni, Sergio; Sublet, Alban; Tobarelli, Mauro

    2016-01-01

    We report in this paper the design and qualification of a cylindrical unbalanced magnetron source. The dedicated magnetic assemblies were simulated using a finite element model. A hall-effect magnetic probe was then used to characterize those assemblies and compared to the theoretical magnet profiles. These show a good agreement between the expected and actual values. the qualification of the different magnetic assemblies was then performed by measuring the ion flux density reaching the surface of the sample to be coated using a commercial retarding field energy analyzer. The strongest unbalanced configuration shows an increase from 0.016A.cm^-2 to 0.074A.cm^-2 of the ion flux density reaching the sample surface compared to the standard balanced configuration for a pressure 5.10^-3 mbar and a plasma source power of 300W.

  18. Mathematical model of cylindrical form tolerance

    Institute of Scientific and Technical Information of China (English)

    蔡敏; 杨将新; 吴昭同

    2004-01-01

    Tolerance is essential for integration of CAD and CAM. Unfortunately, the meaning of tolerances in the national standard is expressed in graphical and language forms and is not adaptable for expression, processing and data transferring with computers. How to interpret its semantics is becoming a focus of relevant studies. This work based on the mathematical definition of form tolerance in ANSI Y 14.5.1 M-1994, established the mathematical model of form tolerance for cylindrical feature. First, each tolerance in the national standard was established by vector equation. Then on the foundation of toler-ance's mathematical definition theory, each tolerance zone's mathematical model was established by inequality based on degrees of feature. At last the variance area of each tolerance zone is derived. This model can interpret the semantics of form tolerance exactly and completely.

  19. Mathematical model of cylindrical form tolerance

    Institute of Scientific and Technical Information of China (English)

    蔡敏; 杨将新; 吴昭同

    2004-01-01

    Tolerance is essential for integration of CAD and CAM.Unfortunately,the meaning of tolerances in the national standard is expressed in graphical and language forms and is not adaptable for expression,processing and data transferring with computers.How to interpret its semantics is becoming a focus of relevant studies.This work based on the mathematical definition of form tolerance in ANSI Y 14.5.1 M-1994,established the mathematical model of form tolerance for cylindrical feature.First,each tolerance in the national standard was established by vector equation.Then on the foundation of tolerance's mathematical definition theory,each tolerance zone's mathematical model was established by inequality based on degrees of feature.At last the variance area of each tolerance zone is derived.This model can interpret the semantics of form tolerance exactly and completely.

  20. SPSM and its application in cylindrical shells

    Institute of Scientific and Technical Information of China (English)

    NIE Wu; ZHOU Su-lian; PENG Hui

    2008-01-01

    In naval architectures, the structure of prismatic shell is used widely. But there is no suitable method to analyze this kind of structure. Stiffened prismatic shell method (SPSM) presented in this paper, is one of the harmonic semi-analytic methods. Theoretically, strong stiffened structure can be analyzed economically and accurately. SPSM is based on the analytical solution of the governing differential equations for orthotropic cylindrical shells. In these differential equations, the torsional stiffness, bending stiffness and the exact position of each stiffener are taken into account with the Heaviside singular function. An algorithm is introduced, in which the actions of stiffeners on shells are replaced by external loads at each stiffener position. Stiffened shells can be computed as non-stiffened shells. Eventually, the displacement solution of the equations is acquired by the introduction of Green function. The stresses in a corrugated transverse bulkhead without pier base of an oil tanker are computed by using SPSM.

  1. Indentation of Ellipsoidal and Cylindrical Elastic Shells

    KAUST Repository

    Vella, Dominic

    2012-10-01

    Thin shells are found in nature at scales ranging from viruses to hens\\' eggs; the stiffness of such shells is essential for their function. We present the results of numerical simulations and theoretical analyses for the indentation of ellipsoidal and cylindrical elastic shells, considering both pressurized and unpressurized shells. We provide a theoretical foundation for the experimental findings of Lazarus etal. [following paper, Phys. Rev. Lett. 109, 144301 (2012)PRLTAO0031-9007] and for previous work inferring the turgor pressure of bacteria from measurements of their indentation stiffness; we also identify a new regime at large indentation. We show that the indentation stiffness of convex shells is dominated by either the mean or Gaussian curvature of the shell depending on the pressurization and indentation depth. Our results reveal how geometry rules the rigidity of shells. © 2012 American Physical Society.

  2. Space charge emission in cylindrical diode

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Córdoba, Rafael; Martínez-García, Edgar [Universidad Autónoma de Cd. Juárez-IIT, Cd. Juárez, Chihuahua, México (Mexico)

    2014-02-15

    In this paper, a mathematical model to describe cylindrical electron current emissions through a physics approximation method is presented. The proposed mathematical approximation consists of analyzing and solving the nonlinear Poisson's equation, with some determined mathematical restrictions. Our findings tackle the problem when charge-space creates potential barrier that disable the steady-state of the beam propagation. In this problem, the potential barrier effects of electron's speed with zero velocity emitted through the virtual cathode happens. The interaction between particles and the virtual cathode have been to find the inter-atomic potentials as boundary conditions from a quantum mechanics perspective. Furthermore, a non-stationary spatial solution of the electrical potential between anode and cathode is presented. The proposed solution is a 2D differential equation that was linearized from the generalized Poisson equation. A single condition was used solely, throughout the radial boundary conditions of the current density formation.

  3. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  4. Ingestion of six cylindrical and four button batteries

    DEFF Research Database (Denmark)

    Nielsen, Simon U; Rasmussen, Morten; Hoegberg, Lotte C G

    2010-01-01

    We report a suicidal ingestion of six cylindrical and four button batteries, in combination with overdosed prescription medicine and smoking of cannabis.......We report a suicidal ingestion of six cylindrical and four button batteries, in combination with overdosed prescription medicine and smoking of cannabis....

  5. Settling of a cylindrical particle in a stagnant fluid

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Rosendahl, Lasse; Yin, Chungen;

    2007-01-01

    The objective of this work is to collect data and develop models for cylindrical particles which could be used in numerical multiphase flow modeling. Trajectories of cylindrical particles settling in stagnant water are filmed from two directions in order to derive detailed information on their mo...

  6. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  7. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  8. Tunable Omnidirectional Surface Plasmon Resonance in Cylindrical Plasmonic Structure

    Institute of Scientific and Technical Information of China (English)

    WANG Yi; WANG Bing; ZHOU Zhi-Ping

    2008-01-01

    @@ The tunable omnidirectional surface plasmon resonance in the optical range is theoretically demonstrated in a cylindrical plasmonic crystal by using rigorous coupled-wave analysis.The cylindrical plasmonic crystal consists of an infinite chain of two-dimensional cylindrical metal-dielectric-dielectric-metal structures.The dispersion relation of the cylindrical plasmonic crystal is obtained by calculating the absorptance as a function of a TM-polarized incident plane wave and its in-plane wave vector.The omnidirectional surface plasmon resonance can be tuned from UV region to visible region by adjusting the thickness of the cylindrical dielectric layers.The absorption spectrum of the infinite chain of nanocylinders is also investigated for comparison.

  9. Jamming of Cylindrical Grains in Featureless Vertical Channels

    Science.gov (United States)

    Baxter, G. William; Barr, Nicholas; Weible, Seth; Friedl, Nicholas

    2013-03-01

    We study jamming of low aspect-ratio cylindrical Delrin grains falling through a featureless vertical channel. With a grain height less than the grain diameter, these grains resemble aspirin tablets, poker chips, or coins. Unidisperse grains are allowed to fall under the influence of gravity through a uniform channel of square cross-section where the channel width is greater than the grain size and constant along the length of the channel. Channel widths are chosen so that no combination of grain heights and diameters is equal to the channel width. Collections of grains sometimes form jams, stable structures in which the grains are supported by the channel walls and not by grains or walls beneath them. The probability of a jam occurring and the jam's strength are influenced by the grain dimensions and channel width. We will present experimental measurements of the jamming probability and jam strength and discuss the relationship of these results to other experiments and theories. Supported by an Undergraduate Research Grant from Penn State Erie, The Behrend College

  10. Jamming of Monodisperse Cylindrical Grains in Featureless Vertical Channels

    Science.gov (United States)

    Friedl, Nicholas; Baxter, G. William

    2014-03-01

    We study jamming of low aspect-ratio cylindrical Delrin grains falling through a featureless vertical channel under the influence of gravity. These grains have an aspect-ratio less than two (H/D aspirin tablets, 35mm film canisters, poker chips, or coins. Monodisperse grains are allowed to fall under the influence of gravity through a uniform channel of square cross-section where the channel width is greater than the grain size and constant along the length of the channel. No combination of grain heights and diameters is equal to the channel width. Collections of grains sometimes form jams, stable structures in which the grains are supported by the channel walls and not by grains or walls beneath them. The probability of a jam occurring and the jam's strength are influenced by the grain dimensions and channel width. We will present experimental measurements of the jamming probability and jam strength and discuss the relationship of these results to other experiments and theories. Supported by an Undergraduate Research Grant from Penn State Erie, The Behrend College.

  11. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  12. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  13. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  14. Converging cylindrical shocks in ideal magnetohydrodynamics

    KAUST Repository

    Pullin, D. I.

    2014-09-01

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then

  15. Converging cylindrical shocks in ideal magnetohydrodynamics

    Science.gov (United States)

    Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, R.

    2014-09-01

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=sqrt{μ _0/p_0} I/(2 π ) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field

  16. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  17. Surface tension and long range corrections of cylindrical interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Bourasseau, E. [CEA/DAM DIF, F-91297 Arpajon Cedex (France); Malfreyt, P. [Université Clermont Auvergne, Université Blaise Pascal, Institut de Chimie de Clermont-Ferrand, BP 10448, F-63000 Clermont-Ferrand (France); Ghoufi, A., E-mail: aziz.ghoufi@univ-rennes1.fr [Institut de Physique de Rennes, UMR 6251 CNRS, Université de Rennes 1, 263 avenue Général Leclerc, 35042 Rennes (France)

    2015-12-21

    The calculation of the surface tension of curved interfaces has been deeply investigated from molecular simulation during this last past decade. Recently, the thermodynamic Test-Area (TA) approach has been extended to the calculation of surface tension of curved interfaces. In the case of the cylindrical vapour-liquid interfaces of water and Lennard-Jones fluids, it was shown that the surface tension was independent of the curvature of the interface. In addition, the surface tension of the cylindrical interface is higher than that of the planar interface. Molecular simulations of cylindrical interfaces have been so far performed (i) by using a shifted potential, (ii) by means of large cutoff without periodic boundary conditions, or (iii) by ignoring the long range corrections to the surface tension due to the difficulty to estimate them. Indeed, unlike the planar interfaces there are no available operational expressions to consider the tail corrections to the surface tension of cylindrical interfaces. We propose here to develop the long range corrections of the surface tension for cylindrical interfaces by using the non-exponential TA (TA2) method. We also extend the formulation of the Mecke-Winkelmann corrections initially developed for planar surfaces to cylindrical interfaces. We complete this study by the calculation of the surface tension of cylindrical surfaces of liquid tin and copper using the embedded atom model potentials.

  18. Functional evolution of quantum cylindrical waves

    CERN Document Server

    Cho, D H J; Cho, Demian H.J.; Varadarajan, Madhavan

    2006-01-01

    Kucha{\\v{r}} showed that the quantum dynamics of (1 polarization) cylindrical wave solutions to vacuum general relativity is determined by that of a free axially-symmetric scalar field along arbitrary axially-symmetric foliations of a fixed flat 2+1 dimensional spacetime. We investigate if such a dynamics can be defined {\\em unitarily} within the standard Fock space quantization of the scalar field. Evolution between two arbitrary slices of an arbitrary foliation of the flat spacetime can be built out of a restricted class of evolutions (and their inverses). The restricted evolution is from an initial flat slice to an arbitrary (in general, curved) slice of the flat spacetime and can be decomposed into (i) `time' evolution in which the spatial Minkowskian coordinates serve as spatial coordinates on the initial and the final slice, followed by (ii) the action of a spatial diffeomorphism of the final slice on the data obtained from (i). We show that although the functional evolution of (i) is unitarily implemen...

  19. Technology Selections for Cylindrical Compact Fabrication

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey A. Phillips

    2010-10-01

    A variety of process approaches are available and have been used historically for manufacture of cylindrical fuel compacts. The jet milling, fluid bed overcoating, and hot press compacting approach being adopted in the U.S. AGR Fuel Development Program for scale-up of the compacting process involves significant paradigm shifts from historical approaches. New methods are being pursued because of distinct advantages in simplicity, yield, and elimination of process mixed waste. Recent advances in jet milling technology allow simplified dry matrix powder preparation. The matrix preparation method is well matched with patented fluid bed powder overcoating technology recently developed for the pharmaceutical industry and directly usable for high density fuel particle matrix overcoating. High density overcoating places fuel particles as close as possible to their final position in the compact and is matched with hot press compacting which fully fluidizes matrix resin to achieve die fill at low compacting pressures and without matrix end caps. Overall the revised methodology provides a simpler process that should provide very high yields, improve homogeneity, further reduce defect fractions, eliminate intermediate grading and QC steps, and allow further increases in fuel packing fractions.

  20. Acoustic transfer admittance of cylindrical cavities

    Science.gov (United States)

    Guianvarc'h, C.; Durocher, J.-N.; Bruneau, M.; Bruneau, A.-M.

    2006-05-01

    The reciprocity calibration method uses two microphones acoustically connected by a coupler, a cylindrical cavity closed at each end by the diaphragms of the transmitting and receiving microphones. The acoustic transfer admittance of the coupler, including the thermal conductivity effect of the fluid, must be modelled precisely to obtain the accurate sensitivity of the microphones from the electrical transfer impedance measurement. It appears that the analytical model quoted in the current standard [International Electrotechnical Commission IEC 61064-2, Measurement Microphones, Part 2: Primary Method for Pressure Calibration of Laboratory Standard Microphones by the Reciprocity Technique, 1992] is not the appropriate one and that it should be revised, as also suggested by a recent EUROMET project report [K. Rasmussen, Datafiles simulating a pressure reciprocity calibration of microphones, EUROMET Project 294 Report PL-13, 2001]. Thus, it is the aim of the paper to investigate analytically the acoustic field inside the coupler, revisiting the assumptions of the earlier work, leading to a coherent description and therefore providing clarity which should facilitate discussion of a possible revised standard.

  1. Cylindrical shell buckling through strain hardening

    Energy Technology Data Exchange (ETDEWEB)

    Bandyopadhyay, K.; Xu, J.; Shteyngart, S. [Brookhaven National Lab., Upton, NY (United States); Gupta, D. [USDOE, Germantown, MD (United States)

    1995-04-01

    Recently, the authors published results of plastic buckling analysis of cylindrical shells. Ideal elastic-plastic material behavior was used for the analysis. Subsequently, the buckling analysis program was continued with the realistic stress-strain relationship of a stainless steel alloy which does not exhibit a clear yield point. The plastic buckling analysis was carried out through the initial stages of strain hardening for various internal pressure values. The computer program BOSOR5 was used for this purpose. Results were compared with those obtained from the idealized elastic-plastic relationship using the offset stress level at 0.2% strain as the yield stress. For moderate hoop stress values, the realistic stress-grain case shows a slight reduction of the buckling strength. But, a substantial gain in the buckling strength is observed as the hoop stress approaches the yield strength. Most importantly, the shell retains a residual strength to carry a small amount of axial compressive load even when the hoop stress has exceeded the offset yield strength.

  2. Modeling the fusion of cylindrical bioink particles in post bioprinting structure formation

    Science.gov (United States)

    McCune, Matt; Shafiee, Ashkan; Forgacs, Gabor; Kosztin, Ioan

    2015-03-01

    Cellular Particle Dynamics (CPD) is an effective computational method to describe the shape evolution and biomechanical relaxation processes in multicellular systems. Thus, CPD is a useful tool to predict the outcome of post-printing structure formation in bioprinting. The predictive power of CPD has been demonstrated for multicellular systems composed of spherical bioink units. Experiments and computer simulations were related through an independently developed theoretical formalism based on continuum mechanics. Here we generalize the CPD formalism to (i) include cylindrical bioink particles often used in specific bioprinting applications, (ii) describe the more realistic experimental situation in which both the length and the volume of the cylindrical bioink units decrease during post-printing structure formation, and (iii) directly connect CPD simulations to the corresponding experiments without the need of the intermediate continuum theory inherently based on simplifying assumptions. Work supported by NSF [PHY-0957914]. Computer time provided by the University of Missouri Bioinformatics Consortium.

  3. Three-Dimensional Exact Free Vibration Analysis of Spherical, Cylindrical, and Flat One-Layered Panels

    Directory of Open Access Journals (Sweden)

    Salvatore Brischetto

    2014-01-01

    equilibrium written in orthogonal curvilinear coordinates for the free vibrations of simply supported structures. These equations consider an exact geometry for shells without simplifications. The main novelty is the possibility of a general formulation for different geometries. The equations written in general orthogonal curvilinear coordinates allow the analysis of spherical shell panels and they automatically degenerate into cylindrical shell panel, cylindrical closed shell, and plate cases. Results are proposed for isotropic and orthotropic structures. An exhaustive overview is given of the vibration modes for a number of thickness ratios, imposed wave numbers, geometries, embedded materials, and angles of orthotropy. These results can also be used as reference solutions to validate two-dimensional models for plates and shells in both analytical and numerical form (e.g., closed solutions, finite element method, differential quadrature method, and global collocation method.

  4. Nonlinear vibration of functionally graded circular cylindrical shells based on improved Donnell equations

    Science.gov (United States)

    Bich, Dao Huy; Xuan Nguyen, Nguyen

    2012-12-01

    In the present work, the study of the nonlinear vibration of a functionally graded cylindrical shell subjected to axial and transverse mechanical loads is presented. Material properties are graded in the thickness direction of the shell according to a simple power law distribution in terms of volume fractions of the material constituents. Governing equations are derived using improved Donnell shell theory ignoring the shallowness of cylindrical shells and kinematic nonlinearity is taken into consideration. One-term approximate solution is assumed to satisfy simply supported boundary conditions. The Galerkin method, the Volmir's assumption and fourth-order Runge-Kutta method are used for dynamical analysis of shells to give explicit expressions of natural frequencies, nonlinear frequency-amplitude relation and nonlinear dynamic responses. Numerical results show the effects of characteristics of functionally graded materials, pre-loaded axial compression and dimensional ratios on the dynamical behavior of shells. The proposed results are validated by comparing with those in the literature.

  5. Stability of cylindrical shells with initial imperfections under the action of external pressure

    Science.gov (United States)

    Lopanitsyn, E. A.; Matveev, E. A.

    2011-04-01

    We use the equations of nonlinear theory of shallow shells to solve the problem of stability of thin elastic isotropic cylindrical shells, with small initial shape imperfections, that are under the action of external uniform pressure. The problem solution is constructed by the Rayleigh-Ritz method with the approximation of the shell midsurface displacement by double functional sums in trigonometric and beam functions. The system of nonlinear algebraic equations is solved by using the methods of continuation with respect to a close-to-best parameter. For the initial imperfections of the shells, we use their normalized deflections from the limit points of overcritical branches of the loading trajectories. We consider various cases of the shell fixation and support under loading by lateral and hydrostatic uniform pressure. We also construct the range of values of the critical pressure, which, with the maximal deviation of the shell shape from the cylindrical shape up to 30%, covers practically all known experimental data.

  6. A frameless, cylindrically shaped, multiwire proportional chamber using charge division readout

    CERN Document Server

    Fainberg, A; Linscott, I; Moneti, G

    1977-01-01

    PWCs have been constructed in the shape of cylindrical quandrants, placed them around the bicone in an experiment at the CERN ISR, and operated them in a charge division mode to obtain two dimensional position information. A pair of PWCs share a cylindrical styrofoam shell as the basic support member, and contain approximately 0.008 radiation lengths of material. The observed charge division resolution is delta x/L approximately 0.5% in reasonable agreement with an expected resolution of approximately 0.3% due primarily to digitization noise. Reduction of digitization noise is limited by available dynamic range of the electronics and the width of the pulse height distributions. A method is described, using X-rays from /sup 55 /Fe strip sources for calibrating the electronics, which is sufficiently accurate to match the observed resolution. (13 refs).

  7. Free vibration analysis of functionally graded nanocomposite cylindrical panel reinforced by carbon nanotube

    Directory of Open Access Journals (Sweden)

    J. E. Jam

    2013-09-01

    Full Text Available In this study, based on the three-dimensional theory of elasticity, free vibration characteristics of nanocomposite cylindrical panels reinforced by single-walled carbon nanotubes are considered. The carbon nanotube reinforced (CNTRC cylindrical panels have smooth variation of carbon nanotube (CNT fraction in the radial direction and the material properties are estimated by the extended rule of mixture. Suitable displacement functions that identically satisfy the boundary conditions at the simply supported edges are used to reduce the equilibrium equations to a set of coupled ordinary differential equations with variable coefficients, which can be solved by a generalized differential quadrature (GDQ method. The results show that the kind of distribution and volume fraction of CNT have a significant effect on the normalized natural frequency.

  8. Magneto-Rayleigh-Taylor, Sausage And Kink Mode In Cylindrical Liners

    Science.gov (United States)

    Lau, Y. Y.; Zhang, Peng; Weis, Matthew; Gilgenbach, Ronald; Hess, Mark; Peterson, Kyle

    2014-10-01

    This paper analyzes the coupling of magneto-Rayleigh-Taylor (MRT), sausage (azimuthal mode number m = 0) and kink mode (m = 1) in an imploding cylindrical liner, using ideal MHD. A uniform axial magnetic field of arbitrary value is included in each region: liner, its interior, and its exterior. The dispersion relation, the feedthrough factor, and the temporal evolution of perturbations were solved exactly, for arbitrary values of g (= gravity), k (= axial wavenumber), m, aspect ratio, and equilibrium quantities in each region. For small k, a positive g (inward radial acceleration in the lab frame) tends to stabilize the sausage mode, but destabilize the kink mode. For large k, a positive g destabilizes both the kink and sausage mode. This analysis might shed lights into some puzzling features in Harris' classic paper, and in the recent cylindrical liner experiments on MRT. M. R. Weis was supported by the Sandia National Laboratories.

  9. Buckling localization in a cylindrical panel under axial compression

    DEFF Research Database (Denmark)

    Tvergaard, Viggo; Needleman, A.

    2000-01-01

    Localization of an initially periodic buckling pattern is investigated for an axially compressed elastic-plastic cylindrical panel of the type occurring between axial stiffeners on cylindrical shells. The phenomenon of buckling localization and its analogy with plastic flow localization in tensile...... test specimens is discussed in general. For the cylindrical panel, it is shown that buckling localization develops shortly after a maximum load has been attained, and this occurs for a purely elastic panel as well as for elastic-plastic panels. In a case where localization occurs after a load maximum...

  10. Electromagnetic Cylindrical Transparent Devices with Irregular Cross Section

    Directory of Open Access Journals (Sweden)

    C. Yang

    2010-04-01

    Full Text Available Electromagnetic transparent device is very important for antenna protection. In this paper, the material parameters for the cylindrical transparent devices with arbitrary cross section are developed based on the coordinate transformation. The equivalent two-dimensional (2D transparent devices under TE plane and cylindrical wave irradiation is designed and studied by full-wave simulation, respectively. It shows that although the incident waves are distorted in the transformation region apparently, they return to the original wavefronts when passing through the device. All theoretical and numerical results validate the material parameters for the cylindrical transparent devices with arbitrary cross section we developed.

  11. New cylindrical gravitational soliton waves and gravitational Faraday rotation

    CERN Document Server

    Tomizawa, Shinya

    2013-01-01

    In terms of gravitational solitons, we study gravitational non-linear effects of gravitational solitary waves such as Faraday rotation. Applying the Pomeransky's procedure for inverse scattering method, which has been recently used for constructing stationary black hole solutions in five dimensions to a cylindrical spacetime in four dimensions, we construct a new cylindrically symmetric soliton solution. This is the first example to be applied to the cylindrically symmetric case. In particular, we clarify the difference from the Tomimatsu's single soliton solution, which was constructed by the Belinsky-Zakharov's procedure.

  12. γ-ray self-absorption of cylindrical fissile material

    Institute of Scientific and Technical Information of China (English)

    HUANG Yong-Yi; CHENG Yi-Ying; TIAN Dong-Feng; LU Fu-Quan; YANG Fu-Jia

    2005-01-01

    The self-absorption of γ-ray emitted from cylindrical fissile materials, such as 235U and 239Pu, does not possess spherical symmetry. The analytical formulae of self-absorption for γ-ray throughout the cylinder have been obtained. The intensity of γ-ray is a function of γ-ray outgoing directions and cylindrical configurations, accordingly one can acquire the information about geometrical configuration of cylindrical fissile materials through multi-location measurements. Further more, the method is given in this article. The result can be applied to the fissile material safeguard, such as nuclear monitoring and verifying.

  13. Plasmonic Bloch oscillations in cylindrical metal-dielectric waveguide arrays.

    Science.gov (United States)

    Shiu, Ruei-Cheng; Lan, Yung-Chiang; Chen, Chin-Min

    2010-12-01

    This study investigates plasmonic Bloch oscillations (PBOs) in cylindrical metal-dielectric waveguide arrays (MDWAs) by performing numerical simulations and theoretical analyses. Optical conformal mapping is used to transform cylindrical MDWAs into equivalent chirped structures with permittivity and permeability gradients across the waveguide arrays, which is caused by the curvature of the cylindrical waveguide. The PBOs are attributed to the transformed structure. The period of oscillation increases with the wavelength of the incident Gaussian beam. However, the amplitude of oscillation is almost independent of wavelength.

  14. Cylindrical array luminescent solar concentrators: performance boosts by geometric effects.

    Science.gov (United States)

    Videira, Jose J H; Bilotti, Emiliano; Chatten, Amanda J

    2016-07-11

    This paper presents an investigation of the geometric effects within a cylindrical array luminescent solar concentrator (LSC). Photon concentration of a cylindrical LSC increases linearly with cylinder length up to 2 metres. Raytrace modelling on the shading effects of circles on their neighbours demonstrates effective incident light trapping in a cylindrical LSC array at angles of incidence between 60-70 degrees. Raytrace modelling with real-world lighting conditions shows optical efficiency boosts when the suns angle of incidence is within this angle range. On certain days, 2 separate times of peak optical efficiency can be attained over the course of sunrise-solar noon.

  15. Nonlinear damping calculation in cylindrical gear dynamic modeling

    Science.gov (United States)

    Guilbault, Raynald; Lalonde, Sébastien; Thomas, Marc

    2012-04-01

    The nonlinear dynamic problem posed by cylindrical gear systems has been extensively covered in the literature. Nonetheless, a significant proportion of the mechanisms involved in damping generation remains to be investigated and described. The main objective of this study is to contribute to this task. Overall, damping is assumed to consist of three sources: surrounding element contribution, hysteresis of the teeth, and oil squeeze damping. The first two contributions are considered to be commensurate with the supported load; for its part however, squeeze damping is formulated using expressions developed from the Reynolds equation. A lubricated impact analysis between the teeth is introduced in this study for the minimum film thickness calculation during contact losses. The dynamic transmission error (DTE) obtained from the final model showed close agreement with experimental measurements available in the literature. The nonlinear damping ratio calculated at different mesh frequencies and torque amplitudes presented average values between 5.3 percent and 8 percent, which is comparable to the constant 8 percent ratio used in published numerical simulations of an equivalent gear pair. A close analysis of the oil squeeze damping evidenced the inverse relationship between this damping effect and the applied load.

  16. A mean curvature estimate for cylindrically bounded submanifolds

    CERN Document Server

    Alias, Luis J

    2010-01-01

    We extend the estimate obtained in [1] for the mean curvature of a cylindrically bounded proper submanifold in a product manifold with an Euclidean space as one factor to a general product ambient space endowed with a warped product structure.

  17. Cylindrical invisibility cloak with simplified material parameters is inherently visible.

    Science.gov (United States)

    Yan, Min; Ruan, Zhichao; Qiu, Min

    2007-12-07

    It was proposed that perfect invisibility cloaks can be constructed for hiding objects from electromagnetic illumination [J. B. Pendry, D. Schurig, and D. R. Smith, Science 312, 1780 (2006)10.1126/science.1125907]. The cylindrical cloaks experimentally demonstrated [D. Schurig, Science 314, 977 (2006)10.1126/science.1133628] and theoretically proposed [W. Cai, Nat. Photon. 1, 224 (2007)10.1038/nphoton.2007.28] have however simplified material parameters in order to facilitate easier realization as well as to avoid infinities in optical constants. Here we show that the cylindrical cloaks with simplified material parameters inherently allow the zeroth-order cylindrical wave to pass through the cloak as if the cloak is made of a homogeneous isotropic medium, and thus visible. To all high-order cylindrical waves, our numerical simulation suggests that the simplified cloak inherits some properties of the ideal cloak, but finite scatterings exist.

  18. Response of an electrostatic probe for a right cylindrical spacer

    DEFF Research Database (Denmark)

    Rerup, T; Crichton, George C; McAllister, Iain Wilson

    1994-01-01

    During the last decade many experimental studies of surface charge phenomena have been undertaken employing right cylindrical spacers. Measurement of the surface charge was performed using small electrostatic field probes to scan across the dielectric surface. Charges are electrostatically induced...

  19. Cylindrically symmetric Einstein-Yang-Mills-Higgs gauge configurations.

    Science.gov (United States)

    Mondaini, R. P.

    1985-02-01

    Two solutions are obtained for coupled Einstein-Yang-Mills-Higgs fields with cylindrical symmetry and rigid rotation. The Higgs fields are responsible for the creation of singularities and infinite energy densities at the cylinder's axis.

  20. DETERMINATION OF ECONOMIC SIZES FOR RC CYLINDRICAL WATER STORAGE TANKS

    Directory of Open Access Journals (Sweden)

    Güneş KOZLUCA

    2007-03-01

    Full Text Available Water storage tanks are built in different shapes and sizes according to needs. Designs of water storage tanks with low costs are quite important for the national economy. Cylindrical and sphere tanks are the most economic types of tanks in terms of material cost. In this study several cylindrical tank designs are made. Then most economic tank radius – tank height ratio is searched by simply changing thickness, height and the radius of the tank considered. Storage capacity of these cylindrical tanks are all the same. All these reinforced tanks have cylindrical reinforced concrete walls fixed at the bottom and free top edge without roof. It is thought that tanks constructed with this optimal ratio will be beneficial.

  1. External Cylindrical Nozzle with Controlled Vacuum

    Directory of Open Access Journals (Sweden)

    V. N. Pil'gunov

    2015-01-01

    Full Text Available There is a developed design of the external cylindrical nozzle with a vacuum camera. The paper studies the nozzle controllability of flow rate via regulated connection of the evacuated chamber to the atmosphere through an air throttle. Working capacity of the nozzle with inlet round or triangular orifice are researched. The gap is provided in the nozzle design between the external wall of the inlet orifice and the end face of the straight case in the nozzle case. The presented mathematical model of the nozzle with the evacuated chamber allows us to estimate the expected vacuum amount in the compressed section of a stream and maximum permissible absolute pressure at the inlet orifice. The paper gives experimental characteristics of the fluid flow process through the nozzle for different values of internal diameter of a straight case and an extent of its end face remoteness from an external wall of the inlet orifice. It estimates how geometry of nozzle constructive elements influences on the volume flow rate. It is established that the nozzle capacity significantly depends on the shape of inlet orifice. Triangular orifice nozzles steadily work in the mode of completely filled flow area of the straight case at much more amounts of the limit pressure of the flow. Vacuum depth in the evacuated chamber also depends on the shape of inlet orifice: the greatest vacuum is reached in a nozzle with the triangular orifice which 1.5 times exceeds the greatest vacuum with the round orifice. Possibility to control nozzle capacity through the regulated connection of the evacuated chamber to the atmosphere was experimentally estimated, thus depth of flow rate regulation of the nozzle with a triangular orifice was 45% in comparison with 10% regulation depth of the nozzle with a round orifice. Depth of regulation calculated by a mathematical model appeared to be much more. The paper presents experimental dependences of the flow coefficients of nozzle input orifice

  2. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  3. Improved Analysis Techniques for Cylindrical and Spherical Double Probes (Preprint)

    Science.gov (United States)

    2012-03-21

    accounts for the finite, but non -negligible extent of the plasma sheath. One of the most extensive assessments of ion collection by a biased cylindrical...Approved for public release; distribution unlimited. 4 regardless of rP/λD so long as the electron distribution function is Maxwellian such that...731. 3 J.G. Laframboise, Theory of Spherical and Cylindrical Langmuir Probes in a Collisionless, Maxwellian Plasma at Rest, (University of Toronto

  4. An Approximate Solution for Spherical and Cylindrical Piston Problem

    Indian Academy of Sciences (India)

    S K Singh; V P Singh

    2000-02-01

    A new theory of shock dynamics (NTSD) has been derived in the form of a finite number of compatibility conditions along shock rays. It has been used to study the growth and decay of shock strengths for spherical and cylindrical pistons starting from a non-zero velocity. Further a weak shock theory has been derived using a simple perturbation method which admits an exact solution and also agrees with the classical decay laws for weak spherical and cylindrical shocks.

  5. On elliptic cylindrical Kadomtsev-Petviashvili equation for surface waves

    CERN Document Server

    Khusnutdinova, K R; Matveev, V B; Smirnov, A O

    2012-01-01

    The `elliptic cylindrical Kadomtsev-Petviashvili equation' is derived for surface gravity waves with nearly-elliptic front, generalising the cylindrical KP equation for nearly-concentric waves. We discuss transformations between the derived equation and two existing versions of the KP equation, for nearly-plane and nearly-concentric waves. The transformations are used to construct important classes of exact solutions of the derived equation and corresponding approximate solutions for surface waves.

  6. Cylindrical bubbles and blobs from a Class II Hydrophobin

    Science.gov (United States)

    Russo, Paul; Pham, Michael; Blalock, Brad

    2012-02-01

    Cerato ulmin is a class II hydrophobin. In aqueous suspensions, it easily forms cylindrical air bubbles and cylindrical oil blobs. The conditions for formation of these unusual structures will be discussed, along with scattering and microscopic investigations of their remarkable stability. Possible applications in diverse fields including polymer synthesis and oil spill remediation will be considered. Acknowledgment is made to Dr. Wayne C. Richards of the Canadian Forest Service for the gift of Cerato ulmin.

  7. Hysteretic ac losses in a superconductor strip between flat magnetic shields

    Energy Technology Data Exchange (ETDEWEB)

    Genenko, Y A; Rauh, H, E-mail: hera@tgm.tu-darmstadt.d [Institut fuer Materialwissenschaft, Technische Universitaet Darmstadt, 64287 Darmstadt (Germany)

    2010-07-15

    Hysteretic ac losses in a thin, current-carrying superconductor strip located between two flat magnetic shields of infinite permeability are calculated using Bean's model of the critical state. Exact numerical calculations and approximate analytical forms delineating the penetration of magnetic flux and the energy dissipated during a cycle of the ac transport current, per unit length of the strip, are derived. For the shields oriented parallel to the plane of the strip, the penetration of the self-induced magnetic field is found to be enhanced, with the analytical current dependence of the ac loss conditionally resembling that of an isolated superconductor slab; for the shields oriented perpendicular to the plane of the strip, the penetration of the self-induced magnetic field is found to be impaired, with the analytical current dependence of the ac loss conditionally duplicating that of a regular set of curved superconducting tapes extending longitudinally around a surface of cylindrical shape. Thus, hysteretic ac losses can strongly augment or, respectively, wane when the shields approach the strip.

  8. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  9. Theory and modeling of cylindrical thermo-acoustic transduction

    Energy Technology Data Exchange (ETDEWEB)

    Tong, Lihong, E-mail: lhtong@ecjtu.edu.cn [School of Civil Engineering and Architecture, East China Jiaotong University, Nanchang, Jiangxi (China); Lim, C.W. [Department of Architecture and Civil Engineering, City University of Hong Kong, Kowloon, Hong Kong SAR (China); Zhao, Xiushao; Geng, Daxing [School of Civil Engineering and Architecture, East China Jiaotong University, Nanchang, Jiangxi (China)

    2016-06-03

    Models both for solid and thinfilm-solid cylindrical thermo-acoustic transductions are proposed and the corresponding acoustic pressure solutions are obtained. The acoustic pressure for an individual carbon nanotube (CNT) as a function of input power is investigated analytically and it is verified by comparing with the published experimental data. Further numerical analysis on the acoustic pressure response and characteristics for varying input frequency and distance are also examined both for solid and thinfilm-solid cylindrical thermo-acoustic transductions. Through detailed theoretical and numerical studies on the acoustic pressure solution for thinfilm-solid cylindrical transduction, it is concluded that a solid with smaller thermal conductivity favors to improve the acoustic performance. In general, the proposed models are applicable to a variety of cylindrical thermo-acoustic devices performing in different gaseous media. - Highlights: • Theory and modeling both for solid and thinfilm-solid cylindrical thermo-acoustic transductions are proposed. • The modeling is verified by comparing with the published experimental data. • Acoustic response characteristics of cylindrical thermo-acoustic transductions are predicted by the proposed model.

  10. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  11. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  12. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  14. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  15. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  16. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  17. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  18. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  19. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  20. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  1. Influence of magnetic fields on hysteretic ac losses in bulk MgB{sub 2} superconductor investigated by using Hall probe ac susceptibility method

    Energy Technology Data Exchange (ETDEWEB)

    Varilci, A [Faculty of Arts and Sciences, Department of Physics, Abant Izzet Baysal University, 14280 Bolu (Turkey)

    2007-04-15

    We report the results of an investigation of the influence of magnetic fields on hysteretic ac losses in bulk MgB{sub 2} superconductor by using Hall probe ac susceptibility. The external magnetic field in this study had an ac part with frequency 10 Hz and magnitude in the range 240-1200 A m{sup -1} and no dc part. We have measured the imaginary part of the magnetic susceptibility and analysed data by using Bean's critical state model of cylindrical geometry for four different temperature values 39.55, 39.51, 39.47 and 39.41 K. The result of this analysis indicates that Bean's model is adequate to explain the experimental findings. Calculated hysteretic ac loss versus applied magnetic field curve is given by using the critical state model. We have also measured the magnetization versus applied magnetic field and determined the first critical magnetic field of a MgB{sub 2} sample as 500 A m{sup -1} at 35 K.

  2. Abatement of Perfluorinated Compounds Using Cylindrical Microwave Plasma Source at Low Pressure

    Science.gov (United States)

    Kim, Seong Bong; Park, S.; Park, Y.; Youn, S.; Yoo, S. J.

    2016-10-01

    Microwave plasma source with a cylindrical cavity has been proposed to abate the perfluorinated compounds (PFCs). This plasma source was designed to generate microwave plasma with the cylindrical shape and to be easily installed in existing exhaust line. The microwave frequency is 2.45 GHz and the operating pressure range is 0.1 Torr to 0.3 Torr. The plasma characteristic of the cylindrical microwave plasma source was measured using the optical spectrometer, and tunable diode laser absorption spectroscopy (TDLAS). The destruction and removal efficiency (DRE) of CF4 and CHF3 were measured by a quadrupole mass spectroscopy (QMS) with the various operation conditions. The effect of the addition of the oxygen gas were tested and also the correlation between the plasma parameters and the DRE are presented in this study. This work was supported by R&D Program of ``Plasma Advanced Technology for Agriculture and Food (Plasma Farming)'' through the National Fusion Research Institute of Korea (NFRI) funded by the Government funds.

  3. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  4. Research on Cylindrical Surface Wave Plasma Fluorescent Lamps

    Directory of Open Access Journals (Sweden)

    Kun WANG

    2013-07-01

    Full Text Available This paper presents an application of the well known SPWM technique on a voltage stabilizer, using a microcontroller. The stabilizer is AC/DC/AC type. So, the system rectifies the input AC voltage to a suitable DC level and the intelligent control of an embedded microcontroller regulates the pulse width of the output voltage in order to produce through a filter a perfect sinusoidal AC voltage. The control program on the microcontroller has the ability to change the FET transistor firing in order to compensate any input voltage variation. The applied software using the microcontroller’s interrupts managed to achieve concurrency on the running program.

  5. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  6. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  7. A cylindrical specimen holder for electron cryo-tomography

    Energy Technology Data Exchange (ETDEWEB)

    Palmer, Colin M., E-mail: cpalmer@mrc-lmb.cam.ac.uk; Löwe, Jan, E-mail: jyl@mrc-lmb.cam.ac.uk

    2014-02-01

    The use of slab-like flat specimens for electron cryo-tomography restricts the range of viewing angles that can be used. This leads to the “missing wedge” problem, which causes artefacts and anisotropic resolution in reconstructed tomograms. Cylindrical specimens provide a way to eliminate the problem, since they allow imaging from a full range of viewing angles around the tilt axis. Such specimens have been used before for tomography of radiation-insensitive samples at room temperature, but never for frozen-hydrated specimens. Here, we demonstrate the use of thin-walled carbon tubes as specimen holders, allowing the preparation of cylindrical frozen-hydrated samples of ribosomes, liposomes and whole bacterial cells. Images acquired from these cylinders have equal quality at all viewing angles, and the accessible tilt range is restricted only by the physical limits of the microscope. Tomographic reconstructions of these specimens demonstrate that the effects of the missing wedge are substantially reduced, and could be completely eliminated if a full tilt range was used. The overall quality of these tomograms is still lower than that obtained by existing methods, but improvements are likely in future. - Highlights: • The missing wedge is a serious problem for electron cryo-tomography. • Cylindrical specimens allow the missing wedge to be eliminated. • Carbon nanopipettes can be used as cylindrical holders for tomography of frozen-hydrated specimens. • Cryo-tomography of cylindrical biological samples demonstrates a reduction of deleterious effects associated with the missing wedge.

  8. Novel spherical hohlraum with cylindrical laser entrance holes and shields

    Energy Technology Data Exchange (ETDEWEB)

    Lan, Ke [Institute of Applied Physics and Computational Mathematics, Beijing 100088 (China); Center for Applied Physics and Technology, Peking University, Beijing 100871 (China); Zheng, Wudi [Institute of Applied Physics and Computational Mathematics, Beijing 100088 (China)

    2014-09-15

    Our recent works [K. Lan et al., Phys. Plasmas 21, 010704 (2014); K. Lan et al., Phys. Plasmas 21, 052704 (2014)] have shown that the octahedral spherical hohlraums are superior to the cylindrical hohlraums in both higher symmetry during the capsule implosion and lower backscatter without supplementary technology. However, both the coupling efficiency from the drive laser energy to the capsule and the capsule symmetry decrease remarkably when larger laser entrance holes (LEHs) are used. In addition, the laser beams injected at angles > 45° transport close to the hohlraum wall, thus the wall blowoff causes the LEH to close faster and results in strong laser plasma interactions inside the spherical hohlraums. In this letter, we propose a novel octahedral hohlraum with LEH shields and cylindrical LEHs to alleviate these problems. From our theoretical study, with the LEH shields, the laser coupling efficiency is significantly increased and the capsule symmetry is remarkably improved in the spherical hohlraums. The cylindrical LEHs take advantage of the cylindrical hohlraum near the LEH and mitigate the influence of the blowoff on laser transport inside a spherical hohlraum. The cylindrical LEHs can also be applied to the rugby and elliptical hohlraums.

  9. Generation of highly symmetric, cylindrically convergent shockwaves in water

    Science.gov (United States)

    Bland, S. N.; Krasik, Ya. E.; Yanuka, D.; Gardner, R.; MacDonald, J.; Virozub, A.; Efimov, S.; Gleizer, S.; Chaturvedi, N.

    2017-08-01

    We report on pulsed power driven, exploding copper wire array experiments conducted to generate cylindrical convergent shockwaves in water employing μs risetime currents >550 kA in amplitude and with stored energies of >15 kJ—a substantial increase over previous results. The experiments were carried out on the recently constructed Mega-Ampere-Compression-and-Hydrodynamics facility at Imperial College London in collaboration with colleagues of Technion, Israel. 10 mm diameter arrays consisting of 60 × 130 μm wires were utilized, and the current and voltage diagnostics of the load region suggested that ˜8 kJ of energy was deposited in the wires (and the load region close to the wires) during the experiments, resulting in the formation of dense, highly resistive plasmas that rapidly expanded driving the shockwaves in water. Laser-backlit framing images of the shockfront were obtained at radii 50:1. Framing images and streak photographs showed that the velocity of the shockwave reached ˜7.5 km s-1 at 0.1 mm from the axis. 2D hydrodynamic simulations that match the experimentally obtained implosion trajectory suggest that pressures >1 Mbar are produced within 10 μm of the axis along with water densities of 3gcm-3 and temperatures of many 1000 s of Kelvin. Under these conditions, Quotidian Equation of State suggests that a strongly coupled plasma with an ionization fraction of ˜0.7 would be formed. The results represent a "stepping stone" in the application of the technique to drive different material samples into high pressure, warm dense matter regimes with compact, university scale generators, and provide support in scaling the technique to multi-mega ampere currents.

  10. Buckling of un—stiffened cylindrical shell under non—uniform axial compressive stress

    Institute of Scientific and Technical Information of China (English)

    宋昌永

    2002-01-01

    This paper provides a review of recent research advances and trends in the area of stability of unstiffened circular cylindrical shells subjected to general non-uniform axial compressive stresses.Only the more important and interesting aspects of the research,judged from a personal viewpoint,are discussed.They can be crudely classified into four categories:(1) shells subjected to non-uniform loads;(2) shells on discrete supports;(3) shells with intended cutouts/holes;and (4) shells with non-uniform settlements.

  11. Propagation of the initial value perturbation in a cylindrical lined duct carrying a gas flow

    Directory of Open Access Journals (Sweden)

    Agneta M. BALINT

    2013-03-01

    Full Text Available For the homogeneous Euler equation linearized around a non-slipping mean flow andboundary conditions corresponding to the mass-spring-damper impedance, smooth initial dataperturbations with compact support are considered. The propagation of this type of initial dataperturbations in a straight cylindrical lined duct is investigated. Such kind of investigations is missingin the existing literature. The mathematical tools are the Fourier transform with respect to the axialspatial variable and the Laplace transform with respect to the time variable. The functionalframework and sufficient conditions are researched that the so problem be well-posed in the sense ofHadamard and the Briggs-Bers stability criteria can be applied.

  12. Buckling of un-stiffened cylindrical shell under non-uniform axial conpressive stress

    Institute of Scientific and Technical Information of China (English)

    宋昌永

    2002-01-01

    This paper provides a review of recent research advances and trends in the area of stability of un-stiffened circular cylindrical shells subjected to general non-uniform axial compressive stresses. Only the more important and interesting aspects of the research, judged from a personal viewpoint, are discussed. They can be crudely classified into four categories: (1) shells subjected to non-uniform loads; (2) shells on discrete supports; (3) shells with intended cutouts/holes; and (4) shells with non-uniform settlements.

  13. Buckling analysis of stringer-stiffened laminated cylindrical shells with nonuniform eccentricity

    Energy Technology Data Exchange (ETDEWEB)

    Sadeghifar, M. [Islamic Azad University, Department of Mechanical Engineering, Nowshahr Branch, Nowshahr (Iran, Islamic Republic of); Bagheri, M. [Sattari Air University, Faculty of Aerospace Engineering, Tehran (Iran, Islamic Republic of); Jafari, A.A. [K.N. Toosi University of Technology, Faculty of Mechanical Engineering, Tehran (Iran, Islamic Republic of)

    2011-07-15

    In this study, the influence of nonuniformity of eccentricity of stringers on the general axial buckling load of stiffened laminated cylindrical shells with simply supported end conditions is investigated. The critical loads are calculated using Love's First-order Shear Deformation Theory and solved using the Rayleigh-Ritz procedure. The effects of the shell length-to-radius ratio, shell thickness-to-radius ratio, number of stringers, and stringers depth-to-width ratio on the buckling load of nonuniformly eccentric shells, are examined. The research demonstrates that an appropriate nonuniform distribution of eccentricity of stringers leads the buckling load to increase significantly. (orig.)

  14. Backward Surface Wave Propagation and Radiation along a One-Dimensional Folded Cylindrical Helix Array

    Directory of Open Access Journals (Sweden)

    Bin Xu

    2015-01-01

    Full Text Available Wave propagation along a closely spaced folded cylindrical helix (FCH array is investigated for the purpose of designing compact array for energy transport and antenna radiation. It is found that the height of this surface wave guiding structure can be decreased from 0.24λ0 to 0.06λ0 by replacing the monopole element with the FCH. Both the propagation constant and the mode distribution of the dominant wave mechanism are extracted by ESPRIT algorithm, which indicates that a backward propagating surface wave is supported by the array structure. A compact backfire FCH antenna array is designed and measured based on the identified dominant wave mechanism.

  15. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  16. Determination of the Boltzmann Constant Using the Differential - Cylindrical Procedure

    CERN Document Server

    Feng, X J; Lin, H; Gillis, K A; Moldover, M R

    2015-01-01

    We report in this paper the progresses on the determination of the Boltzmann constant using the acoustic gas thermometer (AGT) of fixed-length cylindrical cavities. First, we present the comparison of the molar masses of pure argon gases through comparing speeds of sound of gases. The procedure is independent from the methodology by Gas Chromatography-Mass Spectrometry (GC-MS). The experimental results show good agreement between both methods. The comparison offers an independent inspection of the analytical results by GC-MS. Second, we present the principle of the novel differential-cylindrical procedure based on the AGT of two fixed-length cavities. The deletion mechanism for some major perturbations is analyzed for the new procedure. The experimental results of the differential-cylindrical procedure demonstrate some major improvements on the first, second acoustic and third virial coefficients, and the excess half-widths. The three acoustic virial coefficients agree well with the stated-of-the-art experime...

  17. Experiments of cylindrical isentropic compression by ultrahigh magnetic field

    Directory of Open Access Journals (Sweden)

    Gu Zhuowei

    2015-01-01

    Full Text Available The high Explosive Magnetic Flux Implosion Compression Generator (EMFICG is a kind of unique high energy density dynamic technique with characters like ultrahigh pressure and low temperature rising and could be suitable as a tool of cylindrical isentropic compression. The Institute of Fluid Physics, Chinese Academy of Engineering Physics (IFP, CAEP have developed EMFICG technique and realized cylindrical isentropic compression. In the experiments, a seed magnetic field of 5–6 Tesla were built first and compressed by a stainless steel liner which is driven by high explosive. The inner free surface velocity of sample was measured by PDV. The isentropic compression of a copper sample was verified and the isentropic pressure is over 100 GPa. The cylindrical isentropic compression process has been numerical simulated by 1D MHD code and the simulation results were compared with the experiments. Compared with the transitional X-ray flash radiograph measurement, this method will probably promote the data accuracy.

  18. Encoding high-order cylindrically polarized light beams.

    Science.gov (United States)

    Moreno, Ignacio; Davis, Jeffrey A; Cottrell, Don M; Donoso, Ramiro

    2014-08-20

    In this work we present a setup for the experimental production of cylindrically polarized beams, as well as other variations of polarized light beams. The optical system uses a single transmissive phase-only spatial light modulator, which is used to apply different spatial phase modulation to two output collinear R and L circularly polarized components. Different cylindrically polarized light beams can be obtained by applying different phase shifts to these two circularly polarized components. The system is very efficient since modulation is directly applied to the light beam (as opposed to other common methods operating in the first order of encoded diffraction gratings). Different variations to the cylindrically polarized light beams are also reported, obtained by adding linear or quadratic relative phase shifts between the two circular polarization components of the light beam. Experimental results are provided in all cases.

  19. A cylindrical converging shock tube for shock-interface studies.

    Science.gov (United States)

    Luo, Xisheng; Si, Ting; Yang, Jiming; Zhai, Zhigang

    2014-01-01

    A shock tube facility for generating a cylindrical converging shock wave is developed in this work. Based on the shock dynamics theory, a specific wall profile is designed for the test section of the shock tube to transfer a planar shock into a cylindrical one. The shock front in the converging part obtained from experiment presents a perfect circular shape, which proves the feasibility and reliability of the method. The time variations of the shock strength obtained from numerical simulation, experiment, and theoretical estimation show the desired converging effect in the shock tube test section. Particular emphasis is then placed on the problem of shock-interface interaction induced by cylindrical converging shock waves. For this purpose, membrane-less gas cylinder is adopted to form the interface between two different fluids while the laser sheet technique to visualize the flow field. The result shows that it is convenient to perform such experiments in this facility.

  20. POSTBUCKLING OF PRESSURE-LOADED SHEAR DEFORMABLE LAMINATED CYLINDRICAL PANELS

    Institute of Scientific and Technical Information of China (English)

    沈惠申

    2003-01-01

    A postbuckling analysis is presented for a shear deformable laminated cylindrical panel of finite length subjected to lateral pressure. The governing equations are based on Reddy's higher order shear deformation shell theory with yon Kdrmdn-Donnell-type of kinematic nonlinearity. The nonlinear prebuckling deformations and initial geometric imperfections of the panel are both taken into account. A boundary layer theory of shell buckling, which includes the effects of nonlinear prebuckling deformations, large deflections in the postbuckling range, and initial geometric imperfections of the shell, is extended to the case of shear deformable laminated cylindrical panels under lateral pressure. A singular perturbation technique is employed to determine the buckling loads and postbuckling equilibrium paths. The numerical illustrations concern the postbuckling response of perfect and imperfect, moderately thick, cross-ply laminated cylindrical panels. The effects played by transverse shear deformation, panel geometric parameters, total number of plies, fiber orientation, and initial geometric imperfections are studied.

  1. Design of elliptic cylindrical thermal cloak with layered structure

    Science.gov (United States)

    Yuan, Xuebo; Lin, Guochang; Wang, Youshan

    2017-01-01

    Thermal cloak has potential applications in thermal protection and sensing. Based on the theories of spatial transformation and effective medium, layered structure of elliptic cylindrical thermal cloak was designed. According to theoretical analysis and numerical simulation, the layered structure has typical characteristics of perfect thermal cloak. The external temperature field remains unchanged, while the internal temperature gradient decreases obviously. Meanwhile, the cloaking effect is stable in any direction. The cloaking effect can be improved by increasing the number of discretization layers or reducing the cloak thickness. The elliptic cylindrical cloak can be considered as cylindrical cloak when the focal distance is close to zero. This study has provided an effective way for realizing thermal cloak with more complex shapes.

  2. Third-generation cylindrical diffusers for medical use

    Science.gov (United States)

    Lytle, A. Charles; Narciso, Hugh L.; Spain, David V.; Doiron, Daniel R.

    1993-05-01

    Cylindrical light diffusion is a key element in a variety of medical applications which require the controlled administration of light to a treatment site within the body. Applications such as photodynamic therapy (PDT), laser induced hyperthermia (LHT), and photoatherolytic (PAL) therapy may all require that light be diffused in this manner. Cylindrical diffusers are typically used in tubular cavities, such as the bronchus, trachea, or the esophagus, and in interstitial applications where uniform illumination over a specified length is required to maximize the therapeutic response. A third generation of cylindrical diffuser with improved performance has been developed to more effectively meet these needs. This paper will discuss the evolution of cylinder diffusers and will describe the characteristics and performance of this new generation device.

  3. Radiation and scattering from printed antennas on cylindrically conformal platforms

    Science.gov (United States)

    Kempel, Leo C.; Volakis, John L.; Bindiganavale, Sunil

    1994-01-01

    The goal was to develop suitable methods and software for the analysis of antennas on cylindrical coated and uncoated platforms. Specifically, the finite element boundary integral and finite element ABC methods were employed successfully and associated software were developed for the analysis and design of wraparound and discrete cavity-backed arrays situated on cylindrical platforms. This work led to the successful implementation of analysis software for such antennas. Developments which played a role in this respect are the efficient implementation of the 3D Green's function for a metallic cylinder, the incorporation of the fast Fourier transform in computing the matrix-vector products executed in the solver of the finite element-boundary integral system, and the development of a new absorbing boundary condition for terminating the finite element mesh on cylindrical surfaces.

  4. Numerical investigation on evolution of cylindrical cellular detonation

    Institute of Scientific and Technical Information of China (English)

    WANG Chun; JIANG Zong-lin; HU Zong-min; HAN Gui-lai

    2008-01-01

    Cylindrical cellular detonation is numerically investigated by solving twodimensional reactive Euler equations with a finite volume method on a two-dimensional self-adaptive unstructured mesh.The one-step reversible chemical reaction model is applied to simplify the control parameters of chemical reaction.Numerical results demonstrate the evolution of cellular cell splitting of cylindrical cellular detonation explored in experimentas.Split of cellular structures shows different features in the near-field and far-field from the initiation zone.Variation of the local curvature is a key factor in the behavior of cell split of cylindrical cellular detonation in propagation.Numerical results show that split of cellular structures comes from the self-organization of transverse waves corresponding to the development of small disturbances along the detonation front related to detonation instability.

  5. Pinching Solutions of Slender Cylindrical Jets

    Science.gov (United States)

    1993-06-01

    NASA Langley Research Center, Hampton, VA 23681.2This research was supported in part by Fondo Nacional de Desarrollo Cientifico y Tecnologico (FONDE...prediction, is the validity of the slender jet assumption and in particular the absence of gradient steepening in the shapes at break-down. 7

  6. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  7. Boundary Conditions in 2D Numerical and 3D Exact Models for Cylindrical Bending Analysis of Functionally Graded Structures

    Directory of Open Access Journals (Sweden)

    F. Tornabene

    2016-01-01

    Full Text Available The cylindrical bending condition for structural models is very common in the literature because it allows an incisive and simple verification of the proposed plate and shell models. In the present paper, 2D numerical approaches (the Generalized Differential Quadrature (GDQ and the finite element (FE methods are compared with an exact 3D shell solution in the case of free vibrations of functionally graded material (FGM plates and shells. The first 18 vibration modes carried out through the 3D exact model are compared with the frequencies obtained via the 2D numerical models. All the 18 frequencies obtained via the 3D exact model are computed when the structures have simply supported boundary conditions for all the edges. If the same boundary conditions are used in the 2D numerical models, some modes are missed. Some of these missed modes can be obtained modifying the boundary conditions imposing free edges through the direction perpendicular to the direction of cylindrical bending. However, some modes cannot be calculated via the 2D numerical models even when the boundary conditions are modified because the cylindrical bending requirements cannot be imposed for numerical solutions in the curvilinear edges by definition. These features are investigated in the present paper for different geometries (plates, cylinders, and cylindrical shells, types of FGM law, lamination sequences, and thickness ratios.

  8. 纵边落地支承单层柱面网壳强震倒塌机理及参数分析%Collapse mechanism and parameter analysis of single-layer cylindrical latticed shell with longitudinal edge supports on ground under severe earthquake

    Institute of Scientific and Technical Information of China (English)

    杨大彬; 张毅刚; 吴金志

    2011-01-01

    采用基于荷载域的全过程分析方法对纵边落地支承单层柱面网壳的强震倒塌机理进行了研究.结果表明,该类型网壳呈现明显的沿跨度方向的单向受力特征,长宽比对其受力几乎没有影响;其强震倒塌具有很强的规律性,破坏类型均为动力强度破坏;矢跨比对能引起其倒塌的PGA有很大影响,但对其发展趋势并无固定的影响规律;屋面质量的增大及初始几何缺陷均会降低该类型柱面网壳的倒塌PGA,其降低程度因柱壳而异.%The collapse mechanism of single-layer cylindrical latticed shell under severe earthquakes is analyzed with full-range responses method based on load domain. Results show that this kind of shell takes on a very distinct one-way mechanical characteristic along the span direction, and its length to span ratio has little influence on its mechanical performance. There is a strong regularity in its collapse behaviour, and all the collapse patterns belong to the dynamic strength failure mode. Its rise to span ratio has a tremendous influence on the collapse PGA, but the influence has no fixed regularity. The collapse PGA will decrease when the roof mass increases or there is initial geometrical imperfection, but the decreased magnitude depends on the shells.

  9. The magnetic properties of the hollow cylindrical ideal remanence magnet

    DEFF Research Database (Denmark)

    Bjørk, Rasmus

    2016-01-01

    We consider the magnetic properties of the hollow cylindrical ideal remanence magnet. This magnet is the cylindrical permanent magnet that generates a uniform field in the cylinder bore, using the least amount of magnetic energy to do so. The remanence distribution of this magnet is derived...... and the generated field is compared to that of a Halbach cylinder of equal dimensions. The ideal remanence magnet is shown in most cases to generate a significantly lower field than the equivalent Halbach cylinder, although the field is generated with higher efficiency. The most efficient Halbach cylinder is shown...... to generate a field exactly twice as large as the equivalent ideal remanence magnet....

  10. Transient impact responses of laminated composite cylindrical shells

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The generalized ray method(GRM) has been successfully used to study the transient elastic wave transmitting in the beams,planar trusses,space frames and infinite layered media.In this letter,the GRM is extended to investigate the early short time transient responses of laminated composite cylindrical shells under impact load.By using the Laplace transformation and referring to the boundary conditions,the ray groups transmitting in the finite laminated cylindrical shells under the shock load are obtained ...

  11. Static Cylindrically Symmetric Interior Solutions in f(R) Gravity

    CERN Document Server

    Sharif, M

    2013-01-01

    We investigate some exact static cylindrically symmetric solutions for a perfect fluid in the metric $f(R)$ theory of gravity. For this purpose, three different families of solutions are explored. We evaluate energy density, pressure, Ricci scalar and functional form of $f(R)$. It is interesting to mention here that two new exact solutions are found from the last approach, one is in particular form and the other is in the general form. The general form gives a complete description of a cylindrical star in $f(R)$ gravity.

  12. Analytic descriptions of cylindrical electromagnetic waves in a nonlinear medium.

    Science.gov (United States)

    Xiong, Hao; Si, Liu-Gang; Yang, Xiaoxue; Wu, Ying

    2015-06-15

    A simple but highly efficient approach for dealing with the problem of cylindrical electromagnetic waves propagation in a nonlinear medium is proposed based on an exact solution proposed recently. We derive an analytical explicit formula, which exhibiting rich interesting nonlinear effects, to describe the propagation of any amount of cylindrical electromagnetic waves in a nonlinear medium. The results obtained by using the present method are accurately concordant with the results of using traditional coupled-wave equations. As an example of application, we discuss how a third wave affects the sum- and difference-frequency generation of two waves propagation in the nonlinear medium.

  13. Ideal cylindrical cloak: perfect but sensitive to tiny perturbations.

    Science.gov (United States)

    Ruan, Zhichao; Yan, Min; Neff, Curtis W; Qiu, Min

    2007-09-14

    A cylindrical wave expansion method is developed to obtain the scattering field for an ideal two-dimensional cylindrical invisibility cloak. A near-ideal model of the invisibility cloak is set up to solve the boundary problem at the inner boundary of the cloak shell. We confirm that a cloak with the ideal material parameters is a perfect invisibility cloak by systematically studying the change of the scattering coefficients from the near-ideal case to the ideal one. However, because of the slow convergence of the zeroth-order scattering coefficients, a tiny perturbation on the cloak would induce a noticeable field scattering and penetration.

  14. Confined and interface phonons in combined cylindrical nanoheterosystem

    Directory of Open Access Journals (Sweden)

    O.M.Makhanets

    2006-01-01

    Full Text Available The spectra of all types of phonons existing in a complicated combined nanoheterosystem consisting of three cylindrical quantum dots embedded into the cylindrical quantum wire placed into vacuum are studied within the dielectric continuum model. It is shown that there are confined optical (LO and interface phonons of two types: top surface optical (TSO and side surface optical (SSO modes of vibration in such a nanosystem. The dependences of phonon energies on the quasiwave numbers and geometrical parameters of quantum dots are investigated and analysed.

  15. Friction Compensation in the Upsetting of Cylindrical Test Specimens

    DEFF Research Database (Denmark)

    Christiansen, Peter; Martins, P. A. F.; Bay, Niels Oluf

    2016-01-01

    This manuscript presents a combined numerical andexperimental methodology for determining the stress-straincurve of metallic materials from the measurements of forceand displacement obtained in the axial compression of cylindrical test specimens with friction between the specimens and the platens...... model or combined friction models are utilized .Experimental results obtained from cylindrical and Rastegaev test specimens with different lubricants combined with the experimental determination of friction by means of ring compression tests allows compensating the effect of friction...... Appendix is provided for those readers interested in utilizing the associated numerical algorithm for determining the stress straincurves of metallic materials....

  16. The magnetic properties of the hollow cylindrical ideal remanence magnet

    CERN Document Server

    Bjørk, R

    2016-01-01

    We consider the magnetic properties of the hollow cylindrical ideal remanence magnet. This magnet is the cylindrical permanent magnet that generates a uniform field in the cylinder bore, using the least amount of magnetic energy to do so. The remanence distribution of this magnet is derived and the generated field is compared to that of a Halbach cylinder of equal dimensions. The ideal remanence magnet is shown in most cases to generate a significantly lower field than the equivalent Halbach cylinder, although the field is generated with higher efficiency. The most efficient Halbach cylinder is shown to generate a field exactly twice as large as the equivalent ideal remanence magnet.

  17. Liquid bridge as a tunable-focus cylindrical liquid lens

    Science.gov (United States)

    Chen, H.; Tabatabaei, N.; Amirfazli, A.

    2017-01-01

    We proposed a method to create a tunable-focus cylindrical liquid lens using a liquid bridge between two narrow surfaces. Due to the surface edge effect, the interface of the liquid bridge (on the long side) was shown to be able to serve as a tunable-focus cylindrical liquid lens. The working distance of the lens can be adjusted by changing either or both of the height of the bridge (H) and the volume of the liquid (V). By varying H and V, the lens can serve as either diverging or converging lens, with a minimum working distance of 2.11 mm.

  18. Simple model of capillary condensation in cylindrical pores

    Science.gov (United States)

    Szybisz, Leszek; Urrutia, Ignacio

    2002-11-01

    A simple model based on an approximation of the dropletlike model is formulated for studying adsorption of fluids into cylindrical pores. This model yields a nearly universal description of capillary condensation transitions for noble gases confined by alkali metals. The system's thermodynamical behavior is predicted from the values of two dimensionless parameters: D* (the reduced asymptotic strength of the fluid-adsorber interaction, a function of temperature) and R* (the reduced radius of the pore). The phenomenon of hysteresis inherently related to capillary condensation is discussed. The connection to a previously proposed universality for cylindrical pores is also established.

  19. Exploring Cylindrical Solutions in Modified f(G) Gravity

    CERN Document Server

    Houndjo, M J S; Momeni, D; Myrzakulov, R

    2013-01-01

    We present cylindrically symmetric solutions for a type of the Gauss-Bonnet gravity, in details. We derive the full system of the field equations and show that there exist seven families of exact solutions for three forms of viable models. By applying the method based on the effective fluid energy momentum tensor components, we evaluate the mass per unit length for the solutions. From dynamical point of the view, by evaluating the null energy condition for these configurations, we show that in some cases the azimuthal pressure breaks the energy condition. This violation of the null energy condition predicts the existence of a cylindrical wormhole.

  20. Metallurgical Evaluation of the Five-Inch Cylindrical Induction Melter

    Energy Technology Data Exchange (ETDEWEB)

    Imrich, K.J.

    2000-08-15

    A metallurgical evaluation of the 5-inch cylindrical induction melter (CIM) vessel was performed by the Materials Technology Section to evaluate the metallurgical condition after operating for approximately 375 hours at 1400 to 1500 Degrees Celsius during a 2 year period. Results indicate that wall thinning and significant grain growth occurred in the lower portion of the conical section and the drain tube. No through-wall penetrations were found in the cylindrical and conical sections of the CIM vessel and only one leak site was identified in the drain tube. Failure of the drain tube was associated with a localized over heating and intercrystalline fracture.

  1. The Levitating Buddha: Constructing a Realistic Cylindrical Mirror Pseudo Image

    Science.gov (United States)

    Caussat, María Alicia; Rabal, Héctor; Muramatsu, Mikiya

    2006-10-01

    There are several interesting experiments involving image formation that can be easily implemented using mirrored foil, a very inexpensive material. When the foil is somewhat bent by holding its opposite edges and slightly pulling them together, cylindrical surfaces are generated. They behave as cylindrical mirrors, and circular or elliptical cross sections can be made. A project that can be easily built with the mirror foil is the generation of a pseudo image that is so compelling in its apparent reality that it can easily be taken to be the object itself.

  2. Nonlinear dynamo action in a precessing cylindrical container.

    Science.gov (United States)

    Nore, C; Léorat, J; Guermond, J-L; Luddens, F

    2011-07-01

    It is numerically demonstrated by means of a magnetohydrodynamics code that precession can trigger the dynamo effect in a cylindrical container. When the Reynolds number, based on the radius of the cylinder and its angular velocity, increases, the flow, which is initially centrosymmetric, loses its stability and bifurcates to a quasiperiodic motion. This unsteady and asymmetric flow is shown to be capable of sustaining dynamo action in the linear and nonlinear regimes. The magnetic field thus generated is unsteady and quadrupolar. These numerical evidences of dynamo action in a precessing cylindrical container may be useful for an experiment now planned at the Dresden sodium facility for dynamo and thermohydraulic studies in Germany.

  3. Optical trapping and optical binding using cylindrical vector beams

    Directory of Open Access Journals (Sweden)

    S. E. Skelton

    2011-09-01

    Full Text Available We report on the use of cylindrical vector beams for optical manipulation of micron and sub-micron sized particles using the methods of a single-beam gradient force trap (optical tweezers and an evanescent-field surface trap (optical binding. We have demonstrated a stable interferometric method for the synthesis of cylindrical vector beams (CVBs, and present measurements demonstrating polarization-controlled focal volume shaping using CVBs in an optical tweezers. Furthermore we show how appropriate combinations of CVBs corresponding to superpositions of optical fibre modes can be used for controlled trapping and trafficking of micro- and nanoparticles along a tapered optical fibre.

  4. Active Constrained Layer Damping of Thin Cylindrical Shells

    Science.gov (United States)

    RAY, M. C.; OH, J.; BAZ, A.

    2001-03-01

    The effectiveness of the active constrained layer damping (ACLD) treatments in enhancing the damping characteristics of thin cylindrical shells is presented. A finite element model (FEM) is developed to describe the dynamic interaction between the shells and the ACLD treatments. Experiments are performed to verify the numerical predictions. The obtained results suggest the potential of the ACLD treatments in controlling the vibration of cylindrical shells which constitute the major building block of many critical structures such as cabins of aircrafts, hulls of submarines and bodies of rockets and missiles.

  5. Analytic descriptions of cylindrical electromagnetic waves in a nonlinear medium

    Science.gov (United States)

    Xiong, Hao; Si, Liu-Gang; Yang, Xiaoxue; Wu, Ying

    2015-01-01

    A simple but highly efficient approach for dealing with the problem of cylindrical electromagnetic waves propagation in a nonlinear medium is proposed based on an exact solution proposed recently. We derive an analytical explicit formula, which exhibiting rich interesting nonlinear effects, to describe the propagation of any amount of cylindrical electromagnetic waves in a nonlinear medium. The results obtained by using the present method are accurately concordant with the results of using traditional coupled-wave equations. As an example of application, we discuss how a third wave affects the sum- and difference-frequency generation of two waves propagation in the nonlinear medium. PMID:26073066

  6. Gravitational collapse of a cylindrical null shell in vacuum

    Directory of Open Access Journals (Sweden)

    S. Khakshournia

    2008-03-01

    Full Text Available   Barrabès-Israel null shell formalism is used to study the gravitational collapse of a thin cylindrical null shell in vacuum. In general the lightlike matter shell whose history coincides with a null hypersurface is characterized by a surface energy density. In addition, a gravitational impulsive wave is present on this null hypersurface whose generators admit both the shear and expansion. In the case of imposing the cylindrical flatness the surface energy-momentum tensor of the matter shell on the null hypersurface vanishes and the null hyper- surface is just the history of the gravitational wave .

  7. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  8. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  9. Efficient Generation of Truncated Bessel Beams using Cylindrical Waveguides

    Science.gov (United States)

    Ilchenko, Vladimir S.; Mohageg, Makan; Savchenkov, Anatoliy A.; Matsko, Andrey B.; Maleki, Lute

    2007-01-01

    In this paper we address efficient conversion between a Gaussian beam (a truncated plane wave) and a truncated Bessel beam of agiven order, using cylindrical optical waveguides and whispering gallery mode resonators. Utilizing a generator based on waveguides combined with whispering gallery mode resonators, we have realized Bessel beams of the order of 200 with a conversion efficiency exceeding 10 %.

  10. A winning strategy for 3 x n Cylindrical Hex

    DEFF Research Database (Denmark)

    Huneke, S. C.; Hayward, R.; Toft, Bjarne

    2014-01-01

    For Cylindrical Hex on a board with circumference 3, we give a winning strategy for the end-to-end player. This is the first known winning strategy for odd circumference at least 3, answering a question of David Gale. (C) 2014 Elsevier B.V. All rights reserved....

  11. QUASI-PML FOR WAVES IN CYLINDRICAL COORDINATES. (R825225)

    Science.gov (United States)

    We prove that the straightforward extension of Berenger's original perfectly matched layer (PML) is not reflectionless at a cylindrical interface in the continuum limit. A quasi-PLM is developed as an absorbing boundary condition (ABC) for the finite-difference time-domain method...

  12. Imaging for Borehole Wall by a Cylindrical Linear Phased Array

    Institute of Scientific and Technical Information of China (English)

    ZHANG Bi-Xing; SHI Fang-Fang; WU Xian-Mei; GONG Jun-Jie; ZHANG Cheng-Guang

    2010-01-01

    @@ A new ultrasonic cylindrical linear phased array (CLPA) transducer is designed and fabricated for the borehole wall imaging in petroleum logging based on the previous theoretical researches.First,the CLPA transducer,which is made up of numbers of the piezoelectric elements distributed on the surface of a cylinder uniformly,is designed and fabricated.

  13. A circumferential crack in a cylindrical shell under tension.

    Science.gov (United States)

    Duncan-Fama, M. E.; Sanders, J. L., Jr.

    1972-01-01

    A closed cylindrical shell under uniform internal pressure has a slit around a portion of its circumference. Linear shallow shell theory predicts inverse square-root-type singularities in certain of the stresses at the crack tips. This paper reports the computed strength of these singularities for different values of a dimensionless parameter based on crack length, shell radius and shell thickness.

  14. 3D impurity inspection of cylindrical transparent containers

    DEFF Research Database (Denmark)

    Kragh, Mikkel Fly; Bjerge, Kim; Ahrendt, Peter

    2016-01-01

    This paper presents a method for automatically detecting and three-dimensionally positioning particles based on sequences of 2D images of rotating cylindrical transparent containers. The method can be used in the manufacturing industry by distinguishing between particles residing inside or outsid...

  15. Constitutive sensitivity of the oscillatory behaviour of hyperelastic cylindrical shells

    Science.gov (United States)

    Aranda-Iglesias, D.; Vadillo, G.; Rodríguez-Martínez, J. A.

    2015-12-01

    Free and forced nonlinear radial oscillations of a thick-walled cylindrical shell are investigated. The shell material is taken to be incompressible and isotropic within the framework of finite nonlinear elasticity. In comparison with previous seminal works dealing with the dynamic behaviour of hyperelastic cylindrical tubes, in this paper we have developed a broader analysis on the constitutive sensitivity of the oscillatory response of the shell. In this regard, our investigation is inspired by the recent works of Bucchi and Hearn (2013) [28,29], who carried out a constitutive sensitivity analysis of similar problem with hyperelastic cylindrical membranes subjected to static inflation. In the present paper we consider two different Helmholtz free-energy functions to describe the material behaviour: Mooney-Rivlin and Yeoh constitutive models. We carry out a systematic comparison of the results obtained by application of both constitutive models, paying specific attention to the critical initial and loading conditions which preclude the oscillatory response of the cylindrical tube. It has been found that these critical conditions are strongly dependent on the specific constitutive model selected, even though both Helmholtz free-energy functions were calibrated using the same experimental data.

  16. Capillary condensation of 4He in cylindrical pores

    Science.gov (United States)

    Urrutia, Ignacio; Szybisz, Leszek

    2004-10-01

    The adsorption of superfluid 4He confined into cylindrical pores of alkali metals is illustrated by looking at the case of Na. A density functional formalism is utilized for the theoretical description. The energetics and density profiles are determined as a function of the radius of cylinders and the filling fraction. These results are compared with those provided by a simple model recently proposed.

  17. Characterization of Density Profile of Cylindrical Pulsed Gas Jets

    Institute of Scientific and Technical Information of China (English)

    YU Quan-Zhi; LI Yu-Tong; ZhANG Jie; ZHENG Jun; LI Han-Ming; PENG Xiao-Yu; LI Kun

    2004-01-01

    @@ We investigated the characteristics of argon and helium gas jets produced by a cylindrical nozzle under pressures from I to 6 Mpa using a femtosecond laser interferometry. A radial parabolic distribution and an axial exponential distribution of the gas jet density profiles are identified. The results show that the density increases linearly with the backing pressure.

  18. Spherical coordinate descriptions of cylindrical and spherical Bessel beams.

    Science.gov (United States)

    Poletti, M A

    2017-03-01

    This paper derives a generalized spherical harmonic description of Bessel beams. The spherical harmonic description of the well-known cylindrical Bessel beams is reviewed and a family of spherical Bessel beams are introduced which can provide a number of azimuthal phase variations for a single beam radial amplitude. The results are verified by numerical simulations.

  19. On stability cylindrical shell with a viscoelastic core

    OpenAIRE

    2013-01-01

    Stability of cylindrical shell with a viscoelastic core is investigated under action both of external uniform pressure and constant temperature field. Core effect is modelled by means of Winkler formula. Besides of instant and prolonged critical parameters, the instability critical time are defined.

  20. Chaotic Vibrations of Closed Cylindrical Shells in a Temperature Field

    Directory of Open Access Journals (Sweden)

    A.V. Krysko

    2008-01-01

    Full Text Available Complex vibrations of cylindrical shells embedded in a temperature field are studied, and the Bubnov-Galerkin method in higher approximations and in the Fourier representation is applied. Both lack and influence of temperature field on the shell dynamics are analyzed.

  1. Internally Pressurized Spherical and Cylindrical Cavities in Rock Salt

    DEFF Research Database (Denmark)

    Krenk, Steen

    1978-01-01

    The paper deals with the stress distribution around cavities under pressure in an infinite, non-linear elastic material. A homogeneous stress state is assumed at infinity. For spherical and cylindrical cavities simple formulae are derived for the stress concentration, the extent of the non-linear...

  2. KE-Rod Initial Velocity of Hollow Cylindrical Charge

    Directory of Open Access Journals (Sweden)

    Wang Shushan

    2011-01-01

    Full Text Available KE-rod warhead is a kind of forward interception warhead. To control the KE-rods to disperse uniformly, the hollow cylindrical charge is applied. Initial velocity is crucial to KE-rods distribution and the coordination between the fuze and the warhead. Therefore, based on the classical Gurney formula of cylindrical charge and tabulate interlayer charge, a mathematical model for calculating the KE-rod initial velocity of hollow cylindrical charge has been deduced based on certain assumptions, of which the basis theory is energy and momentum conservation. To validate this deduced equation, high-speed photography and metal-pass target experimental methods were applied simultaneously to test the initial velocity of designed KE-rod warhead. Testing results clearly indicate that the calculated results of the derived mathematical model coincides with the experimental  results, and with the increase in hollow radius, the calculated results become much closer to the experimental results. But the calculated results of classical Gurney formula are far above the experimental results, and the relative error increases with increase in the hollow diameter. The derived mathematical model with satisfactory accuracy is applicable to calculate the KE-rod initial velocity of hollow cylindrical charge in engineering applications.Defence Science Journal, 2011, 61(1, pp.25-29, DOI:http://dx.doi.org/10.14429/dsj.61.72

  3. Development and Evaluation of Gold 3D Cylindrical Nanoelectrode Ensembles

    Institute of Scientific and Technical Information of China (English)

    CAO Li-Xin; YAN Pei-Sheng; SUN Ke-Ning; KIRK W Donald

    2007-01-01

    Gold 3D cylindrical nanoelectrode ensembles (NEEs), 100 nm in diameter and 500 nm in length were prepared by electroless template synthesis in polycarbonate filter membranes, followed by selective controlled chemical etching. The morphology of the nanowires and cylindrical NEEs was imaged by scanning electron microscopy. The protruding nanoelectrodes were in good parallel order. EDX study showed that the nanoelectrode elements consisted of pure gold. The electrochemical evaluation of the 3D electrodes was conducted using the well known [Fe(CN)6]3-/[Fe(CN)6]4- couple. Cyclic voltammgrams (CV) show a very low double layer charging current and a higher ratio of signal to background current than 2D disc NEEs. Electrochemical impedance spectroscopy (EIS) indicates that the 3D cylindrical NEEs effectively accelerate the charge transfer process, which is in consistent with the results of CV. The linear relationship with a slope of 0.5 between lg Ipc and lg v shows that linear diffusion is dominant on the 3D cylindrical NEEs at conventional scan rates.

  4. Static Solutions of Einstein's Equations with Cylindrical Symmetry

    Science.gov (United States)

    Trendafilova, C. S.; Fulling, S. A.

    2011-01-01

    In analogy with the standard derivation of the Schwarzschild solution, we find all static, cylindrically symmetric solutions of the Einstein field equations for vacuum. These include not only the well-known cone solution, which is locally flat, but others in which the metric coefficients are powers of the radial coordinate and the spacetime is…

  5. PCM thermal energy storage in cylindrical containers of various configurations

    Energy Technology Data Exchange (ETDEWEB)

    Mujumdar, A.S.; Ali Ashraf, F.; Menon, A.S.; Weber, M.E.

    1981-01-01

    Experimental measurements are reported for the time variation of surface-averaged rate of heat storage during melting in single, thin-walled cylindrical containers of copper filled with a commercially available paraffin wax. For the wax used the enthalpy-temperature curve was obtained using a differential scanning calorimeter according to the ASTM method. 12 refs.

  6. A cylindrical drift chamber with azimuthal and axial position readout

    Energy Technology Data Exchange (ETDEWEB)

    Bar-Yam, Z.; Cummings, J.P.; Dowd, J.P.; Eugenio, P.; Hayek, M.; Kern, W.; King, E.; Shenhav, N.; Chung, S.U.; Hackenburg, R.W.; Olchanski, C.; Weygand, D.P.; Willutzki, H.J.; Brabson, B.B.; Crittenden, R.R.; Dzierba, A.R.; Gunter, J.; Lindenbusch, R.; Rust, D.R.; Scott, E.; Smith, P.T.; Sulanke, T.; Teige, S.; Denisov, S.; Dushkin, A.; Kochetkov, V.; Lipaev, V.; Popov, A.; Shein, I.; Soldatov, A.; Anoshina, E.V.; Bodyagin, V.A.; Demianov, A.I.; Gribushin, A.M.; Kodolova, O.L.; Korotkikh, V.L.; Kostin, M.A.; Ostrovidov, A.I.; Sarycheva, L.I.; Sinev, N.B.; Vardanyan, I.N.; Yershov, A.A.; Adams, T.; Bishop, J.M.; Cason, N.M.; Sanjari, A.H.; LoSecco, J.M.; Manak, J.J.; Shephard, W.D.; Stienike, D.L.; Taegar, S.A.; Thompson, D.R.; Brown, D.S.; Pedlar, T.; Seth, K.K.; Wise, J.; Zhao, D.; Adams, G.S.; Napolitano, J.; Nozar, M.; Smith, J.A.; Witkowski, M. [Massachusetts Univ., North Dartmouth, MA (United States)]|[Brookhaven National Laboratory, Upton, L.I., NY 11973 (United States)]|[Indiana University, Bloomington, IN 47405 (United States)]|[Institute for High Energy Physics, Protvino (Russian Federation)]|[Institute of Nuclear Physics, Moscow State University, Moscow (Russian Federation)]|[University of Notre Dame, Notre Dame, IN 46556 (United States)]|[Northwestern University, Evanston, IL 60208 (United States)]|[Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    1997-02-21

    A cylindrical multiwire drift chamber with axial charge-division has been constructed and used in experiment E852 at Brookhaven National Laboratory. It serves as a trigger element and as a tracking device for recoil protons in {pi}{sup -}p interactions. We describe the chamber`s design considerations, details of its construction, electronics, and performance characteristics. (orig.).

  7. Charged Cylindrical Polytropes with Generalized Polytropic Equation of State

    CERN Document Server

    Azam, M; Noureen, I; Rehman, M A

    2016-01-01

    We study the general formalism of polytropes in relativistic regime with generalized polytropic equations of state in the vicinity of cylindrical symmetry. We take charged anisotropic fluid distribution of matter with conformally flat condition for the development of general framework of polytropes. We discussed the stability of the model by Whittaker formula and concluded that one of the developed model is physically viable.

  8. Microfabrication of cylindrical microfluidic channel networks for microvascular research.

    Science.gov (United States)

    Huang, Zhouchun; Li, Xiang; Martins-Green, Manuela; Liu, Yuxin

    2012-10-01

    Current methods for formation of microvascular channel scaffolds are limited with non-circular channel cross-sections, complicated fabrication, and less flexibility in microchannel network design. To address current limitations in the creation of engineered microvascular channels with complex three-dimensional (3-D) geometries in the shape of microvessels, we have developed a reproducible, cost-effective, and flexible micromanufacturing process combined with photolithographic reflowable photoresist and soft lithography techniques to fabricate cylindrical microchannel and networks. A positive reflowable photoresist AZ P4620 was used to fabricate a master microchannel mold with semi-circular cross-sections. By the alignment and bonding of two polydimethylsiloxane (PDMS) microchannels replicated from the master mold together, a cylindrical microchannel or microchannel network was created. Further examination of the channel dimensions and surface profiles at different branching levels showed that the shape of the microfluidic channel was well approximated by a semi-circular surface, and a multi-level, multi-depth channel network was created. In addition, a computational fluidic dynamics (CFD) model was used to simulate shear flows and corresponding pressure distributions inside of the microchannel and channel network based on the dimensions of the fabricated channels. The fabricated multi-depth cylindrical microchannel network can provide platforms for the investigation of microvascular cells growing inside of cylindrical channels under shear flows and lumen pressures, and work as scaffolds for the investigation of morphogenesis and tubulogenesis.

  9. Strength Reliability Analysis of Stiffened Cylindrical Shells Considering Failure Correlation

    Institute of Scientific and Technical Information of China (English)

    Xu Bai; Liping Sun; Wei Qin; Yongkun Lv

    2014-01-01

    The stiffened cylindrical shell is commonly used for the pressure hull of submersibles and the legs of offshore platforms. There are various failure modes because of uncertainty with the structural size and material properties, uncertainty of the calculation model and machining errors. Correlations among failure modes must be considered with the structural reliability of stiffened cylindrical shells. However, the traditional method cannot consider the correlations effectively. The aim of this study is to present a method of reliability analysis for stiffened cylindrical shells which considers the correlations among failure modes. Firstly, the joint failure probability calculation formula of two related failure modes is derived through use of the 2D joint probability density function. Secondly, the full probability formula of the tandem structural system is given with consideration to the correlations among failure modes. At last, the accuracy of the system reliability calculation is verified through use of the Monte Carlo simulation. Result of the analysis shows the failure probability of stiffened cylindrical shells can be gained through adding the failure probability of each mode.

  10. Flow-induced vibrations of circular cylindrical structures. [LMFBR

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S.

    1977-06-01

    The problems of flow-induced vibrations of circular cylindrical structures are reviewed. First, the general method of analysis and classification of structural responses are presented. Then, the presentation is broken up along the lines with stationary fluid, parallel flow, and cross flow. Finally, design considerations and future research needs are pointed out. 234 references.

  11. The cylindrical or tubiliform glands of Nephila clavipes.

    Science.gov (United States)

    Candelas, G C; Ortiz, A; Molina, C

    1986-02-01

    The cylindrical or tubiliform glands of the spider Nephila clavipes have been studied and compared to the large ampullates on which we have previously reported. The three pairs of cylindrical or tubiliform glands secrete the fibroin for the organism's egg case. Their solubilized luminar contents migrate as a homogeneous band in Sodium dodecyl sulfate polyacrylamide gel electrophoresis and turn out to be a larger protein than that produced by the large ampullates. The excised cylindrical glands remain metabolically active for several hours in a simple culture medium, where fibroin synthesis can be monitored through the incorporation of 14C alanine. The glands' response to a fibroin production stimulus does not reach the magnitude displayed by the large ampullates, but this is to be expected since their products supply different functions in this organism. This fibroin also seems to be elongated discontinuously. Translational pauses have been detected in the secretory epithelium of cylindrical and large ampullate glands of Nephila as well as in the silk glands of Bombyx mori. Since these glands produce the fibroin for the females egg case, they should prove to be an interesting model system.

  12. Employing a cylindrical single crystal in gas-surface dynamics

    NARCIS (Netherlands)

    Hahn, C.; Shan, J.; Liu, Y.; Berg, van den O.; Kleijn, A.W.; Juurlink, L.B.F.

    2012-01-01

    We describe the use of a polished, hollow cylindrical nickel single crystal to study effects of step edges on adsorption and desorption of gas phase molecules. The crystal is held in an ultra-high vacuum apparatus by a crystal holder that provides axial rotation about a [100] direction, and a crysta

  13. The Quality Factor of the Folded Cylindrical Helix

    Directory of Open Access Journals (Sweden)

    S. R. Best

    2009-12-01

    Full Text Available Any electrically small antenna can be impedance matched at any single frequency using a number of well known techniques. Once the small antenna is impedance matched, the primary characteristics of interest are its radiation efficiency, its operating bandwidth and to a lesser extent, its radiation patterns. The bandwidth of the small antenna is often quantified using the antenna's quality factor (Q since fundamental lower bounds for Q are defined in terms of the antenna's occupied volume. The lower bound on Q, also known as the Chu-limit, is defined in terms of the spherical volume occupied by the antenna. However, many small antenna designs are constrained to fit within volumes other than a sphere. To address this issue, Gustafsson et al derived lower bounds for antennas of arbitrary shape with a specific focus on cylindrical and planar shaped antennas. In this paper we consider the quality factor of the folded cylindrical helix, an antenna design that effectively utilizes the available cylindrical volume. We compare its Q to the Gustaffson limit as a function of length-to-diameter ratio, while maintaining a fixed value of ka, and show that it’s Q is at or above Gustafsson’s lower bound for cylindrical shaped antennas.

  14. Magnetoresistance of cylindrical nanowires with artificial pinning site

    KAUST Repository

    Vidal, Enrique Vilanova

    2015-05-01

    New concepts of magnetic memory devices are exploiting the movement of data bits by current induced domain wall motion. This concept has been widely explored with rectangular nanowires (NWs) or stripes both theoretically and experimentally [1]. In the case of cylindrical NWs not much progress has been made on the experimental side, despite its promising advantages like the absence of Walker breakdown [2].

  15. Development of new cylindrical magnetrons for industrial use

    CERN Document Server

    Clayton, B

    2000-01-01

    four-fold system. In an attempt to tackle this problem, a finite element model of the magnetic field generated by the magnetic assembly was built, run and verified. Changes were made to this model, and a new .magnet assembly was built and tested based on the results obtained. This did not lead to a final solution of the problem, but has set bounds within which the solution must lie. A number of alternative techniques were considered and tested with a view to the construction of a cylindrical sputtering device. This device was required to be capable of depositing tribological coatings inside approximately cylindrical substrates of diameters less than 100mm, in an industrial situation. A cylindrical magnetron device was designed, and constructed as a prototype, using a magnetic assembly inside a cylindrical target with outside diameter (o.d.) 40mm. Two alternative magnetic assemblies were tested, and found to have complimentary advantages. The magnetron characteristics of the device were tested, as were key pro...

  16. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  17. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  18. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  19. Nonlinear vibrations and imperfection sensitivity of a cylindrical shell containing axial fluid flow

    Science.gov (United States)

    del Prado, Z.; Gonçalves, P. B.; Païdoussis, M. P.

    2009-10-01

    The high imperfection sensitivity of cylindrical shells under static compressive axial loads is a well-known phenomenon in structural stability. On the other hand, less is known of the influence of imperfections on the nonlinear vibrations of these shells under harmonic axial loads. The aim of this work is to study the simultaneous influence of geometric imperfections and an axial fluid flow on the nonlinear vibrations and instabilities of simply supported circular cylindrical shells under axial load. The fluid is assumed to be non-viscous and incompressible and the flow to be isentropic and irrotational. The behavior of the thin-walled shell is modeled by Donnell's nonlinear shallow-shell equations. It is subjected to a static uniform compressive axial pre-load plus a harmonic axial load. A low-dimensional modal expansion, which satisfies the relevant boundary and continuity conditions, and takes into account all relevant nonlinear modal interactions observed in the past in the nonlinear vibrations of cylindrical shells with and without flow is used together with the Galerkin method to derive a set of eight coupled nonlinear ordinary differential equations of motion which are, in turn, solved by the Runge-Kutta method. The shell is considered to be initially at rest, in a position corresponding to a pre-buckling configuration. Then, a harmonic excitation is applied and conditions for parametric instability and dynamic snap-through are sought. The results clarify the marked influence of geometric imperfections and fluid flow on the dynamic stability boundaries, bifurcations and basins of attraction.

  20. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  1. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  5. Complete Classification of Cylindrically Symmetric Static Spacetimes and the Corresponding Conservation Laws

    Directory of Open Access Journals (Sweden)

    Farhad Ali

    2016-08-01

    Full Text Available In this paper we find the Noether symmetries of the Lagrangian of cylindrically symmetric static spacetimes. Using this approach we recover all cylindrically symmetric static spacetimes appeared in the classification by isometries and homotheties. We give different classes of cylindrically symmetric static spacetimes along with the Noether symmetries of the corresponding Lagrangians and conservation laws.

  6. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  7. Elastic constant of Dendrobium protoplasts in AC electric fields

    Directory of Open Access Journals (Sweden)

    Pikul Wanichapichart

    2002-11-01

    Full Text Available This work reports elongation of Dendrobium protoplasts in an ac electric field between two cylindrical electrodes. A protoplast firstly was translated towards an electrode by dielectrophoretic force in 17 kV.m-1 field strength at 1 MHz, and secondly it was elongated due to an interaction between an induced electric dipole (μ and the electric field (E. Protoplast elongation was observed by varying both the field strength at 30, 45, 60, and 85 kV.m-1 and field frequency at 0.5, 1, 5, and 10 MHz. For a given field frequency and field strength, a parameter a/b (major/minor axis was measured as the protoplast elongation.Two-step elongation and restoration phases were observed. The former was completed within 2 minutes of field exposure, and the latter was completed within 15 seconds regardless of the field exposure time between 3 and 20 minutes. The evidence of a complete restoration indicated that the elasticity of the protoplast membrane obeyed Hooke’s law. This study also found that elastic constant k of the membrane varied non-linearly with the field strength. It was found to be from 0.04 to 0.08 mN.m-1, dependent on the field frequency.

  8. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  9. Improvement of superconducting cylindrical linear induction motor; Chodendo entogata tan'ichiji rinia yudo mota no tokusei kaizen

    Energy Technology Data Exchange (ETDEWEB)

    Kikuma, T.; Ishiyama, A. [Waseda Univ., Tokyo (Japan)

    2000-05-29

    For the purpose of examining the characteristics (effect of stability and ac loss by the higher harmonic wave etc.) of an alternating current superconductivity winding under a real machine operating environment of the super-conductive AC machine vessel, authors produced a cylindrical shortness first linear guiding motor (SCLIM) which used the NbTi/CuNi super-conducting cable for the first excitation winding experimentally. In this study, the evaluation of the start up thrust and operation confirmation of the quenching detection protection circuit were carried out using the produced SCLIM. In the quenching detection protection control circuit, the first excitation winding was divided into an internal layer and an outer layer, and both layers were excited in the 2 layer division and a quenching detection protection circuit was installed on the 2 layers respectively. The circuit of a part of fact by this of the phase in which the quench was generated and observed was cut off, and the operation would be able to be continued in part of the remainder of the phase and other two phases. Here, it is to cut off the quenched phase from the circuit, when the phase current becomes zero, and the other effect on the phase is held as small as possible. (NEDO)

  10. Tumor-associated MUC5AC stimulates in vivo tumorigenicity of human pancreatic cancer.

    Science.gov (United States)

    Hoshi, Hirotaka; Sawada, Tetsuji; Uchida, Motoyuki; Saito, Hikaru; Iijima, Hiroko; Toda-Agetsuma, Mikako; Wada, Tsutomu; Yamazoe, Sadaaki; Tanaka, Hiroaki; Kimura, Kenjiro; Kakehashi, Anna; Wei, Min; Hirakawa, Kosei; Wanibuchi, Hideki

    2011-03-01

    MUC5AC, a high molecular weight glycoprotein, is overexpressed in the ductal region of human pancreatic cancer but is not detectable in the normal pancreas, suggesting its association with disease development. In the present study, we investigated the in vitro and in vivo effects of MUC5AC knockdown by short interfering RNA (siRNA) in the MUC5AC-overexpressing SW1990 and BxPC3 human pancreatic cancer cell lines in order to clarify its function. Significant decreases in the expression levels of MUC5AC mRNA and protein were observed in SW1990 and BxPC3 cells that had been stably transfected with a MUC5AC siRNA expression vector (SW1990/si-MUC5AC and BxPC3/si-MUC5AC cells) compared to those in cells transfected with an si-mock vector (SW1990/si-mock and BxPC3/si-mock cells). In in vitro studies, neither type of MUC5AC-knockdown cell showed any difference in cell survival, proliferation, or morphology from the si-mock cells or parental cells. However, in vivo xenograft studies demonstrated that MUC5AC knockdown significantly reduced the tumorigenicity and suppressed the tumor growth of si-MUC5AC cells compared to those of the si-mock cells. Immunohistochemical analysis revealed that CD45R/B220+ and Gr-1+ cells had infiltrated into the tumor tissue of the SW1990/si-MUC5AC cells. Furthermore, cancer-associated antigen specific antibodies were detected at high levels in the sera from the SW1990/si-MUC5AC cell-bearing mice. These results suggest that tumor-associated MUC5AC expressed on the surface of pancreatic cancer cells supports the escape of pancreatic cancer cells from immunosurveillance. The present findings highlight a new dimension of MUC5AC as a functional immunosuppressive agent and its important role in pancreatic cancer progression.

  11. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  12. Design algorithm for generatrix profile of cylindrical crowned rollers

    Directory of Open Access Journals (Sweden)

    Creţu Spiridon

    2017-01-01

    Full Text Available The cross-section of roller profile controls the pressure distribution in the contact area and radically affects the roller bearings basic dynamic load rating and rating lives. Today the most used roller profiles are the logarithmic profile and cylindrical-crowned (ZB profile. The logarithmic profile has a continuous evolution with no discontinuities till the intersection with the end fillet while ZB profile has two more discontinuities at the intersections points between the crowning circle and straight line generatrix. Using a semianalytical method, a numerical study has been carried out to find the optimum ZB profile for rollers incorporated in cylindrical rollers bearings. The basic reference rating life (L10_r has been used as optimization criterion.

  13. NONLINEAR THEORY OF DYNAMIC STABILITY FOR LAMINATED COMPOSITE CYLINDRICAL SHELLS

    Institute of Scientific and Technical Information of China (English)

    周承倜; 王列东

    2001-01-01

    Hamilton Principle was uaed to derive the general governing equations of nonlinear dynamic stability for laminated cylindrical shells in which, factors of nonlinear large deflection, transverse shear and longitudinal inertia force were concluded. Equations were solved by variational method. Analysis reveals that under the action of dynamic load,laminated cylindrical shells will fall into a state of parametric resonance and enter into the dynamic unstable region that causes dynamic instability of shells. Laminated shells of three typical composites were computed: i.e. T300/5 208 graphite epoxy E-glass epoxy, and ARALL shells. Results show that all factors will induce important influence for dynamic stability of laminated shells. So, in research of dynamic stability for laminated shells, to consider these factors is important.

  14. Selective decay in a long cylindrical geometry in SSX

    Science.gov (United States)

    Gray, T.; Brown, M.; Dandurand, D.; Zhang, X.

    2010-11-01

    A helical, minimum-energy relaxed plasma state has been observed in a long cylindrical volume. The cylinder is long enough (L/R = 13) so that the predicted minimum energy state is a close approximation to the infinite cylinder solution. The plasma is injected at v >=50 km/s by a coaxial magnetized plasma gun located at one end of the cylindrical volume. The relaxed state is rapidly attained in 1--2 axial Alfvén times after initiation of the plasma. Magnetic data is favorably compared with an analytical model. Magnetic data exhibits broadband fluctuations of the measured axial modes during the formation period. The broadband activity rapidly decays as the energy condenses into the lowest energy mode, which is in agreement to the minimum energy eigenstate of ∇xB = λB. Merging experiments are planned and additional data will be presented if available.

  15. Shielding and Radiation Characteristics of Cylindrical Layered Bianisotropic Structures

    Directory of Open Access Journals (Sweden)

    A. Toscano

    2005-12-01

    Full Text Available In this paper we propose an analytical study in the spectral domainof cylindrical layered structures filled with general bianisotropicmedia and fed by a 3D electric source. The integrated structure ischaracterized in terms of transmission matrices leading to anequivalent circuit representation of the whole multilayered structure.Within the framework of this two-port formalism, we present a newcontribution to the computation of the Green's function arising in theanalysis of multilayered conformal integrated antennas loaded withgeneral bianisotropic materials. We also propose an analytical study ofthe shielding effectiveness of general bianisotropic materials locatedin multilayered, cylindrical configuration. The expression of theshielded fields sustained both by plane wave and arbitrary sources isobtained in a closed analytical form. Numerical results are alsopresented showing effects of electromagnetic parameters on radiationpattern, matching properties and radar cross section of the integratedstructure.

  16. Gamma ray absorption of cylindrical fissile material with dual shields

    Institute of Scientific and Technical Information of China (English)

    WU Chen-Yan; TIAN Dong-Feng; CHENG Yi-Ying; HUANG Yong-Yi; LU Fu-Quan; YANG Fu-Jia

    2005-01-01

    This work analyzed the gamma ray attenuation effect from the self-absorption and shield attenuation perspectively. An exact mathematical equation was given for the geometric factor of the cylindrical fissile material with dual shields. In addition, several approximation approaches suitable for real situation were discussed, especially in the radial and axial directions of the cylinders, since the G-factors have simple forms. Then the space distribution patterns of the G-factor were analyzed based on numerical result and effective ways to solve the geometric information of the cylindrical fissile material, the radii and the heights, were deduced. This method was checked and verified by numerical calculation. Because of the efficiency of the method, it is ideal for application in real situations, such as nuclear safeguards, which demands speed of detection and accuracy of geometric analysis.

  17. Dynamic response of cylindrical lined cavity in elastic medium

    Institute of Scientific and Technical Information of China (English)

    高盟; 王滢; 高广运

    2013-01-01

    An analytical solution to the transient dynamic response of a cylindrical lining subjected to an internal loading was presented and the dynamic interaction between the lining and surrounding soil was considered. The lining structure and the soil were treated as a cylindrical elastic shell and an infinite elastic compressible medium, respectively. A two-dimensional axisymmetric wave equation was derived from the governing equation of displacement by introducing the potential functions. Shell equation of motion was established based on continuity conditions. The closed-form solution for dynamic response of the lining due to an impact loading was obtained in Laplace transforms and inverse transforms. Detailed parametric studies were also presented to illustrate the influences of the Poisson ratio of soil, the dynamic shear moduli of both soil and lining and the thickness of lining on dynamic response of the lining.

  18. Fem Formulation of Heat Transfer in Cylindrical Porous Medium

    Science.gov (United States)

    Azeem; Khaleed, H. M. T.; Soudagar, Manzoor Elahi M.

    2017-08-01

    Heat transfer in porous medium can be derived from the fundamental laws of flow in porous region ass given by Henry Darcy. The fluid flow and energy transport inside the porous medium can be described with the help of momentum and energy equations. The heat transfer in cylindrical porous medium differs from its counterpart in radial and axial coordinates. The present work is focused to discuss the finite element formulation of heat transfer in cylindrical porous medium. The basic partial differential equations are derived using Darcy law which is the converted into a set of algebraic equations with the help of finite element method. The resulting equations are solved by matrix method for two solution variables involved in the coupled equations.

  19. Highly compressed nanosolution restricted in cylindrical carbon nanospaces

    Science.gov (United States)

    Nishi, Masayasu; Ohkubo, Takahiro; Tsurusaki, Kazuma; Itadani, Atsushi; Ahmmad, Bashir; Urita, Koki; Moriguchi, Isamu; Kittaka, Shigeharu; Kuroda, Yasushige

    2013-02-01

    We shed light on the specific hydration structure around a zinc ion of nanosolution restricted in a cylindrical micropore of single-wall carbon nanotube (SWNT) by comparison with the structure restricted in a cylindrical mesopore of multi-wall carbon nanotube (MWNT) and that of bulk aqueous solution. The average micropore width of open-pore SWNT was 0.87 nm which is equivalent to the size of a hydrated zinc ion having 6-hydrated water molecules. We could impregnate the zinc ions into the micropore of SWNT with negligible amounts of ion-exchanged species on surface functional groups by the appropriate oxidation followed by heat treatment under an inert condition. The results of X-ray absorption fine structure (XAFS) spectra confirmed that the proportion of dissolved species in nanospaces against the total adsorbed amounts of zinc ions on the open-pore SWNT and MWNT were 44 and 61%, respectively, indicating the formation of a dehydrated structure in narrower nanospaces. The structure parameters obtained by the analysis of XAFS spectra also indicate that the dehydrated and highly compressed hydration structure can be stably formed inside the cylindrical micropore of SWNT where the structure is different from that inside the slit-shaped micropore whose pore width is less than 1 nm. Such a unique structure needs not only a narrow micropore geometry which is equivalent to the size of a hydrated ion but also the cylindrical nature of the pore.We shed light on the specific hydration structure around a zinc ion of nanosolution restricted in a cylindrical micropore of single-wall carbon nanotube (SWNT) by comparison with the structure restricted in a cylindrical mesopore of multi-wall carbon nanotube (MWNT) and that of bulk aqueous solution. The average micropore width of open-pore SWNT was 0.87 nm which is equivalent to the size of a hydrated zinc ion having 6-hydrated water molecules. We could impregnate the zinc ions into the micropore of SWNT with negligible amounts of

  20. NONLINEAR FARADAY WAVES IN A PARAMETRICALLY EXCITED CIRCULAR CYLINDRICAL CONTAINER

    Institute of Scientific and Technical Information of China (English)

    菅永军; 鄂学全; 柏威

    2003-01-01

    In the cylindrical coordinate system, a singular perturbation theory of multiple-scale asymptotic expansions was developed to study single standing water wave mode bysolving potential equations of water waves in a rigid circular cylinder, which is subject to avertical oscillation. It is assumed that the fluid in the circular cylindrical vessel is inviscid ,incompressible and the motion is irrotational, a nonlinear amplitude equation with cubicand vertically excited terms of the vessel was derived by expansion of two-time scales withoutconsidering the effect of surface tension. It is shown by numerical computation that differentfree surface standing wave patterns will be formed in different excited frequencies andamplitudes. The contours of free surface waves are agreed well with the experimental resultswhich were carried out several years ago.

  1. Electrostatic resonances and optical responses of cylindrical clusters

    Science.gov (United States)

    Choy, C. W.; Xiao, J. J.; Yu, K. W.

    2008-12-01

    We developed a Green function formalism (GFF) for computing the electrostatic resonance in clusters of cylindrical particles. In the GFF, we take advantage of a surface integral equation to avoid matching the complicated boundary conditions on the surfaces of the particles. Numerical solutions of the eigenvalue equation yield a pole spectrum in the spectral representation. The pole spectrum can in turn be used to compute the optical response of these particles. For two cylindrical particles, the results are in excellent agreement with the exact results from the multiple image method and the normal mode expansion method. The results of this work can be extended to investigate the enhanced nonlinear optical responses of metal-dielectric composites, as well as optical switching in plasmonic waveguides.

  2. Elasticity solutions for functionally graded plates in cylindrical bending

    Institute of Scientific and Technical Information of China (English)

    YANG Bo; DING Hao-jiang; CHEN Wei-qiu

    2008-01-01

    The plate theory of functionally graded materials suggested by Mian and Spencer is extended to analyze the cylindrical bending problem of a functionally graded rectangular plate subject to uniform load. The expansion formula for displacements is adopted. While keeping the assumption that the material parameters can vary along the thickness direction in an arbitrary fashion, this paper considers orthotropic materials rather than isotropic materials. In addition, the traction-free condition on the top surface is replaced with the condition of uniform load applied on the top surface. The plate theory for the particular case of cylindrical bending is presented by considering an infinite extent in the y-direction. Effects of boundary conditions and material inhomogeneity on the static response of functionally graded plates are investigated through a numerical example.

  3. Enhanced converse magnetoelectric effect in cylindrical piezoelectric-magnetostrictive composites

    Science.gov (United States)

    Wu, Gaojian; Zhang, Ru; Zhang, Ning

    2016-10-01

    Enhanced converse magnetoelectric (ME) effect has been experimentally observed in cylindrical PZT-Terfenol-D piezoelectric-magnetostrictive bilayered composites, where the piezoelectric and magnetostrictive components are coupled through normal stresses instead of shear stresses that act in most of previous multiferroic composites. A theoretical model based on elastodynamics analysis has been proposed to describe the frequency response of converse ME effect for axial and radial modes in the bilayered cylindrical composites. The theory shows good agreement with the experimental results. The different variation tendency of resonant converse ME coefficient, as well as different variation rate of resonance frequency with bias magnetic field for axial and radial modes is interpreted in terms of demagnetizing effect. This work is of theoretical and technological significance for the application of converse ME effect as magnetic sensor, transducers, coil-free flux switch, etc.

  4. Cylindrical luminescent solar concentrators with near-infrared quantum dots.

    Science.gov (United States)

    Inman, R H; Shcherbatyuk, G V; Medvedko, D; Gopinathan, A; Ghosh, S

    2011-11-21

    We investigate the performance of cylindrical luminescent solar concentrators (CLSCs) with near-infrared lead sulfide quantum dots (QDs) in the active region. We fabricate solid and hollow cylinders from a composite of QDs in polymethylmethacrylate, prepared by radical polymerization, and characterize sample homogeneity and optical properties using spectroscopic techniques. We additionally measure photo-stability and photocurrent outputs under both laboratory and external ambient conditions. The experimental results are in good agreement with theoretical calculations which demonstrate that the hollow CLSCs have higher absorption of incident radiation and lower self-absorption compared to solid cylindrical and planar geometries with similar geometric factors, resulting in a higher optical efficiency. © 2011 Optical Society of America

  5. Rated MW from a heliostat field on cylindrical external receiver

    Energy Technology Data Exchange (ETDEWEB)

    Al-Rabghi, O.M.; Fathalah, K.A. [King Abdulaziz Univ., Mechanical Engineering Dep., Jeddah (Saudi Arabia); Elsayed, M.M. [Kuwait Univ., Mechanical Engineering Dep., Safat (Kuwait)

    1995-12-31

    Some of the reflected beam radiation from a heliostat field bypasses the receiver surface. The spillage factor which is a measure of how much of reflected beam radiation actually intercepted by the receiver surface, is calculated and plotted for easy access. The variation of the spillage with tower height, external cylindrical receiver size, dimensionless radial distance from the tower is computed and plotted. The value of the rated MW energy absorbed by an external cylindrical receiver, is investigated, and its relations to the tower height, the site location and the field radius are given. The effect of changing the radial spacing on the rated MW and the total number of heliostats in the field is also computed and depicted. The developed set of charts for the spillage factor are believed to be very useful for solar central receiver system design. (author) 7 figs., 21 refs.

  6. Plastic Buckling of Cylindrical Shells Under Transverse Loading

    Institute of Scientific and Technical Information of China (English)

    ZHANG Chonghou; LIU Yansheng; Yoshiaki Goto

    2008-01-01

    Thick cylindrical shells under transverse loading exhibit an elephant foot buckling mode, whereas moderately thick cylindrical shells show a diamond buckling mode. There exists some intermediate geome- try at which the transition between buckling modes can take place. This behavior is significantly influenced by the radius-to-thickness ratio and the material yield strength, rather than the length-to-radius ratio and the axial force. This paper presents a critical value at which the transition of buckling modes occurs as a func- tion of the radius-to-thickness ratio and the material yield strength. The result shows that the circumferential wave number of the diamond buckling mode increases with decreasing wall thickness. The strain concentra- tion is also intensified for the diamond buckling modes compared with the elephant foot buckling modes.

  7. Friction Compensation in the Upsetting of Cylindrical Test Specimens

    DEFF Research Database (Denmark)

    Christiansen, Peter; Martins, P. A. F.; Bay, Niels Oluf

    2016-01-01

    This manuscript presents a combined numerical andexperimental methodology for determining the stress-straincurve of metallic materials from the measurements of forceand displacement obtained in the axial compression of cylindrical test specimens with friction between the specimens and the platens...... model or combined friction models are utilized .Experimental results obtained from cylindrical and Rastegaev test specimens with different lubricants combined with the experimental determination of friction by means of ring compression tests allows compensating the effect of friction...... in the determination of the material flow curve. Comparison with the flow curves determined without friction compensation shows the viability of the proposed methodology. The proposed methodology is a simple and effective alternative to other solutions available in the literature and the pseudo-code supplied inthe...

  8. Settling of a cylindrical particle in a stagnant fluid

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Rosendahl, Lasse; Yin, Chungen

    2007-01-01

    on their motion. In total 66 experiments were carried out with a particle Reynolds number in the range between 2000 and 15000. All experiments show a distinct oscillation around one of the particle minor axes. For all experiments the oscillating velocity is compared to the mean settling velocity, and it is found......The objective of this work is to collect data and develop models for cylindrical particles which could be used in numerical multiphase flow modeling. Trajectories of cylindrical particles settling in stagnant water are filmed from two directions in order to derive detailed information...... that the oscillating velocity increases with increasing mean settling velocity. Based on the experiment new expressions for drag and lift coefficient are proposed....

  9. Beamformer for Cylindrical Conformal Array of Non-isotropic Antennas

    Directory of Open Access Journals (Sweden)

    ZOU, L.

    2011-02-01

    Full Text Available The principal objective of this investigation is to facilitate minimum variance distortionless response (MVDR beamforming technique for a cylindrical conformal array geometry. An array of directional radiating elements is postulated to cover a surface typical of the cylinder of an aircraft or missile. Borrowing the analysis of conformal array antennas, the authors first derive a deterministic expression that describes the beam pattern of arbitrary weighted cylindrical conformal array. Then, making use of the MVDR beamforming, we derive the beamformer for uniform linear array (ULA of directional antennas which are different from the traditional omnidirectional elements. Thus, the pattern of a directional element is synthesized by the antennas on the same ring array, and we design the MVDR beamformer, which uses MVDR beamforming for ULA of the synthesized pattern. To demonstrate the validity of the method, and cylinder arrays are constructed and experimental results agree well with theoretical expectations.

  10. Performance of cylindrical-conical cyclones with different geometrical configurations

    Directory of Open Access Journals (Sweden)

    J.D.A.M. Santana

    2001-09-01

    Full Text Available The present work is a continuation of a study of the influence of geometric characteristics on the performance of reverse-flow cylindrical-conical cyclones. After studying the behavior of the pressure drop in previous work (Arnosti et al., 1998, here performance in terms of collection efficiency in the removal of particulate material is addressed. The independent variables considered in this study were inlet gas velocity (three velocities and the following dimensions of the cyclone: the cylindrical section (three heights and internal height of the gas exit duct (three heights. The tests were performed using an 3³ experimental design. Analysis of the results for overall efficiency was carried out using response surfaces and the statistical parameters were estimated from linear regression.

  11. On sector magnets or transverse electromagnetic fields in cylindrical coordinates

    CERN Document Server

    Zolkin, Timofey

    2016-01-01

    The Laplace's equations for the scalar and vector potentials describing electric or magnetic fields in cylindrical coordinates with translational invariance along azimuthal coordinate are considered. The series of special functions which, when expanded in power series in radial and vertical coordinates, in lowest order replicate the harmonic homogeneous polynomials of two variables are found. These functions are based on radial harmonics found by Edwin~M.~McMillan in his more-than-40-years "forgotten" article, which will be discussed. In addition to McMillan's harmonics, second family of adjoint radial harmonics is introduced, in order to provide symmetric description between electric and magnetic fields and to describe fields and potentials in terms of same special functions. Formulas to relate any transverse fields specified by the coefficients in the power series expansion in radial or vertical planes in cylindrical coordinates with the set of new functions are provided. This result is no doubt important f...

  12. Dynamic Response of a Thick Piezoelectric Circular Cylindrical Panel: An Exact Solution

    Directory of Open Access Journals (Sweden)

    Atta Oveisi

    2014-01-01

    Full Text Available One of the interesting fields that attracted many researchers in recent years is the smart structures. The piezomaterials, because of their ability in converting both mechanical stress and electricity to each other, are very applicable in this field. However, most of the works available used various inexact two-dimensional theories with certain types of simplification, which are inaccurate in some applications such as thick shells while, in some applications due to request of large displacement/stress, thick piezoelectric panel is needed and two-dimensional theories have not enough accuracy. This study investigates the dynamic steady state response and natural frequency of a piezoelectric circular cylindrical panel using exact three-dimensional solutions based on this decomposition technique. In addition, the formulation is written for both simply supported and clamped boundary conditions. Then the natural frequencies, mode shapes, and dynamic steady state response of the piezoelectric circular cylindrical panel in frequency domain are validated with commercial finite element software (ABAQUS to show the validity of the mathematical formulation and the results will be compared, finally.

  13. Thin cylindrical slot in an optical microdisk cavity for sensing biomaterials

    Science.gov (United States)

    Daraei, Ahmadreza; Daraei, Mohammad Esmaeil

    2017-04-01

    In this paper, we propose and investigate a thin cylindrical slot etched into a disk shape optical microcavity (MC) aiming for sensing biomaterials in a label-free style. Supporting whispering gallery modes (WGMs), with remarkably large quality factor to modal volume ratio (Q/Vm) of the optical MC structures that penetrate in the slot region, enables us to perform sensing. Three different geometries for the side walls of host microdisk cavities, including vertical, 60° wedged, and half-circular cross section, are selected for investigations. In each individual case, the radial position, width, and height of the thin cylindrical slot are varied. The electromagnetic (EM) field intensity distributions (mode mapping profiles) of the WGMs show funneling of the intensified fields into the slot area that possessing nearly the same high Q values. Tuning the slot position, width, and depth for a suitably chosen WGM, sensing could be optimized for different biomaterials. Sensitivity value as high as 75 nm/RIU is calculated for the half-circular side wall microdisk. The proposed WGM-based slotted microdisk, as a state-of-the-art device which can operate, such as lab-on-chip structure, would function as a sensitive biosensor, even down to the single biomolecule levels.

  14. Numerical and Analytical Calculation of Bernstein Mode Resonances in a Non-Uniform Cylindrical Plasma

    Science.gov (United States)

    Walsh, Daniel K.; Dubin, Daniel H. E.

    2015-11-01

    This poster presents theory and numerical calculations of electrostatic Bernstein modes in an inhomogeneous cylindrical plasma column. These modes rely on FLR effects to propagate radially across the column until they are reflected when their frequency matches the local upper hybrid frequency, setting up an internal normal mode on the column, and also mode-coupling to the electrostatic surface cyclotron wave (which allows the normal mode to be excited and observed using external electrodes). Numerical results predicting the mode spectra, using a novel linear Vlasov code on a cylindrical grid, will be presented and compared to an analytic WKB theory. A previous version of the theory expanded the plasma response in powers of 1/B, approximating the local upper hybrid frequency, and consequently its frequency predictions are shifted with respect to the numerical results. A new version of the WKB theory uses the exact cold fluid plasma response and does a better job of reproducing the numerical frequency spectrum. The eventual goal is to compare the theory to recent experiments that have observed these waves in pure electron and pure ion plasmas. Supported by National Science Foundation Grant PHY-1414570.

  15. Studies of Cylindrical Liner Z-Pinches at 1 MA on COBRA

    Science.gov (United States)

    Atoyan, Levon; Byvank, Tom; Cahill, Adam; Potter, William; de Grouchy, Philip; Kusse, Bruce; Hammer, David

    2014-10-01

    Tests of the magnetized liner inertial fusion (MagLIF) concept will make use of the 27 MA Z-machine to implode a cylindrical metal liner onto a preheated plasma contained within it. While most pulsed power machines produce much lower currents than the Z-machine, there are questions that can be addressed on smaller scale facilities. Recent work on the 1 MA Cornell Beam Research Accelerator (COBRA) has made use of 10 mm long cylindrical metal liners having a 4 mm diameter and a varying wall thickness to study the initiation of plasma on the liner's outer surface as well as axial magnetic field compression. We will present experimental results with both imploding and non-imploding liners, investigating the impact the liner's external surface structure has on initiation, outer surface ablation, and implosion. The effect of a uniform axial external magnetic field on observed surface striations will also be discussed. This research is supported by the National Nuclear Security Administration Stewardship Sciences Academic Programs under Department of Energy Cooperative Agreement DE-NA0001836.

  16. Fabrication of porous bioceramics for bone tissue applications using luffa cylindrical fibres (LCF as template

    Directory of Open Access Journals (Sweden)

    Mazen Alshaaer

    2017-03-01

    Full Text Available Three-dimensionally ordered macroporous biomaterials containing hydroxyapatite were synthesized using natural luffa cylindrical fibres (with diameter of 100–400 µm as templates. The preliminary evaluation of this novel method for production of porous bioceramics showed promising potential applications in bone tissue engineering. The produced bioceramics were subjected to microstructural, physical, mechanical, and in vitro characterisation. Mercury intrusion porosimetry, supported by SEM analysis, showed the presence of bimodal porosity (smaller pores with diameters of 10 to 30 µm and cylindrical macropores with diameters from 100 to 400 µm and 60% of the interconnected porosity. These porous calcium phosphate ceramics proved to be bioactive and exhibited mechanical properties comparable to those of natural spongy bones with compressive strength up to 3 MPa and elastic modulus in compression around 0.05 GPa. In vitro characterization of the porous ceramics showed cells attaching to the apatite crystals that make up the scaffold matrix. Cell adhesion resulted in elongated and highly stretched cells within the macropores with focal adhesion points on the scaffolds. Moreover, the cells adhered to the calcium phosphate cement (CPC and developed cytoplasmic extensions as shown by SEM imagery. Their proliferation in the scaffolds in culture demonstrates that the scaffold architecture is suitable for Mesenchymal stem cells seeding and growth.

  17. Effective thermoelastic properties of composites with periodicity in cylindrical coordinates

    KAUST Repository

    Chatzigeorgiou, George

    2012-09-01

    The aim of this work is to study composites that present cylindrical periodicity in the microstructure. The effective thermomechanical properties of these composites are identified using a modified version of the asymptotic expansion homogenization method, which accounts for unit cells with shell shape. The microscale response is also shown. Several numerical examples demonstrate the use of the proposed approach, which is validated by other micromechanics methods. © 2012 Elsevier Ltd. All rights reserved.

  18. On the accuracy of the asymptotic theory for cylindrical shells

    DEFF Research Database (Denmark)

    Niordson, Frithiof; Niordson, Christian

    1999-01-01

    We study the accuracy of the lowest-order bending theory of shells, derived from an asymptotic expansion of the three-dimensional theory of elasticity, by comparing the results of this shell theory for a cylindrical shell with clamped ends with the results of a solution to the three......-dimensional problem. The results are also compared with those of some commonly used engineering shell theories....

  19. Rotating cylindrically symmetric Kaluza-Klein fluid model

    Indian Academy of Sciences (India)

    Ramesh Tikekar; L K Patel

    2000-09-01

    Kaluza-Klein field equations for stationary cylindrically symmetric fluid models in standard Einstein theory are formulated and a set of physically viable solutions is reported. This set is believed to be the first such Kaluza-Klein solutions and it includes the Kaluza-Klein counterpart of Davidson’s solution describing spacetime of a perfect fluid in rigid rotation about a regular axis.

  20. Charged cylindrical polytropes with generalized polytropic equation of state

    Energy Technology Data Exchange (ETDEWEB)

    Azam, M. [University of Education, Division of Science and Technology, Lahore (Pakistan); Mardan, S.A.; Noureen, I.; Rehman, M.A. [University of the Management and Technology, Department of Mathematics, Lahore (Pakistan)

    2016-09-15

    We study the general formalism of polytropes in the relativistic regime with generalized polytropic equations of state in the vicinity of cylindrical symmetry. We take a charged anisotropic fluid distribution of matter with a conformally flat condition for the development of a general framework of the polytropes. We discuss the stability of the model by the Whittaker formula and conclude that one of the models developed is physically viable. (orig.)

  1. Liquid-drop-like model for cylindrical helium systems

    Science.gov (United States)

    Szybisz, Leszek

    2000-08-01

    Free liquid 4He at T=0 K with cylindrical symmetry is studied. The ground-state energy and chemical potential are computed by using a density functional approach. A liquid-drop-like model is formulated for analyzing the behavior of these observables as a function of the size of the systems. It is shown that such a model allows to get precise information about the asymptotic values of the energy per particle and surface tension.

  2. Resonance in a cylindrical wraparound microstrip structure with superstrate

    Science.gov (United States)

    Wong, Kin-Lu; Tsai, Ruenn-Bo; Row, Jeen-Sheen

    1994-06-01

    Analysis of the resonance problem of a cylindrical wrap-around microstrip structure with superstrate is presented. In this study the rigorous full-wave formulation and Galerkin's method are used. The numerical convergence for the selected sinusoidal basis functions with edge singularity is also discussed. Numerical results of the superstrate loading effects on the real and imaginary parts of complex resonant frequency of the structures as a radiator and as a resonator are calculated and analyzed.

  3. Study of Contact Melting Inside Isothermally Heated Vertical Cylindrical Capsules

    Institute of Scientific and Technical Information of China (English)

    ChenWenzhen; ChengShangmo; 等

    1993-01-01

    Close-contact melting processes of phase change material(PCM) inside vertical cylindrical capsule are studied.PCM are heated bhy the capsule isothermalyy at the bottom and side.The theoretical formulas of the melting rate and thickness of liquid layer during the heat transfer process are obtained by analysis,which are convenient for engineering predictions.Finally,the factors that affect melting are discussed.and conclusions are drawn.

  4. Charged cylindrical polytropes with generalized polytropic equation of state

    Science.gov (United States)

    Azam, M.; Mardan, S. A.; Noureen, I.; Rehman, M. A.

    2016-09-01

    We study the general formalism of polytropes in the relativistic regime with generalized polytropic equations of state in the vicinity of cylindrical symmetry. We take a charged anisotropic fluid distribution of matter with a conformally flat condition for the development of a general framework of the polytropes. We discuss the stability of the model by the Whittaker formula and conclude that one of the models developed is physically viable.

  5. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  6. Beltrami flow structure in a diffuser. Quasi-cylindrical approximation

    CERN Document Server

    González, Rafael; Sartarelli, Andrés Salvador; 10.4279/PIP.040002

    2012-01-01

    We determine the flow structure in an axisymmetric diffuser or expansion region connecting two cylindrical pipes when the inlet flow is a solid body rotation with a uniform axial flow of speeds Omega and U, respectively. A quasi-cylindrical approximation is made in order to solve the steady Euler equation, mainly the Bragg-Hawthorne equation. As in our previous work on the cylindrical region downstream [R Gonz\\'alez et al., Phys. Fluids 20, 24106 (2008); R. Gonz\\'alez et al., Phys. Fluids 22, 74102 (2010), R Gonz\\'alez et al., J. Phys.: Conf. Ser. 296, 012024 (2011)], the steady flow in the transition region shows a Beltrami flow structure. The Beltrami flow is defined as a field v_B that satisfies omega_B=nabla v_B= gamma v_B, with gamma = constant. We say that the flow has a Beltrami flow structure when it can be put in the form v = U e_z + Omega r e_theta + v_B, being U and Omega constants, i.e it is the superposition of a solid body rotation and translation with a Beltrami one. Therefore, those findings a...

  7. Modelization of coupled heat transfer inside a cylindrical glass block

    Energy Technology Data Exchange (ETDEWEB)

    Tanguier, J.L.; Kheiri, A.; Kleinclauss, J. [Faculte des Sciences, 54 - Vandoeuvre-les-Nancy (France)

    1995-01-01

    Modelization of coupled heat transfer inside a cylindrical glass block. In crystal industry, the furnaces used to warm up glass before forming are supplied with 4 bar pressure gas. They are noisy, polluting and high consumers of energy. To limit these effects and improve the energetic performances, an electrical infrared furnace is studied. To perfect it, it is necessary to identify the mechanisms of heat transfer which govern the evolution of the temperature into a cylindrical semitransparent media. After a long and thorough bibliography relative to the thermo-optical properties of crystal, the measurement of the field of temperature into the cylindrical block during the phases of working is led into the factory. To do this, it was necessary to adapt a reliable technical measurement device adjusted to industrial surrounding. A fundamental analysis of the results allows us to propose a model of the coupled heat transfer (radiation, conduction and convection) inside glass and between glass and its surroundings. The model is built on brightness and it is based on a triple discretization: temporal, spectral and zonal. This model provides the spectral distribution of the infrared radiation and the electrical power necessary to obtain a good heating of the crystal according to the manufactory charges. The first tests made with the experimental furnace, built by us, show that it is possible to warm up glass with infrared radiation and that this proceeding reduces the energy consumption and the nuisances. (authors). 19 refs., 7 figs.

  8. Tunnel Point Cloud Filtering Method Based on Elliptic Cylindrical Model

    Science.gov (United States)

    Zhua, Ningning; Jiaa, Yonghong; Luo, Lun

    2016-06-01

    The large number of bolts and screws that attached to the subway shield ring plates, along with the great amount of accessories of metal stents and electrical equipments mounted on the tunnel walls, make the laser point cloud data include lots of non-tunnel section points (hereinafter referred to as non-points), therefore affecting the accuracy for modeling and deformation monitoring. This paper proposed a filtering method for the point cloud based on the elliptic cylindrical model. The original laser point cloud data was firstly projected onto a horizontal plane, and a searching algorithm was given to extract the edging points of both sides, which were used further to fit the tunnel central axis. Along the axis the point cloud was segmented regionally, and then fitted as smooth elliptic cylindrical surface by means of iteration. This processing enabled the automatic filtering of those inner wall non-points. Experiments of two groups showed coincident results, that the elliptic cylindrical model based method could effectively filter out the non-points, and meet the accuracy requirements for subway deformation monitoring. The method provides a new mode for the periodic monitoring of tunnel sections all-around deformation in subways routine operation and maintenance.

  9. Fluid-structure coupled analysis of underwater cylindrical shells

    Institute of Scientific and Technical Information of China (English)

    AI Shang-mao; SUN Li-ping

    2008-01-01

    Underwater cylindrical shell structures have been found a wide of application in many engineering fields,such as the element of marine,oil platforms,etc.The coupled vibration analysis is a hot issue for these underwater structures.The vibration characteristics of underwater structures are influenced not only by hydrodynamic pressure but also by hydrostatic pressure corresponding to different water depths.In this study,an acoustic finite element method was used to evaluate the underwater structures.Taken the hydrostatic pressure into account in terms of initial stress stiffness,an acoustical fluid-structure coupled analysis of underwater cylindrical shells has been made to study the effect of hydrodynamic pressures on natural frequency and sound radiation.By comparing with the frequencies obtained by the acoustic finite element method and by the added mass method based on the Bessel function,the validity of present analysis was checked.Finally,test samples of the sound radiation of stiffened cylindrical shells were acquired by a harmonic acoustic analysis.The results showed that hydrostatic pressure plays an important role in determining a large submerged body motion,and the characteristics of sound radiation change with water depth. Furthermore,the analysis methods and the results are of significant reference value for studies of other complicated submarine structures.

  10. Microfluidic step-emulsification in a cylindrical geometry

    Science.gov (United States)

    Chakraborty, Indrajit; Leshansky, Alexander M.

    2016-11-01

    The model microfluidic device for high-throughput droplet generation in a confined cylindrical geometry is investigated numerically. The device comprises of core-annular pressure-driven flow of two immiscible viscous liquids through a cylindrical capillary connected co-axially to a tube of a larger diameter through a sudden expansion, mimicking the microfluidic step-emulsifier (1). To study this problem, the numerical simulations of axisymmetric Navier-Stokes equations have been carried out using an interface capturing procedure based on coupled level set and volume-of-fluid (CLSVOF) methods. The accuracy of the numerical method was favorably tested vs. the predictions of the linear stability analysis of core-annular two-phase flow in a cylindrical capillary. Three distinct flow regimes can be identified: the dripping (D) instability near the entrance to the capillary, the step- (S) and the balloon- (B) emulsification at the step-like expansion. Based on the simulation results we present the phase diagram quantifying transitions between various regimes in plane of the capillary number and the flow-rate ratio. MICROFLUSA EU H2020 project.

  11. Determining the axis orientation of cylindrical magnetic flux rope

    Science.gov (United States)

    Rong, Zhaojin; Wan, Weixing; Shen, Chao; Zhang, Tielong; Lui, Anthony; Wang, Yuming; Dunlop, malcolm; Zhang, Yongcun; Zong, Qiugang

    2013-04-01

    We develop a new simple method for inferring the orientation of a magnetic flux rope, which is assumed to be a time-independent cylindrically symmetric structure via the direct single-point analysis of magnetic field structure. The model tests demonstrate that, for the cylindrical flux rope regardless of whether it is force-free or not, the method can consistently yield the axis orientation of the flux rope with higher accuracy and stability than the minimum variance analysis of the magnetic field and the Grad-Shafranov reconstruction technique. Moreover, the radial distance to the axis center and the current density can also be estimated consistently. Application to two actual flux transfer events observed by the four satellites of the Cluster mission demonstrates that the method is more appropriate to be used for the inner part of flux rope, which might be closer to the cylindrical structure, showing good agreement with the results obtained from the optimal Grad-Shafranov reconstruction and the least squares technique of Faraday's law, but fails to produce such agreement for the outer satellite that grazes the flux rope. Therefore, the method must be used with caution.

  12. Optimization analysis on assembly interference of cylindrical roller bearings

    Directory of Open Access Journals (Sweden)

    Zhen-huan Ye

    2015-07-01

    Full Text Available Distribution of loads and contact stress has a great influence on fatigue life of bearings. In view of the fact that the nonload area is ubiquitous in cylindrical roller bearings, there is a method for prolonging the fatigue life design by adjusting the working clearance of cylindrical roller bearings. In this article, optimization model of fatigue life of cylindrical roller bearings is developed with a quasi-dynamic method and calculated method of bearing life based on micro-area contact, considering the effect of assembly interference, temperature rise, and high-speed centrifugation. Aiming to the different geometry parameters and operating parameters of bearings, the effects of assembly interference on bearing fatigue life are discussed. The results show that the optimum fatigue life of roller bearings is achieved at negative working clearance with the loads distributed evenly within half ring. The optimum working clearance of roller bearings is not influenced by radial load. But with the increase in pitch diameter or decrease in rolling elements, the optimum assembly interference increases, and accelerating revolution of roller bearings will increase the optimum assembly interference as well.

  13. Cylindrical Effects on Magneto-Rayleigh-Taylor Instability

    Science.gov (United States)

    Weis, Matthew; Lau, Yue Ying; Gilgenbach, Ronald; Jennings, Christopher; Hess, Mark

    2012-10-01

    This paper concentrates on the effects of cylindrical geometry on the magneto-Rayleigh-Taylor instability (MRT), a major concern in the magnetized liner inertial fusion concept (MagLIF) [1]. Several issues are being studied, such as the Bell-Plesset effect [2], the effects of magnetic shear and feedthrough [3], and the nonzero MRT growth rate that remains (but was hardly noticed) in the k = m = 0 limit in Harris' seminal paper on a cylindrical liner [4], where k and m are respectively the azimuthal and axial wavenumber. We shall use simulation and direct integration of the eigenvalue equation to investigate the importance of the cylindrical geometry, which is particularly relevant in the final stage of compression in the MagLIF concept. [4pt] [1] S. A. Slutz, et. al, Phys. Plasmas 17, 056303 (2010). [0pt] [2] G. I. Bell, Los Alamos Scientific Laboratory, Report LA-1321 (1951); M. S. Plesset, J. Appl. Phys. 25, 96 (1954).[0pt] [3] P. Zhang et al., Phys. Plasmas 19, 200703 (2012); Y. Y. Lau et al., Phys. Rev. E 83, 006405 (2011). [0pt] [4] E. G. Harris, Phys. Fluids 5, 1057 (1962).

  14. Chain-Based Communication in Cylindrical Underwater Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Nadeem Javaid

    2015-02-01

    Full Text Available Appropriate network design is very significant for Underwater Wireless Sensor Networks (UWSNs. Application-oriented UWSNs are planned to achieve certain objectives. Therefore, there is always a demand for efficient data routing schemes, which can fulfill certain requirements of application-oriented UWSNs. These networks can be of any shape, i.e., rectangular, cylindrical or square. In this paper, we propose chain-based routing schemes for application-oriented cylindrical networks and also formulate mathematical models to find a global optimum path for data transmission. In the first scheme, we devise four interconnected chains of sensor nodes to perform data communication. In the second scheme, we propose routing scheme in which two chains of sensor nodes are interconnected, whereas in third scheme single-chain based routing is done in cylindrical networks. After finding local optimum paths in separate chains, we find global optimum paths through their interconnection. Moreover, we develop a computational model for the analysis of end-to-end delay. We compare the performance of the above three proposed schemes with that of Power Efficient Gathering System in Sensor Information Systems (PEGASIS and Congestion adjusted PEGASIS (C-PEGASIS. Simulation results show that our proposed 4-chain based scheme performs better than the other selected schemes in terms of network lifetime, end-to-end delay, path loss, transmission loss, and packet sending rate.

  15. A mathematical model of microalgae growth in cylindrical photobioreactor

    Science.gov (United States)

    Bakeri, Noorhadila Mohd; Jamaian, Siti Suhana

    2017-08-01

    Microalgae are unicellular organisms, which exist individually or in chains or groups but can be utilized in many applications. Researchers have done various efforts in order to increase the growth rate of microalgae. Microalgae have a potential as an effective tool for wastewater treatment, besides as a replacement for natural fuel such as coal and biodiesel. The growth of microalgae can be estimated by using Geider model, which this model is based on photosynthesis irradiance curve (PI-curve) and focused on flat panel photobioreactor. Therefore, in this study a mathematical model for microalgae growth in cylindrical photobioreactor is proposed based on the Geider model. The light irradiance is the crucial part that affects the growth rate of microalgae. The absorbed photon flux will be determined by calculating the average light irradiance in a cylindrical system illuminated by unidirectional parallel flux and considering the cylinder as a collection of differential parallelepipeds. Results from this study showed that the specific growth rate of microalgae increases until the constant level is achieved. Therefore, the proposed mathematical model can be used to estimate the rate of microalgae growth in cylindrical photobioreactor.

  16. Vibration control of cylindrical shells using active constrained layer damping

    Science.gov (United States)

    Ray, Manas C.; Chen, Tung-Huei; Baz, Amr M.

    1997-05-01

    The fundamentals of controlling the structural vibration of cylindrical shells treated with active constrained layer damping (ACLD) treatments are presented. The effectiveness of the ACLD treatments in enhancing the damping characteristics of thin cylindrical shells is demonstrated theoretically and experimentally. A finite element model (FEM) is developed to describe the dynamic interaction between the shells and the ACLD treatments. The FEM is used to predict the natural frequencies and the modal loss factors of shells which are partially treated with patches of the ACLD treatments. The predictions of the FEM are validated experimentally using stainless steel cylinders which are 20.32 cm in diameter, 30.4 cm in length and 0.05 cm in thickness. The cylinders are treated with ACLD patches of different configurations in order to target single or multi-modes of lobar vibrations. The ACLD patches used are made of DYAD 606 visco-elastic layer which is sandwiched between two layers of PVDF piezo-electric films. Vibration attenuations of 85% are obtained with maximum control voltage of 40 volts. Such attenuations are attributed to the effectiveness of the ACLD treatment in increasing the modal damping ratios by about a factor of four over those of conventional passive constrained layer damping (PCLD) treatments. The obtained results suggest the potential of the ACLD treatments in controlling the vibration of cylindrical shells which constitute the major building block of many critical structures such as cabins of aircrafts, hulls of submarines and bodies of rockets and missiles.

  17. Chain-based communication in cylindrical underwater wireless sensor networks.

    Science.gov (United States)

    Javaid, Nadeem; Jafri, Mohsin Raza; Khan, Zahoor Ali; Alrajeh, Nabil; Imran, Muhammad; Vasilakos, Athanasios

    2015-01-01

    Appropriate network design is very significant for Underwater Wireless Sensor Networks (UWSNs). Application-oriented UWSNs are planned to achieve certain objectives. Therefore, there is always a demand for efficient data routing schemes, which can fulfill certain requirements of application-oriented UWSNs. These networks can be of any shape, i.e., rectangular, cylindrical or square. In this paper, we propose chain-based routing schemes for application-oriented cylindrical networks and also formulate mathematical models to find a global optimum path for data transmission. In the first scheme, we devise four interconnected chains of sensor nodes to perform data communication. In the second scheme, we propose routing scheme in which two chains of sensor nodes are interconnected, whereas in third scheme single-chain based routing is done in cylindrical networks. After finding local optimum paths in separate chains, we find global optimum paths through their interconnection. Moreover, we develop a computational model for the analysis of end-to-end delay. We compare the performance of the above three proposed schemes with that of Power Efficient Gathering System in Sensor Information Systems (PEGASIS) and Congestion adjusted PEGASIS (C-PEGASIS). Simulation results show that our proposed 4-chain based scheme performs better than the other selected schemes in terms of network lifetime, end-to-end delay, path loss, transmission loss, and packet sending rate.

  18. Fabrication and analysis of cylindrical resin AFM microcantilevers

    Energy Technology Data Exchange (ETDEWEB)

    Cheneler, D., E-mail: D.Cheneler@bham.ac.uk [School of Mechanical Engineering, The University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Bowen, J. [School of Chemical Engineering, The University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Leigh, S.J.; Purssell, C.P.; Billson, D.R.; Hutchins, D.A. [School of Engineering, University of Warwick, Coventry CV4 7AL (United Kingdom); Ward, M.C.L. [School of Mechanical Engineering, The University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2011-07-15

    In this paper a new method of fabricating cylindrical resin microcantilevers using the Direct Digital Manufacturing (DDM) technique of Micro-stereolithography (MSL) is described. The method is rapid and commercially viable, allowing the fabrication of atomic force microscope (AFM) cantilevers which exhibit much larger spring constants than those currently commercial available. This allows for experimentation in a force regime orders of magnitude higher than currently possible using the AFM. This makes these cantilevers ideally suited for AFM-based depth sensing indentation. Due to their geometry, the assumptions used in the standard Euler-Bernoulli beam theory usually used to analyse AFM cantilevers may no longer be valid. Therefore approximate analytical solutions based on Timoshenko beam theory have been derived for the stiffness and resonant frequency of these cantilevers. Prototypes of the cantilevers have been fabricated and tested. Results show good agreement between experiment and theory. -- Highlights: {yields} Direct Digital Manufacturing (DDM) has been used to make commercially viable AFM cantilevers. {yields} Analytical expressions for resonant frequency of Timoshenko beams has been derived. {yields} Dynamics of cylindrical AFM cantilevers has been discussed. {yields} Expressions for dynamic properties of conical AFM cantilevers has been derived. {yields} Effect of metallisation of cylindrical AFM cantilevers has been discussed.

  19. TUNNEL POINT CLOUD FILTERING METHOD BASED ON ELLIPTIC CYLINDRICAL MODEL

    Directory of Open Access Journals (Sweden)

    N. Zhu

    2016-06-01

    Full Text Available The large number of bolts and screws that attached to the subway shield ring plates, along with the great amount of accessories of metal stents and electrical equipments mounted on the tunnel walls, make the laser point cloud data include lots of non-tunnel section points (hereinafter referred to as non-points, therefore affecting the accuracy for modeling and deformation monitoring. This paper proposed a filtering method for the point cloud based on the elliptic cylindrical model. The original laser point cloud data was firstly projected onto a horizontal plane, and a searching algorithm was given to extract the edging points of both sides, which were used further to fit the tunnel central axis. Along the axis the point cloud was segmented regionally, and then fitted as smooth elliptic cylindrical surface by means of iteration. This processing enabled the automatic filtering of those inner wall non-points. Experiments of two groups showed coincident results, that the elliptic cylindrical model based method could effectively filter out the non-points, and meet the accuracy requirements for subway deformation monitoring. The method provides a new mode for the periodic monitoring of tunnel sections all-around deformation in subways routine operation and maintenance.

  20. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  1. Sub-aperture stitching test of a cylindrical mirror with large aperture

    Science.gov (United States)

    Xue, Shuai; Chen, Shanyong; Shi, Feng; Lu, Jinfeng

    2016-09-01

    Cylindrical mirrors are key optics of high-end equipment of national defense and scientific research such as high energy laser weapons, synchrotron radiation system, etc. However, its surface error test technology develops slowly. As a result, its optical processing quality can not meet the requirements, and the developing of the associated equipment is hindered. Computer Generated-Hologram (CGH) is commonly utilized as null for testing cylindrical optics. However, since the fabrication process of CGH with large aperture is not sophisticated yet, the null test of cylindrical optics with large aperture is limited by the aperture of the CGH. Hence CGH null test combined with sub-aperture stitching method is proposed to break the limit of the aperture of CGH for testing cylindrical optics, and the design of CGH for testing cylindrical surfaces is analyzed. Besides, the misalignment aberration of cylindrical surfaces is different from that of the rotational symmetric surfaces since the special shape of cylindrical surfaces, and the existing stitching algorithm of rotational symmetric surfaces can not meet the requirements of stitching cylindrical surfaces. We therefore analyze the misalignment aberrations of cylindrical surfaces, and study the stitching algorithm for measuring cylindrical optics with large aperture. Finally we test a cylindrical mirror with large aperture to verify the validity of the proposed method.

  2. Commissioning Monte Carlo algorithm for robotic radiosurgery using cylindrical 3D-array with variable density inserts.

    Science.gov (United States)

    Dechambre, D; Baart, V; Cucchiaro, S; Ernst, C; Jansen, N; Berkovic, P; Mievis, C; Coucke, P; Gulyban, A

    2017-01-01

    To commission the Monte Carlo (MC) algorithm based model of CyberKnife robotic stereotactic system (CK) and evaluate the feasibility of patient specific QA using the ArcCHECK cylindrical 3D-array (AC) with Multiplug inserts (MP). Four configurations were used for simple beam setup and two for patient QA, replacing water equivalent inserts by lung. For twelve collimators (5-60mm) in simple setup, mean (SD) differences between MC and RayTracing algorithm (RT) of the number of points failing the 3%/1mmgamma criteria were 1(1), 1(3), 1(2) and 1(2) for the four MP configurations. Tracking fiducials were placed within AC for patient QA. Single lung insert setup resulted in mean gamma-index 2%/2mm of 90.5% (range [74.3-95.9]) and 82.3% ([66.8-94.5]) for MC and RT respectively, while 93.5% ([86.8-98.2]) and 86.2% ([68.7-95.4]) in presence of largest inhomogeneities, showing significant differences (pfilter free (FFF) delivery. Further improvement of MC calculation might be challenging as Multiplan has limited material library. The AC with Multiplug allowed for comprehensive commissioning of CyberKnife MC algorithm and is useful for patient specific QA for stereotactic body radiation therapy. MC calculation accuracy might be limited due to Multiplan's insufficient material library; still results are comparable with other reported commissioning measurements using FFF beams. Copyright © 2017 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  3. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  4. Analysis of energy processes in pulse converters of AC electric power

    Directory of Open Access Journals (Sweden)

    Kadatsky A.F.

    2015-02-01

    Full Text Available The article presents the analysis of energy processes in switched-mode AC-AC converters of buck, boost and buck-boost types. The mathematical model of energy processes is obtained. The mathematical model is generalized to DC-DC and AC-AC converters, to three basic types of converters and considers possibility of autotransformer inclusion of an inductor. It is shown that the use of bi-directional switches allows both DC and AC conversion of electrical energy regardless of the load type and also supports recuperation of electrical energy back to the source. It is shown that the maximum value of instant power in a load circuit in AC—AC converters exceeds twice the rated value of load power in comparison with DC—DC converters. It is shown that the energy capacity of an inductor in AC—AC converters exceeds twice the energy capacity of DC—DC converters at the identical rated power of conversion. It is shown that the energy capacity of an inductor in converters of buck and boost types depends on the ratio of input and output voltage. Also, the energy capacity of an inductor in converters of buck-boost type does not depend on the ratio of input and output voltage. It is shown that the energy capacity of an inductor in converters of buck and boost types is lower than the energy capacity of an inductor in the converter of buck-boost type.

  5. Phase-sensitive detection of both inductive and non-inductive ac voltages in ferromagnetic resonance

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M.; Nembach, Hans T.; Schoen, Martin A.; Boone, Carl T.; Silva, Thomas J.

    2014-03-01

    Spin pumping causes significant damping in ultrathin ferromagnetic/normal metal (NM) multilayers via spin-current generation of both dc and ac character in the NM system. While the nonlinear dc component has been investigated in detail by utilization of the inverse spin Hall effect (iSHE) in NMs, much less is known about the linear ac component that is presumably much larger in the small-excitation limit. We measured generated ac voltages in a wide variety of Permalloy/NM multilayers via vector-network-analyzer ferromagnetic resonance. We employ a custom, impedance-matched, broadband microwave coupler that features a ferromagnetic thin film reference resonator to accurately compare ac voltage amplitudes and phases between varieties of multilayers. By use of the fact that inductive and ac iSHE signals are phase-shifted by π/2, we find that inductive signals are major contributors in all investigated samples. It is only by comparison of the phase and amplitude of the recorded ac voltages between multiple samples that we can extract the non-inductive contributions due to spin-currents. Voltages due to the ac iSHE in Permalloy(10nm)/platinum(5nm) bilayers are weaker than inductive signals, in agreement with calculations based upon recent theoretical predictions. M.W. acknowledges financial support by the German Academic Exchange service (DAAD).

  6. The effects of theta transcranial alternating current stimulation (tACS) on fluid intelligence.

    Science.gov (United States)

    Pahor, Anja; Jaušovec, Norbert

    2014-09-01

    The objective of the study was to explore the influence of transcranial alternating current stimulation (tACS) on resting brain activity and on measures of fluid intelligence. Theta tACS was applied to the left parietal and left frontal brain areas of healthy participants after which resting electroencephalogram (EEG) data was recorded. Following sham/active stimulation, the participants solved two tests of fluid intelligence while their EEG was recorded. The results showed that active theta tACS affected spectral power in theta and alpha frequency bands. In addition, active theta tACS improved performance on tests of fluid intelligence. This influence was more pronounced in the group of participants that received stimulation to the left parietal area than in the group of participants that received stimulation to the left frontal area. Left parietal tACS increased performance on the difficult test items of both tests (RAPM and PF&C) whereas left frontal tACS increased performance only on the easy test items of one test (RAPM). The observed behavioral tACS influences were also accompanied by changes in neuroelectric activity. The behavioral and neuroelectric data tentatively support the P-FIT neurobiological model of intelligence.

  7. Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2016-06-01

    Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

  8. New matrix method for response analysis of circumferentially stiffened non-circular cylindrical shells under harmonic pressure

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Based on the governing equation of vibration of a kind of cylindrical shells written in a matrix differential equation of the first order, a new matrix method is presented for steady-state vibration analysis of a noncircular cylindrical shell simply supported at two ends and circumferentially stiffened by rings under harmonic pressure. Its difference from the existing works by Yamada and Irie is that the matrix differential equation is solved by using the extended homogeneous capacity precision integration approach other than the Runge-Kutta-Gill integration method. The transfer matrix can easily be determined by a high precision integration scheme. In addition, besides the normal interacting forces, which were commonly adopted by researchers earlier, the tangential interacting forces between the cylindrical shell and the rings are considered at the same time by means of the Dirac-δ function. The effects of the exciting frequencies on displacements and stresses responses have been investigated. Numerical results show that the proposed method is more efficient than the aforementioned method.

  9. Magnetisation reversal in cylindrical nickel nanobars involving magnetic vortex structure: A micromagnetic study

    Energy Technology Data Exchange (ETDEWEB)

    Barpanda, Prabeer, E-mail: prabeer.barpanda@u-picardie.f [Laboratoire de Reactivite et Chimie des Solides, Universite de Picardie Jules Verne, 33 rue Saint Leu, Amiens Cedex 80039 (France); Department of Chemistry, Dalhousie University, Halifax, Nova Scotia, B3H 3J5 (Canada)

    2011-03-15

    A three-dimensional, Fast-Fourier-Transformed (3D-FFT) micromagnetic simulation was employed to study the magnetization reversal mechanisms in cylindrical nickel nanobars possessing magnetic vortices. Individual Ni nanobars of height 150-250 nm with aspect ratio varying from 2.1 to 2.5 were considered, all of them supporting magnetic vortices domains. Magnetization reversal in these nanobars involves the vortex-creation-annihilation (VCA) mechanism with an inversion symmetry feature observed mid-way during reversal process. The effect of incidence angle of externally applied field on overall magnetization reversal process is examined in detail. The corresponding variations in coercivity, squareness, exchange energy and vortex parameters are described by the micromagnetic study that can shed insights for building practical Ni nanobars magnetic nanostructures/devices.

  10. Solitary Wave Solutions of KP equation, Cylindrical KP Equation and Spherical KP Equation

    Science.gov (United States)

    Li, Xiang-Zheng; Zhang, Jin-Liang; Wang, Ming-Liang

    2017-02-01

    Three (2+1)-dimensional equations-KP equation, cylindrical KP equation and spherical KP equation, have been reduced to the same KdV equation by different transformation of variables respectively. Since the single solitary wave solution and 2-solitary wave solution of the KdV equation have been known already, substituting the solutions of the KdV equation into the corresponding transformation of variables respectively, the single and 2-solitary wave solutions of the three (2+1)-dimensional equations can be obtained successfully. Supported by the National Natural Science Foundation of China under Grant No. 11301153 and the Doctoral Foundation of Henan University of Science and Technology under Grant No. 09001562, and the Science and Technology Innovation Platform of Henan University of Science and Technology under Grant No. 2015XPT001

  11. Numerical and Analytical Calculation of Bernstein Resonances in a Non-Uniform Cylindrical Plasma

    Science.gov (United States)

    Walsh, D. K.; Dubin, D. H. E.

    2016-10-01

    This poster presents theory and numerical predictions of electrostatic Bernstein modes in a cylindrical non-neutral plasma column with multiple ion species. These modes propagate radially across the column until they are reflected when their frequency matches the local upper hybrid frequency, setting up an internal normal mode on the column, and also mode-coupling to the electrostatic surface cyclotron wave (which allows the normal mode to be excited and observed using external electrodes). Using our linear Vlasov code discussed last year, we present several numerical results at various magnetic fields, eilθ-dependencies, and plasma profiles in order to make quantitative predictions of future cyclotron wave experiments. These results are compared to the semi-analytic WKB theory in order to determine under what conditions Bernstein waves are measurable at the wall. Supported by NSF Grant PHY-1414570, and DOE Grants DE-SC0002451.

  12. Structural concept studies for a horizontal cylindrical lunar habitat and a lunar guyed tower

    Science.gov (United States)

    Yin, Paul K.

    1990-01-01

    A conceptual structural design of a horizontal cylindrical lunar habitat is presented. The design includes the interior floor framing, the exterior support structure, the foundation mat, and the radiation shielding. Particular attention was given on its efficiency in shipping and field erection, and on selection of structural materials. Presented also is a conceptual design of a 2000-foot lunar guyed tower. A special field erection scheme is implemented in the design. In order to analyze the over-all column buckling of the mast, where its axial compression includes its own body weight, a simple numerical procedure is formulated in a form ready for coding in FORTRAN. Selection of structural materials, effect of temperature variations, dynamic response of the tower to moonquake, and guy anchoring system are discussed. Proposed field erection concepts for the habitat and for the guyed tower are described.

  13. Fabrication technology for a series of cylindrical thin-wall cavity targets

    CERN Document Server

    Zheng Yong; Sun Zu Oke; Wang Ming Da; Zhou La; Zhou Zhi Yun

    2002-01-01

    Cylindrical thin-wall cavity targets have been fabricated to study the behavior of superthermal electrons and their effects on inertial confinement fusion (ICF). Self-supporting cavity targets having adjustable, uniform wall thickness, and low surface roughness were required. This required production of high-quality mandrels, coating them by sputtering or electroplating, developing techniques for measurement of wall thickness and other cavity parameters, improving the uniformity of rotation of the mandrels, and preventing damage to the targets during removal from the mandrels. Details of the fabrication process are presented. Experimental results from the use of these targets are presented. These results, in good agreement with simulations, indicate that the use of thin-wall cavity targets is an effective method for studying superthermal electrons in ICF.

  14. 2D HYDRA Calculations of Magneto-Rayleigh-Taylor Growth and Feedthrough in Cylindrical Liners

    Science.gov (United States)

    Weis, Matthew; Zhang, Peng; Lau, Y. Y.; Gilgenbach, Ronald; Peterson, Kyle; Hess, Mark

    2014-10-01

    Cylindrical liner implosions are susceptible to the magneto-Rayleigh-Taylor instability (MRT), along with the azimuthal current-carrying modes (sausage, kink, etc). ``Feedthrough'' of these instabilities has a strong influence on the integrity of the liner/fuel interface in the magnetized liner inertial fusion concept (MagLIF). The linearized ideal MHD equations can be solved to quantify these effects, including the presence of an effective gravity and an axial magnetic field. We investigate the potential of this field to mitigate feedthrough, due to MRT growth from various initial surface finishes (seeded, rough), throughout the implosion using our analytic results and the LLNL code, HYDRA. We will present both low and high convergence cases. Lastly, we illustrate the effect shock compression can have on feedthrough in seeded liners for various fill gases (cold and pre-heated) and magnetic field configurations. M. R. Weis was supported by the Sandia National Laboratories.

  15. Dynamics and Stability of Pinned-Clamped and Clamped-Pinned Cylindrical Shells Conveying Fluid

    Science.gov (United States)

    Misra, A. K.; Wong, S. S. T.; Païdoussis, M. P.

    2001-11-01

    The paper examines the dynamics and stability of fluid-conveying cylindrical shells having pinned-clamped or clamped-pinned boundary conditions, where ``pinned'' is an abbreviation for ``simply supported''. Flügge's equations are used to describe the shell motion, while the fluid-dynamic perturbation pressure is obtained utilizing the linearized potential flow theory. The solution is obtained using two methods - the travelling wave method and the Fourier-transform approach. The results obtained by both methods suggest that the negative damping of the clamped-pinned systems and positive damping of the pinned-clamped systems, observed by previous investigators for any arbitrarily small flow velocity, are simply numerical artefacts; this is reinforced by energy considerations, in which the work done by the fluid on the shell is shown to be zero. Hence, it is concluded that both systems are conservative.

  16. Research of wind and snow cover loads on the roofs of the vertical cylindrical tanks

    Directory of Open Access Journals (Sweden)

    A.A. Semenov

    2012-08-01

    Full Text Available The widespread use of vertical cylindrical tanks puts the question of their sustainable design. Snow load brings the greatest contribution to the stress-strain state of the supporting structures of vertical tanks spherical domed coatings in the IV-VIII snowy areas of Russia.New geometrical forms of the tank coatings with volume 20 000 m3 were developed. The results of aerodynamic research of proposed coatings model were presented.The coefficients of the external pressure on the surface of the walls and coating of the tank were determined. Qualitative and quantitative picture of the snowy mass under the influence of the wind were also determined.The obtained results can be used to develop effective design solutions for domed coatings of the oil tanks.

  17. Study on the Carbon-Methanation and Catalytic Activity of Ru/AC for Ammonia Synthesis

    Institute of Scientific and Technical Information of China (English)

    祝一锋; 李小年; 季德春; 刘化章

    2004-01-01

    The effects of promoters K, Ba, Sm on the resistance to carbon-methanation and catalytic activity of ruthenium supported on active carbon (Ru/AC) for ammonia synthesis have been studied by means of TG-DTG (thermalgravity-differential thermalgravity), temperature-programmed desorption, and activity test. Promoters Ba,K, and Sm increased the activity of Ru/AC catalysts for ammonia synthesis significantly. Much higher activity can be reached for Ru/AC catalyst with bi- or tri-promoters. Indeed, the triply promoted catalyst showed the highest activity, coupled to a surprisingly high resistance to methanation. The ability of resistance of promoter to methanation of Ru/AC catalyst is dependent on the adsorption intensity of hydrogen. The strong adsorption of hydrogen would enhance methanation and impact the adsorption of nitrogen, which results in the decrease of catalytic activity.

  18. The analysis of the bending stiffness and intensity of cylindrical tubes

    Institute of Scientific and Technical Information of China (English)

    SONG YuQuan; GUAN ZhiPing; NIE YuQin; GUAN XiaoFang

    2007-01-01

    Based on the mechanics of material, the bending stiffness and intensity of cylindrical bar and tube are analyzed. By comparing the cylindrical tube whose ratio of outside diameter to internal diameter is 0.7 with the cylindrical bar, it is concluded that when both of them have the same mass, the section stiffness of the cylindrical tube is three times that of the cylindrical bar; when both of them have the same external diameter, the mass of the cylindrical tube is only 1/2 that of the cylindrical bar, but the section stiffness of the cylindrical tube is 3/4 that of the cylindrical bar.By virtue of the elemental elastic-plastic theory, the yield stress of the liquid-filled cylindrical tube is investigated. Due to the incompressibility of liquid and the strain hardening effect of material, the yield stress of the liquid-filled tube is enlarged compared with the hollow tube, thus raising its bending intensity. Under the dynamic load, compared with the hollow tube, the impact resistance of the liquid-filled tube is also raised due to elastic recovery. Because the hydraulic pressures perpendicular to the inner surface are identical everywhere, the local stress concentration resulting from the ovalisation of the tube would be decreased, and the resistance to buckling would be improved.

  19. The analysis of the bending stiffness and intensity of cylindrical tubes

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Based on the mechanics of material,the bending stiffness and intensity of cylin-drical bar and tube are analyzed. By comparing the cylindrical tube whose ratio of outside diameter to internal diameter is 0.7 with the cylindrical bar,it is concluded that when both of them have the same mass,the section stiffness of the cylindrical tube is three times that of the cylindrical bar;when both of them have the same external diameter,the mass of the cylindrical tube is only 1/2 that of the cylindrical bar,but the section stiffness of the cylindrical tube is 3/4 that of the cylindrical bar. By virtue of the elemental elastic-plastic theory,the yield stress of the liquid-filled cylindrical tube is investigated. Due to the incompressibility of liquid and the strain hardening effect of material,the yield stress of the liquid-filled tube is enlarged compared with the hollow tube,thus raising its bending intensity. Under the dy-namic load,compared with the hollow tube,the impact resistance of the liquid-filled tube is also raised due to elastic recovery. Because the hydraulic pressures per-pendicular to the inner surface are identical everywhere,the local stress concen-tration resulting from the ovalisation of the tube would be decreased,and the re-sistance to buckling would be improved.

  20. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  1. Three-step cylindrical seal for high-performance turbomachines

    Science.gov (United States)

    Hendricks, Robert C.

    1987-01-01

    A three-step cylindrical seal configuration representing the seal for a high performance turbopump (e.g., the space shuttle main engine fuel pump) was tested under static (nonrotating) conditions. The test data included critical mass flux and pressure profiles over a wide range of inlet temperatures and pressures for fluid nitrogen and fluid hydrogen with the seal in concentric and fully eccentric positions. The critical mass flux (leakage rate) was 70% that of an equivalent straight cylindrical seal with a correspondingly higher pressure drop based on the same flow areas of 0.3569 sq cm but 85% that of the straight seal based on the third-step flow area of 0.3044 sq cm. The mass flow rates for the three step cylindrical seal in the fully eccentric and concentric positions were essentially the same, and the trends in flow coefficient followed those of a simple axisymmetric inlet configuration. However, for inlet stagnation temperatures less than the thermodynamic critical temperature the pressure profiles exhibited a flat region throughout the third step of the seal, with the pressure magnitude dependent on the inlet stagnation temperature. Such profiles represent an extreme positive direct stiffness. These conditions engendered a crossover in the pressure profile upstream of the postulated choke that resulted in a local negative stiffness. Flat and crossover profiles resulting from choking within the seal are practically unknown to the seal designer. However, they are of critical importance to turbomachine stability and must be integrated into any dynamic analysis of a seal of this configuration. In addition, choking is highly dependent on geometry, inlet-to-backpressure ratio, and inlet temperature and can occur within the seal even though the backpressure is above the critical pressure.

  2. Interaction of cylindrically converging diffracted shock with uniform interface

    Science.gov (United States)

    Liang, Yu; Ding, Juchun; Zhai, Zhigang; Si, Ting; Luo, Xisheng

    2017-08-01

    The Richtmyer-Meshkov instability of an unperturbed air/SF6 interface subjected to a diffracted shock is experimentally studied by high-speed schlieren photography under cylindrical circumstances. The cylindrically converging diffracted shock (CCDS) is produced by a cylindrically uniform shock diffracting around a rigid cylinder(s), and the unperturbed interface is created by a soap film technique. The effects of coupling of multiple rigid cylinders and diverse spacings from the cylinder to interface on a flow field are highlighted. Schlieren images indicate that the amplitude of disturbances on the CCDS increases compared with the local shock radius. After the CCDS impact, a bulge is derived from the interface due to the shock-shock interaction inside the interface, and the number of bulges depends upon the number of cylinders. As the number of cylinders increases, the bulge becomes less pronounced, which is ascribed to additional shock-shock interactions inside the volume. As the distance between the cylinder and interface increases, an air cavity is first observed before the formation of a bulge. The amplitude of perturbation on the interface is found to reduce before the central reflected shock arrival because of the Rayleigh-Taylor stabilization effect. Through equating the pre-interface disturbance of the CCDS to the pre-shock perturbation of the perturbed interface, the initially linear growth rate is theoretically computed based on the impulsive model considering the Bell-Plesset effect. The theoretical results are found to deviate greatly from the experimental counterparts. Instead, taking the post-shock interface amplitude as an initial interface amplitude, the model works well. Therefore, the interface perturbations produced are notably smaller than the disturbances causing them. Moreover, the nonlinear behavior of perturbation growth is estimated by the model considering the Rayleigh-Taylor effect.

  3. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  4. Finite-amplitude waves in cylindrical lined ducts

    Science.gov (United States)

    Nayfeh, A. H.; Tsai, M.-S.

    1974-01-01

    A second-order uniformly valid expansion is obtained for nonlinear waves propagating in a cylindrical duct lined with a point-reacting acoustic material that consists of a porous sheet followed by honey-comb cavities and backed by the impervious walls of the duct. The effect of the liner is taken into account by coupling the waves in the duct with those in the liner. As in the two-dimensional case, the nonlinearity increases the attenuation rate at all frequencies except in narrow bandwidths around the resonant frequencies, irrespective of the geometrical dimensions of the liner or the acoustic properties of the porous sheet.

  5. PERFORATION OF PLASTIC SPHERICAL SHELLS UNDER IMPACT BY CYLINDRICAL PROJECTILES

    Institute of Scientific and Technical Information of China (English)

    NING Jian-guo; SONG Wei-dong

    2006-01-01

    The objective is to study the perforation of a plastic spherical shell impacted by a cylindrical projectile. First, the deformation modes of the shell were given by introducing an isometric transformation. Then, the perforation mechanism of the shell was analyzed and an analytical model was advanced. Based on Hamilton principle, the governing equation was obtained and solved using Runge-Kuta method. Finally, some important theoretical predictions were given to describe the perforation mechanism of the shell. The results will play an important role in understanding the perforation mechanism of spherical shells impacted by a projectile.

  6. Metamaterial Structure Design Optimization: A Study of the Cylindrical Cloak

    Science.gov (United States)

    2013-03-01

    energy. iv First, I wish to thank God and my savior, Jesus Christ , for the opportunity to study His creation. Next, a big thank-you goes to my loving wife...requirements to create a more physically realizable set of material parameters. 6 2.1 TO Cylindrical Cloak Originally , TO was conceived in an effort to avoid...TO method to designing a cloak consists of deforming the coordinate system such that the origin point is expanded into a boundary around an area to be

  7. Polar POLICRYPS diffractive structures generate cylindrical vector beams

    Energy Technology Data Exchange (ETDEWEB)

    Alj, Domenico; Caputo, Roberto, E-mail: roberto.caputo@fis.unical.it; Umeton, Cesare [Department of Physics and CNR-NANOTEC University of Calabria, I-87036 Rende (CS) (Italy); Paladugu, Sathyanarayana [Soft Matter Lab, Department of Physics, Bilkent University, Ankara 06800 (Turkey); Volpe, Giovanni [Soft Matter Lab, Department of Physics, Bilkent University, Ankara 06800 (Turkey); UNAM-National Nanotechnology Research Center, Bilkent University, Ankara 06800 (Turkey)

    2015-11-16

    Local shaping of the polarization state of a light beam is appealing for a number of applications. This can be achieved by employing devices containing birefringent materials. In this article, we present one such enables converting a uniformly circularly polarized beam into a cylindrical vector beam (CVB). This device has been fabricated by exploiting the POLICRYPS (POlymer-LIquid CRYstals-Polymer-Slices) photocuring technique. It is a liquid-crystal-based optical diffraction grating featuring polar symmetry of the director alignment. We have characterized the resulting CVB profile and polarization for the cases of left and right circularly polarized incoming beams.

  8. DYNAMICAL BEHAVIOR OF VISCOELASTIC CYLINDRICAL SHELLS UNDER AXIAL PRESSURES

    Institute of Scientific and Technical Information of China (English)

    程昌钧; 张能辉

    2001-01-01

    The hypotheses of the Kármán-Donnell theory of thin shells with large deflections and the Boltzmann laws for isotropic linear, viscoelastic materials, the constitutive equations of shallow shells are first derived. Then the governing equations for the deflection equations of elastic thin plates. Introducing proper assumptions, an approximate theory for viscoelastic cylindrical shells under axial pressures can be obtained. Finally, the dynamical behavior is studied in detail by using several numerical methods. Dynamical properties,such as, hyperchaos , chaos, strange attractor, limit cycle etc., are discovered.

  9. Colliding wall-jets on a cylindrical surface

    Science.gov (United States)

    Tesař, Václav; Peszynski, Kazimierz

    2015-05-01

    Paper discusses aerodynamics and potential engineering applications of an unusual and in literature practically unknown fluid flow configuration, with two wall-jets attached to a cylindrical surface so that they collide head-on and by mutual conjunction generate a single jet directed away from the wall. Applications are envisaged in pneumatic sensors, particularly those operating at low Reynolds numbers. Performed experimental investigation, combined with numerical flowfield computations, revealed several interesting aspects. The most interesting among them is the discovery of symmetry-breaking existence of three different stable flow regimes. This opens a possibility for fluidic tristable amplifiers and systems operating with ternary logic.

  10. ANALYSIS OF TRANSIENT THERMAL STRESS IN CYLINDRICALLY ORTHOTROPIC TUBES

    Institute of Scientific and Technical Information of China (English)

    凌道盛

    2003-01-01

    The incorrect deduction of equations in the research works devoted to the studies of transient stress in cylindrically orthotropic tubes and done by Kardomateas ( Journal of Applied Mechanics, 1989, 1990) leads to the wrong results. The errata (1991) correct the deduction error, but do not give the right numerical results. All errors are corrected, and the Mathematica is adopted to solve the large argument problem for Bessel function. A theoretical solution of the transient thermal stresses in tubes with uniform form is presented,and a numerical example is studied.

  11. Cylindrical Three-Dimensional Porous Anodic Alumina Networks

    Directory of Open Access Journals (Sweden)

    Pedro M. Resende

    2016-11-01

    Full Text Available The synthesis of a conformal three-dimensional nanostructure based on porous anodic alumina with transversal nanopores on wires is herein presented. The resulting three-dimensional network exhibits the same nanostructure as that obtained on planar geometries, but with a macroscopic cylindrical geometry. The morphological analysis of the nanostructure revealed the effects of the initial defects on the aluminum surface and the mechanical strains on the integrity of the three-dimensional network. The results evidence the feasibility of obtaining 3D porous anodic alumina on non-planar aluminum substrates.

  12. Experimental comparison of symmetry in rugby and cylindrical holhraums

    Science.gov (United States)

    Philippe, Franck; Tassin, Veronique; Laffite, Stephane; Monteil, Marie-Christine; Bastian, Josiane; Lours, Laurence; Villette, Bruno; Stemmler, Philippe; Bednarczyk, Sophie; Reneaume, Benoit; di Nicola, Pascale; Raffin, Vincent

    2007-11-01

    Recently, holhraum shape optimization has been investigated as a practical way to achieve ignition at lower energy [1][2]. Rugby shaped holhraums theoretically allow better energetic coupling and symmetry control than classical cylinders. As a first step toward an experimental validation of this design, this talk presents the results of experiments on the OMEGA laser facility dedicated to the comparison of symmetry in cylindrical and rugby holhraums. Foamball radiographs and Symcaps emission contours for both type of holhraums are compared to numerical simulation results. [1] M. Vandenboomgaerde et al., accepted by Phys. Rev. Lett. [2] P. Amendt et al., Phys. Plasmas 14, 056312 (2007)

  13. Phase transition properties of a cylindrical ferroelectric nanowire

    Indian Academy of Sciences (India)

    Wang Ying; Yang Xiong

    2013-11-01

    Based on the transverse Ising model (TIM) and using the mean-field theory, we investigate the phase transition properties of a cylindrical ferroelectric nanowire. Two different kinds of phase diagrams are constructed. We discuss systematically the effects of exchange interactions and the transverse field parameters on the phase diagrams. Moreover, the cross-over features of the parameters from the ferroelectric dominant phase diagram to the paraelectric dominant phase diagram are determined for the ferroelectric nanowire. In addition, the polarizations of the surface shell and the core are illustrated in detail by modifying the TIM parameters.

  14. PCM thermal energy storage in cylindrical containers of various configurations

    Science.gov (United States)

    Mujumdar, A. S.; Ashraf, F. A.; Menon, A. S.; Weber, M. E.

    Experimental measurements are reported for the time variation of surface-averaged rate of heat storage during melting in single, thin-walled cylindrical containers of copper filled with a commercially available paraffin wax. For the wax used the enthalpy-temperature curve was obtained using a differential scanning calorimeter according to the ASTM method. Three lengths and three equivalent diameters of plain circular, plain square and internally partitioned cylinders were studied for their heat storage characteristics. The heat transfer measurements revealed the importance of natural convection during melting. The effects of cylinder geometry and temperature of the external fluid on instantaneous and integral heat storage rate were examined experimentally.

  15. Experimental Investigations of Compressed Sandwich Composite/Honeycomb Cylindrical Shells

    Science.gov (United States)

    Muc, A.; Stawiarski, A.; Romanowicz, P.

    2017-06-01

    This article explains in some details the behaviour of thick, deep cylindrical sandwich panels subjected to compressive loads. In general, experimental results indicated that two different forms of failure have been observed - the first corresponds to the overall buckling and the second to the facesheet wrinkling. The obtained experimentally damages of shells are verified and validated with the use of the FE analysis, 2-D and 3-D both in the linear and non-linear approach. The unidirectional strain gauges were applied to detect the initiation of the overall buckling mode.

  16. Interaction of Explosive Shocks with Airborne Cylindrical Targets of Elliptical

    Directory of Open Access Journals (Sweden)

    V.P. Singh

    1990-07-01

    Full Text Available A theoretical model to find pressure-space history around a cylindrical target of elliptical cross-section has been presented for assessing the damage by warheads exploding in the vicinity of an airborne vehicle. The energy hypothesis has been used to find the attenuation law from a point explosion. The Whitham-Bryson and Gross theory for shock interaction has been modified to take into account the finite strength of incident shock. The theoretical results have also been compared with Heilig's experimental results.

  17. Three-dimensional global fluid simulations of cylindrical magnetized plasmas

    DEFF Research Database (Denmark)

    Naulin, Volker; Windisch, T.; Grulke, O.

    2008-01-01

    . Thus, it is possible to assess the reproductive and predictive capabilities of plasma simulations in unprecedented detail. Here, three-dimensional global fluid simulations of a cylindrical magnetized plasma are presented. This plasma is characterized by the existence of spatially localized sources...... and sinks. The traditional scale separation paradigm is not applied in the simulation model to account for the important evolution of the background profiles due to the dynamics of turbulent fluctuations. Furthermore, the fluid modeling of sheath boundary conditions, which determine the plasma conditions...

  18. Preliminary analysis techniques for ring and stringer stiffened cylindrical shells

    Science.gov (United States)

    Graham, J.

    1993-03-01

    This report outlines methods of analysis for the buckling of thin-walled circumferentially and longitudinally stiffened cylindrical shells. Methods of analysis for the various failure modes are presented in one cohesive package. Where applicable, more than one method of analysis for a failure mode is presented along with standard practices. The results of this report are primarily intended for use in launch vehicle design in the elastic range. A Microsoft Excel worksheet with accompanying macros has been developed to automate the analysis procedures.

  19. Radiation from a charge rotating inside a cylindrical grating

    Science.gov (United States)

    Kotanjyan, A. S.; Mkrtchyan, A. R.; Saharian, A. A.

    2017-07-01

    We investigate the spectral-angular distribution for the radiation emitted by a point charge moving along a helical trajectory inside a cylindrical grating with conducting strips. Two types of the radiation processes are realized: undulator and Smith-Purcell radiations. Their relative contributions to the total radiation intensity are discussed in various asymptotic regions of the parameters describing the diffraction grating and for large harmonics. The region of the parameters is specified for which the interference effects between the undulator and Smith-Purcell radiations are essential.

  20. Magnetic forces between arrays of cylindrical permanent magnets

    DEFF Research Database (Denmark)

    Vokoun, D.; Tomassetti, G.; Beleggia, Marco

    2011-01-01

    Permanent magnet arrays are often employed in a broad range of applications: actuators, sensors, drug targeting and delivery systems, fabrication of self-assembled particles, just to name a few. An estimate of the magnetic forces in play between arrays is required to control devices and fabrication...... procedures. Here, we introduce analytical expressions for calculating the attraction force between two arrays of cylindrical permanent magnets and compare the predictions with experimental data obtained from force measurements with NdFeB magnets. We show that the difference between predicted and measured...

  1. The hydrodynamic instability of powerful cylindrical magnetohydrodynamic pumps

    Energy Technology Data Exchange (ETDEWEB)

    Valdmane, R.A.; Ulmanis, L.Ya.; Valdamanis, Ya.Ya.

    1984-01-01

    A numerical calculation is the basis for analyzing the issues of stability of the speed profile in channels of powerful cylindrical magnetohydrodynamic (MGD) pumps. A one dimensional hydraulic model is used in the calculations. The questions about stability of movement relative to transverse perturbations in speed are discussed. It is shown that at high values of the parameter epsilon and the radius of the channel the movement is unstable with respect to the transverse shifts. The results are of interest for studies of liquid metal magnetohydrodynamic generators.

  2. Finite Amplitude Electron Plasma Waves in a Cylindrical Waveguide

    DEFF Research Database (Denmark)

    Juul Rasmussen, Jens

    1978-01-01

    The nonlinear behaviour of the electron plasma wave propagating in a cylindrical plasma waveguide immersed in an infinite axial magnetic field is investigated using the Krylov-Bogoliubov-Mitropolsky perturbation method, by means of which is deduced the nonlinear Schrodinger equation governing...... the long-time slow modulation of the wave amplitude. From this equation the amplitude-dependent frequency and wavenumber shifts are calculated, and it is found that the electron waves with short wavelengths are modulationally unstable with respect to long-wavelength, low-frequency perturbations...

  3. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  4. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  5. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  6. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  7. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  8. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  9. Liquid bridging of cylindrical colloids in near-critical solvents

    Science.gov (United States)

    Labbé-Laurent, M.; Law, A. D.; Dietrich, S.

    2017-09-01

    Within mean field theory, we investigate the bridging transition between a pair of parallel cylindrical colloids immersed in a binary liquid mixture as a solvent that is close to its critical consolute point Tc. We determine the universal scaling functions of the effective potential and of the force between the colloids. For a solvent that is at the critical concentration and close to Tc, we find that the critical Casimir force is the dominant interaction at close separations. This agrees very well with the corresponding Derjaguin approximation for the effective interaction between the two cylinders, while capillary forces originating from the extension of the liquid bridge turn out to be more important at large separations. In addition, we are able to infer from the wetting characteristics of the individual colloids the first-order transition of the liquid bridge connecting two colloidal particles to the ruptured state. While specific to cylindrical colloids, the results presented here also provide an outline for identifying critical Casimir forces acting on bridged colloidal particles as such and for analyzing the bridging transition between them.

  10. Cylindrical acoustical holography applied to full-scale jet noise.

    Science.gov (United States)

    Wall, Alan T; Gee, Kent L; Neilsen, Tracianne B; Krueger, David W; James, Michael M

    2014-09-01

    Near-field acoustical holography methods are used to predict sound radiation from an engine installed on a high-performance military fighter aircraft. Cylindrical holography techniques are an efficient approach to measure the large and complex sound fields produced by full-scale jets. It is shown that a ground-based, one-dimensional array of microphones can be used in conjunction with a cylindrical wave function field representation to provide a holographic reconstruction of the radiated sound field at low frequencies. In the current work, partial field decomposition methods and numerical extrapolation of data beyond the boundaries of the hologram aperture are required prior to holographic projection. Predicted jet noise source distributions and directionality are shown for four frequencies between 63 and 250 Hz. It is shown that the source distribution narrows and moves upstream, and that radiation directionality shifts toward the forward direction, with increasing frequency. A double-lobe feature of full-scale jet radiation is also demonstrated.

  11. Progress on Diamond-Based Cylindrical Dielectric Accelerating Structures

    Science.gov (United States)

    Kanareykin, A.; Schoessow, P.; Conde, M.; Gai, W.

    2006-11-01

    The development of a high gradient diamond-based cylindrical dielectric loaded accelerator (DLA) is presented. A diamond-loaded DLA can potentially sustain accelerating gradients far in excess of the limits experimentally observed for conventional metallic accelerating structures. The electrical and mechanical properties of diamond make it an ideal candidate material for use in dielectric accelerators: high rf breakdown level, extremely low dielectric losses and the highest available thermoconductive coefficient. We used the hot-filament Chemical Vapor Deposition (CVD) process to produce high quality 5-10 cm long cylindrical diamond layers. Our collaboration has also been developing a new method of CVD diamond surface preparation that reduces the secondary electron emission coefficient below unity. Special attention was paid to the numerical optimization of the waveguide to structure rf coupling section, where the surface magnetic and electric fields were minimized relative to the accelerating gradient and within known metal surface breakdown limits. We conclude with a brief overview of the use of diamond microstructures for use in compact rf sources.

  12. An Analytical Solution for Cylindrical Concrete Tank on Deformable Soil

    Directory of Open Access Journals (Sweden)

    Shirish Vichare

    2010-07-01

    Full Text Available Cylindrical concrete tanks are commonly used in wastewater treatment plants. These are usually clarifier tanks. Design codes of practice provide methods to calculate design forces in the wall and raft of such tanks. These methods neglect self-weight of tank material and assume extreme, namely ‘fixed’ and ‘hinged’ conditions for the wall bottom. However, when founded on deformable soil, the actual condition at the wall bottom is neither fixed nor hinged. Further, the self-weight of the tank wall does affect the design forces. Thus, it is required to offer better insight of the combined effect of deformable soil and bottom raft stiffness on the design forces induced in such cylindrical concrete tanks. A systematic analytical method based on fundamental equations of shells is presented in this paper. Important observations on variation of design forces across the wall and the raft with different soil conditions are given. Set of commonly used tanks, are analysed using equations developed in the paper and are appended at the end.

  13. Local and Global Casimir Energies for a Semitransparent Cylindrical Shell

    CERN Document Server

    Cavero-Pelaez, I; Milton, K A; Cavero-Pelaez, Ines; Kirsten, Klaus; Milton, Kimball A.

    2006-01-01

    The local Casimir energy density and the global Casimir energy for a massless scalar field associated with a $\\lambda\\delta$-function potential in a 3+1 dimensional circular cylindrical geometry are considered. The global energy is examined for both weak and strong coupling, the latter being the well-studied Dirichlet cylinder case. For weak-coupling,in $\\mathcal{O}(\\lambda^2)$, the total energy is shown to vanish by both analytic and numerical arguments, based both on Green's-function and zeta-function techniques. Divergences occurring in the calculation are shown to be absorbable by renormalization of physical parameters of the model. The global energy may be obtained by integrating the local energy density only when the latter is supplemented by an energy term residing precisely on the surface of the cylinder. The latter is identified as the integrated local energy density of the cylindrical shell when the latter is physically expanded to have finite thickness. Inside and outside the shell, the local energ...

  14. Micro-photonic cylindrical waveguide based protein biosensor

    Energy Technology Data Exchange (ETDEWEB)

    Padigi, Sudhaprasanna Kumar [Department of Electrical and Computer Engineering, Portland State University, 160-11 FAB, 1900 SW Fourth Avenue, Portland, OR 97201 (United States); Asante, Kofi [Department of Physics, Portland State University, Portland, OR 97201 (United States); Kovvuri, Vijay Sekhar Reddy [Department of Electrical and Computer Engineering, Portland State University, 160-11 FAB, 1900 SW Fourth Avenue, Portland, OR 97201 (United States); Reddy, Ravi Kiran Kondama [Department of Electrical and Computer Engineering, Portland State University, 160-11 FAB, 1900 SW Fourth Avenue, Portland, OR 97201 (United States); Rosa, Andres La [Department of Physics, Portland State University, Portland, OR 97201 (United States); Prasad, Shalini [Department of Electrical and Computer Engineering, Portland State University, 160-11 FAB, 1900 SW Fourth Avenue, Portland, OR 97201 (United States)

    2006-09-14

    In this paper we experimentally demonstrate the fabrication and operation of a rapidly prototyped optical cylindrical micro-waveguide based biosensor. This device works on the principle of variation to the light intensity and path of coupled input light due to the binding of protein bio-molecules onto the micro-waveguide surface as a method of physical transduction. The variation to the coupled light intensity and path is dependent on the nature of the bio-molecule and the density of the bio-molecules. This technique has been used to identify protein biomarkers for inflammation and thrombosis, namely myeloperoxidase (MPO) and C-reactive protein (CRP). The detection limit that has been demonstrated is pg ml{sup -1}. The detection speed is of the order of seconds from the time of injection of the bio-molecule. The optical signature that is obtained to identify a protein bio-molecule is entirely dependent on the nature of adsorption of the bio-molecule on to the cylindrical cavity surfaces. This in turn is dependent on the protein conformation and the surface charge of the bio-molecules. Hence a specific protein bio-molecule generates a unique optical identifier based on the nature of binding/adsorption to the cavity surface. This physical phenomenon is exploited to identify individual proteins. This technique is a demonstration of detection of nano-scale protein bio-molecules using the optical biosensor technique with unprecedented sensitivity.

  15. Implosion of Cylindrical Cavities via Short Duration Impulsive Loading

    Science.gov (United States)

    Huneault, Justin; Higgins, Andrew

    2014-11-01

    An apparatus has been developed to study the collapse of a cylindrical cavity in gelatin subjected to a symmetric impact-driven impulsive loading. A gas-driven annular projectile is accelerated to approximately 50 m/s, at which point it impacts a gelatin casting confined by curved steel surfaces that allow a transition from an annular geometry to a cylindrically imploding motion. The implosion is visualized by a high-speed camera through a window which forms the top confining wall of the implosion cavity. The initial size of the cavity is such that the gelatin wall is two to five times thicker than the impacting projectile. Thus, during impact the compression wave which travels towards the cavity is closely followed by a rarefaction resulting from the free surface reflection of the compression wave in the projectile. As the compression wave in the gelatin reaches the inner surface, it will also reflect as a rarefaction wave. The interaction between the rarefaction waves from the gelatin and projectile free surfaces leads to large tensile stresses resulting in the spallation of a relatively thin shell. The study focuses on the effect of impact parameters on the thickness and uniformity of the imploding shell formed by the cavitation in the imploding gelatin cylinder.

  16. Design of Slit between Micro Cylindrical Pillars for Cell Sorting

    Directory of Open Access Journals (Sweden)

    Yusuke Takahashi

    2016-12-01

    Full Text Available Micro slits have been designed between micro cylindrical pillars to sort biological cells. Micro cylindrical pillars of 0.02 mm diameter and 0.055 mm height were fabricated on the glass plate using the photolithography technique. Variation was made on the gap between pillars: 0.01 mm, 0.02 mm, 0.03 mm, and 0.04 mm. The micro pillars are set in the flow path between parallel plates, of which dimension of the cross section is 5 mm width and 0.055 mm height. Three kinds of biological cells were used in the test alternatively: C2C12 (mouse myoblast cell line originated with cross-striated muscle of C3H mouse, Hepa1-6 (mouse hepatoma cell line of C57L mouse, or swine red blood cell. The suspension of cells was introduced into the slits by the syringe pump at the flow rate between 0.4 and 500 cm3/hour. The deformation of the cell at the slit can be observed by the microscope. The experimental results show that the designed slit has capability for sorting cells according to the size and deformability of the cell.

  17. Array gain for a cylindrical array with baffle scatter effects.

    Science.gov (United States)

    Bertilone, Derek C; Killeen, Damien S; Bao, Chaoying

    2007-11-01

    Cylindrical arrays used in sonar for passive underwater surveillance often have sensors surrounding a cylindrical metal baffle. In some operational sonars, the phones in each stave (i.e., each line of phones aligned with the cylinder axis) are hardwired together so that the array is equivalent to a baffled circular array of directional elements, where each element corresponds to a line array of omnidirectional phones steered to broadside. In this paper a model is introduced for computing the array gain of such an array at high frequencies, which incorporates baffle scatter using infinite, rigid cylinder scattering theory, and with ambient noise described by an angular spectral density function. In practice the phones are often offset from the baffle surface, and the acoustic field sampled by the staves is distorted at high frequencies due to interference between the incident and scattered fields. Examples are given to illustrate the resulting array gain degradation, using three noise distributions that are frequently used in sonar performance modeling: three-dimensional isotropic, two-dimensional isotropic, and surface dipole noise.

  18. Finite deformations of an electroelastic circular cylindrical tube

    Science.gov (United States)

    Melnikov, Andrey; Ogden, Ray W.

    2016-12-01

    In this paper the theory of nonlinear electroelasticity is used to examine deformations of a pressurized thick-walled circular cylindrical tube of soft dielectric material with closed ends and compliant electrodes on its curved boundaries. Expressions for the dependence of the pressure and reduced axial load on the deformation and a potential difference between, or uniform surface charge distributions on, the electrodes are obtained in respect of a general isotropic electroelastic energy function. To illustrate the behaviour of the tube, specific forms of energy functions accounting for different mechanical properties coupled with a deformation independent quadratic dependence on the electric field are used for numerical purposes, for a given potential difference and separately for a given charge distribution. Numerical dependences of the non-dimensional pressure and reduced axial load on the deformation are obtained for the considered energy functions. Results are then given for the thin-walled approximation as a limiting case of a thick-walled cylindrical tube without restriction on the energy function. The theory described herein provides a general basis for the detailed analysis of the electroelastic response of tubular dielectric elastomer actuators, which is illustrated for a fixed axial load in the absence of internal pressure and fixed internal pressure in the absence of an applied axial load.

  19. On the physics of propagating Bessel modes in cylindrical waveguides

    Science.gov (United States)

    Gómez-Correa, J. E.; Balderas-Mata, S. E.; Coello, V.; Puente, N. P.; Rogel-Salazar, J.; Chávez-Cerda, S.

    2017-05-01

    In this paper, we demonstrate that by using a mathematical physics approach—focusing attention on the physics and using mathematics as a tool—it is possible to visualize the formation of the transverse modes inside a cylindrical waveguide. The opposite (physical mathematics) approach looks at the mathematical problem and then tries to impose a physical interpretation. For cylindrical waveguides, the physical mathematics route leads to the Bessel differential equation, and it is argued that in the core of the waveguide there are only Bessel functions of the first kind in the description of the transverse modes. The Neumann functions are deemed non-physical due to their singularity at the origin and are eliminated from the final description of the solution. In this paper, by combining geometric optics and wave optics concepts, we show that the inclusion of the Neumann function is physically necessary to describe fully and properly the formation of the propagating transverse modes. With this approach, we also show that the field outside a dielectric waveguide arises in a natural way.

  20. Beam Switching Cylindrical Array Antenna System for Communication

    Directory of Open Access Journals (Sweden)

    V. C. Misra

    1998-10-01

    Full Text Available The beam switching cylindrical array, which is a unique system, has been designed and developed to cover 360° in azimuth plane by generating 16 beams with specified elevation coverage.In this design, the concept of fast aperture selection (4 x 4 in microseconds from the total cylindrical array has been realised successfully to meet the requirement of point-to-multipoint communication. The components of the array, viz., radiating elements, powder dividers, switches, etc., are designed in printed circuit type, and hence, objectives of lightweight and ease of reproducibility are achieved. The lightweight of the array makes it accessible for easy mounting at a specified height for achieving longer communication range. Finally, a low-loss radome is incorporated to protect the array from environmental conditions. The various parameters, viz., return loss, gain, and switched-beam radiation patterns were measured over a bandwidth of 300 MHz in L- band and typical measured results are presented in this paper.

  1. Nonlinear RF spurious in a cylindrical cavity with superconducting endplates

    Science.gov (United States)

    Mateu, Jordi; Collado, Carlos; Shaw, Timothy J.; O'Callaghan, Juan M.

    2002-08-01

    We have developed a method to calculate the distribution of fundamental and spurious fields in a metallic cylindrical cavity with superconducting endplates in which signals at two different frequencies are injected. The nonlinearity in the superconductor produces the typical intermodulation effects if the frequencies of the injected signals are sufficiently close to each other and near a resonant mode. Our method uses harmonic balance to match the fields in the cavity with the currents on the endplates. The method can be used for a variety of nonlinear models of the superconducting endplate, and could be the base for a nondestructive procedure to extract the nonlinear parameters of an HTS sample from RF measurements. Our analysis is restricted to the TE0 1 1 mode, but the method can be applied to any propagating mode in the cylindrical cavity. Closed-form equations for the case of square-law nonlinearities in the superconductor are derived and used to check the validity of the harmonic balance calculation.

  2. Unpolarized radiative cylindrical spacetimes Trapped surfaces and quasilocal energy

    CERN Document Server

    Gonçalves, S M C V

    2003-01-01

    We consider the most general vacuum cylindrical spacetimes, which are defined by two global, spacelike, commuting, non-hypersurface-orthogonal Killing vector fields. The cylindrical waves in such spacetimes contain both + and $\\times$ polarizations, and are thus said to be unpolarized. We show that there are no trapped cylinders in the spacetime, and present a formal derivation of Thorne's C-energy, based on a Hamiltonian reduction approach. Using the Brown-York quasilocal energy prescription, we compute the actual physical energy (per unit Killing length) of the system, which corresponds to the value of the Hamiltonian that generates unit proper-time translations orthogonal to a given fixed spatial boundary. The C-energy turns out to be a monotonic non-polynomial function of the Brown-York quasilocal energy. Finally, we show that the Brown-York energy at spatial infinity is related to an asymptotic deficit angle in exactly the same manner as the specific mass of a straight cosmic string is to the former.

  3. On Sector Magnets or Transverse Electromagnetic Fields in Cylindrical Coordinates

    Energy Technology Data Exchange (ETDEWEB)

    Zolkin, Timofey [Fermilab

    2016-03-10

    The Laplace's equations for the scalar and vector potentials describing electric or magnetic fields in cylindrical coordinates with translational invariance along azimuthal coordinate are considered. The series of special functions which, when expanded in power series in radial and vertical coordinates, in lowest order replicate the harmonic homogeneous polynomials of two variables are found. These functions are based on radial harmonics found by Edwin~M.~McMillan in his more-than-40-years "forgotten" article, which will be discussed. In addition to McMillan's harmonics, second family of adjoint radial harmonics is introduced, in order to provide symmetric description between electric and magnetic fields and to describe fields and potentials in terms of same special functions. Formulas to relate any transverse fields specified by the coefficients in the power series expansion in radial or vertical planes in cylindrical coordinates with the set of new functions are provided. This result is no doubt important for potential theory while also critical for theoretical studies, design and proper modeling of sector dipoles, combined function dipoles and any general sector element for accelerator physics. All results are presented in connection with these problems.

  4. Influence of Ring Stiffeners on a Steel Cylindrical Shell

    Directory of Open Access Journals (Sweden)

    D. Lemák

    2005-01-01

    Full Text Available Shell structures are usually formed from concrete, steel and nowadays also from many others materials. Steel is typically used in the structures of chimneys, reservoirs, silos, pipelines, etc. Unlike concrete shells, steel shells are regularly stiffened with the help of longitudinal and/or ring stiffeners.The authors of this paper investigated steel cylindrical shells and their stiffening with the use of ring stiffeners. The more complete the stiffening, the more closely the shell will act to beam theory, and the calculations will be much easier. However, this would make realization of the structure more expensive and more laborious. The target of the study is to find the limits of ring stiffeners for cylindrical shells. Adequate stiffeners will eliminate semi-bending action of the shells in such way that the shell structures can be analyzed with the use of numerical models of the struts (e.g., by beam theory without significant divergences from reality. Recommendations are made for the design of ring stiffeners, especially for the distances between stiffeners and for their bending stiffness. 

  5. Entropy generation analysis of cylindrical heat pipe using nanofluid

    Energy Technology Data Exchange (ETDEWEB)

    Ghanbarpour, Morteza, E-mail: morteza.ghanbarpour@energy.kth.se; Khodabandeh, Rahmatollah

    2015-06-20

    Highlights: • Entropy generation of heat pipe with nanofluid has been studied. • Nanofluid has significant effect on heat pipe performance. • Entropy generation in heat pipe decreases when nanofluids are used as working fluids. - Abstract: Thermal performance of cylindrical heat pipe with nanofluid is studied based on the laws of thermodynamics. The objective of the present work is to investigate nanofluids effect on different sources of entropy generation in heat pipe caused by heat transfer between hot and cold reservoirs and also frictional losses and pressure drop in the liquid and vapor flow along heat pipe. An analytical study was performed to formulate all sources of entropy generation and the predicted results are compared with experimental ones. Cylindrical miniature grooved heat pipes of 250 mm length and 6.35 mm outer diameter were fabricated and tested with distilled water and water based TiO{sub 2} and Al{sub 2}O{sub 3} nanofluids at different concentrations as working fluids. Analytical and experimental results revealed that the entropy generation in heat pipes decreases when nanofluids are used as working fluids instead of basefluid which results in improved thermal performance of the heat pipes with nanofluids.

  6. Nonlinear Dynamic Buckling of Damaged Composite Cylindrical Shells

    Institute of Scientific and Technical Information of China (English)

    WANG Tian-lin; TANG Wen-yong; ZHANG Sheng-kun

    2007-01-01

    Based on the first order shear deformation theory(FSDT), the nonlinear dynamic equations involving transverse shear deformation and initial geometric imperfections were obtained by Hamilton's philosophy. Geometric deformation of the composite cylindrical shell was treated as the initial geometric imperfection in the dynamic equations, which were solved by the semi-analytical method in this paper. Stiffness reduction was employed for the damaged sub-layer, and the equivalent stiffness matrix was obtained for the delaminated area. By circumferential Fourier series expansions for shell displacements and loads and by using Galerkin technique, the nonlinear partial differential equations were transformed to ordinary differential equations which were finally solved by the finite difference method. The buckling was judged from shell responses by B-R criteria, and critical loads were then determined. The effect of the initial geometric deformation on the dynamic response and buckling of composite cylindrical shell was also discussed, as well as the effects of concomitant delamination and sub-layer matrix damages.

  7. Self-sustained oscillation for compressible cylindrical cavity flows

    Directory of Open Access Journals (Sweden)

    Kung-Ming CHUNG

    2017-08-01

    Full Text Available The presence of a cavity changes the mean and fluctuating pressure distributions. Similarities are observed between a cylindrical cavity and a rectangular cavity for a compressible flow. The type of cavity flow field depends on the diameter-to-depth ratio and the length-to-depth ratio. The feedback loop is responsible for the generation of discrete acoustic tones. In this study, the self-sustained oscillation for a compressible cylindrical cavity flow was investigated experimentally. For open-type cavities, the power spectra show that the strength of resonance depends on the diameter-to-depth ratio (4.43–43.0 and the incoming boundary layer thickness-to-depth ratio (0.72–7.0. The effective streamwise length is used as the characteristic length to estimate the Strouhal number. At higher modes, there is a large deviation from Rossiter’s formula for rectangular cavities. The gradient-based searching method was used to evaluate the values of the empirical parameters. Less phase lag and a lower convection velocity are observed.

  8. Orbital motion theory and operational regimes for cylindrical emissive probes

    Science.gov (United States)

    Chen, Xin; Sanchez-Arriaga, G.

    2017-02-01

    A full-kinetic model based on the orbital-motion theory for cylindrical emissive probes (EPs) is presented. The conservation of the distribution function, the energy, and the angular momentum for cylindrical probes immersed in collisionless and stationary plasmas is used to write the Vlasov-Poisson system as a single integro-differential equation. It describes self-consistently the electrostatic potential profile and, consequently, the current-voltage (I-V) probe characteristics. Its numerical solutions are used to identify different EP operational regimes, including orbital-motion-limited (OML)/non-OML current collection and monotonic/non-monotonic potential, in the parametric domain of probe bias and emission level. The most important features of the potential and density profiles are presented and compared with common approximations in the literature. Conventional methods to measure plasma potential with EPs are briefly revisited. A direct application of the model is to estimate plasma parameters by fitting I-V measurements to the theoretical results.

  9. Multimode laser emission from free-standing cylindrical microcavities

    Energy Technology Data Exchange (ETDEWEB)

    Peter, Jaison, E-mail: jaisonpeter@cusat.ac.in; Radhakrishnan, P.; Nampoori, V.P.N.; Kailasnath, M.

    2014-05-01

    We report a well resolved whispering gallery mode (WGM) laser emission from a free-standing microring cavity based on a dye doped hollow polymer optical fiber (DDHPOF), which is transversely pumped by a pulsed Nd:YAG laser. The microring laser is characterized by a well-defined, low threshold pump power at which the emission spectral intensity dramatically increases and collapses into several dominant microcavity laser modes with reduced mode spacing and high Q-value. Resonant modes are excited inside the gain medium which is strongly confined along the radial direction so that the spacing of lasing modes is controlled by the diameter of the cylindrical microcavity. A variation in the free spectral range of WGM spectra from 0.23 to 0.09 nm coupled with a red-shift is observed with an increase in the diameter of DDHPOFs. - Highlights: • Different diameter free-standing cylindrical microcavity lasers have been fabricated and their performances have been evaluated. • The microring laser is characterized by a well-defined, low threshold pump power, with reduced mode spacing and high Q-value. • When the diameter of DDHPOF increases, the number of lasing peaks increases along with the decrease of the FSR as observed from our studies. • It is also found that whispering gallery lasing envelope is shifted from 559 to 571 nm (Stokes shift) with the diameter.

  10. Cylindrical Liner Z-pinch Experiments on the MAGPIE Generator

    Science.gov (United States)

    Burdiak, Guy; Lebedev, Sergey V.; Harvey-Thompson, Adam J.; Swadling, George F.; Suzuki-Vidal, Francisco; Skidmore, Jonathan; Suttle, Lee; Khoory, Essa; Pickworth, Louisa; de Grouchy, Philip; Hall, Gareth N.; Bland, Simon N.; Weinwurm, Marcus; Chittenden, Jeremy P.

    2012-10-01

    Experimental data from gas-filled cylindrical liner z-pinch experiments is presented. The MAGPIE current (1.4 MA, 240 ns) is applied to a thin walled (80um) Al tube with a static gas-fill inside. The system is diagnosed axially using interferometry, optical streak photography and optical spectroscopy. We observe a series of cylindrically converging shock waves driven into the gas-fill from the inside liner surface. No bulk motion of the liner occurs. The timing of the shocks and their trajectories provide information on the shock launching mechanisms. This in turn allows a study of the response of the liner to the current pulse. Shock wave timing is compared to measurements of the liner resistance and optical images of the liner's outside surface. The system provides a useful, essentially 1D problem for testing MagLIF relevant MHD codes, particularly with regards to EOS, strength and resistivity models. This work may also be relevant to the study of shocks in astrophysical plasmas. The shocks launched into the gas radiatiate strongly; spatially resolved optical spectroscopy data and radial electron density profiles from interferometry images provide evidence for a radiative precursor ahead of the first shock. Instabilities are seen to develop in the downstream regions.

  11. Employing a cylindrical single crystal in gas-surface dynamics.

    Science.gov (United States)

    Hahn, Christine; Shan, Junjun; Liu, Ying; Berg, Otto; Kleijn, Aart W; Juurlink, Ludo B F

    2012-03-21

    We describe the use of a polished, hollow cylindrical nickel single crystal to study effects of step edges on adsorption and desorption of gas phase molecules. The crystal is held in an ultra-high vacuum apparatus by a crystal holder that provides axial rotation about a [100] direction, and a crystal temperature range of 89 to 1100 K. A microchannel plate-based low energy electron diffraction/retarding field Auger electron spectrometer (AES) apparatus identifies surface structures present on the outer surface of the cylinder, while a separate double pass cylindrical mirror analyzer AES verifies surface cleanliness. A supersonic molecular beam, skimmed by a rectangular slot, impinges molecules on a narrow longitudinal strip of the surface. Here, we use the King and Wells technique to demonstrate how surface structure influences the dissociation probability of deuterium at various kinetic energies. Finally, we introduce spatially-resolved temperature programmed desorption from areas exposed to the supersonic molecular beam to show how surface structures influence desorption features.

  12. Cylindrical diffractive lenses recorded on PVA/AA photopolymers

    Science.gov (United States)

    Fernández, R.; Gallego, S.; Márquez, A.; Navarro-Fuster, V.; Francés, J.; Neipp, C.; Beléndez, A.; Pascual, I.

    2016-04-01

    Photopolymers are optical recording materials appealing for many different applications such as holography, data storage, interconnectors, solar concentrations, or wave-guides fabrication. Recently the capacity of photopolymers to record diffractive optical elements (DOE's) has been investigated. Different authors have reported proposes to record DOE like fork gratings, photonics structures, lenses, sinusoidal, blazed or fork gratings. In these experiments there are different experimental set-ups and different photopolymers. In this work due to the improvement in the spatial light modulation technology together with the photopolymer science we propose a recording experimental system of DOE using a Liquid Cristal based on Silicon (LCoS) display as a master to store complex DOE like cylindrical lenses. This technology permits us an accurate control of the phase and the amplitude of the recording beam, with a very small pixel size. The main advantage of this display is that permit us to modify the DOE automatically, we use the software of the LCoS to send the voltage to each pixel In this work we use a photopolymer composed by acrylamide (AA) as polymerizable monomer and polyvinyl alcohol (PVA). We use a coverplated and index matched photopolymer to avoid the influence of the thickness variation on the transmitted light. In order to reproduce the material behaviour during polymerization, we have designed our model to simulate cylindrical lenses and used Fresnel propagation to simulate the light propagation through the DOE and analyze the focal plane and the properties of the recorded lenses.

  13. NUMERICAL SIMULATION OF SPHERICAL, CYLINDRICAL AND AXIAL BUBBLE CLOUDS COLLAPSE

    Institute of Scientific and Technical Information of China (English)

    MAHDI Miralam; EBRAHIMI Reza; SHAMS Mehrzad

    2012-01-01

    The nonlinear dynamics of a spherical,cylindrical and axial cloud of cavitation bubbles were numerically simulated in order to learn more about the physical phenomena occurring in the cloud cavitation.The simulations employed the fully nonlinear continuum mixture equations coupled with the Gilmore equation for the dynamics of bubbles by considering the compressibility of liquid.A set of the Navier-Stokes equations was solved for the gas inside a spherical bubble,considering heat transfer through the gas inside the bubble and the liquid layer.The flow field around the cylindrical and axial cloud was obtained by solving the Navier-Stokes equations using a finite volume method and a dynamic layering mesh scheme.The calculated strength of shock wave in the liquid around the cloud was of the order of 1 × 106 Pa and the propagation of this shock wave lasted for 10 μs.The conducted investigations illustrate that the shock wave propagates before the cloud has completely collapsed.A good agreement with experimental data was observed.

  14. Smart Cylindrical Dome Antenna Based on Active Frequency Selective Surface

    Directory of Open Access Journals (Sweden)

    Tongyu Ding

    2017-01-01

    Full Text Available In this paper, we proposed a beamforming antenna, which is realized using an omnidirectional antenna in the center surrounded by a cylindrical smart dome. The smart dome is made of 16 active frequency selective surface columns of which the amplitude and phase response can be continuously tuned by varying the bias voltages of the employed varactors. Thus, the performance of the proposed antenna could achieve higher gain, better nulling level, and more agility than many switch methods-based cylindrical reconfigurable antennas. Moreover, in order to overcome the unavailable analytical synthesis caused by complex mutual coupling between columns, we develop a genetic algorithm based optimization system and conducted a serial of experiments to evaluate the high-gain, nulling, continuously steering, and frequency-invariant ability. The results show that, during the frequency tunable range of the AFSS (2.0 GHz to 2.7 GHz, the antenna can offer an additional gain of up to 6.57 dB and nulling level of −56.41 dBi. For the high-gain modes, the −3 dB beam widths are 26°–34°, which offers enhanced angular resolution compared with other reported beam-sweeping work. Furthermore, the radiation pattern is continuously steerable.

  15. Ultrasound cylindrical phased array for transoesophageal thermal therapy: initial studies

    Energy Technology Data Exchange (ETDEWEB)

    Melodelima, David [INSERM, Unite 556, 151 Cours Albert Thomas, 69424 Lyon (France); Lafon, Cyril [INSERM, Unite 556, 151 Cours Albert Thomas, 69424 Lyon (France); Prat, Frederic [Centre Hospitalier Bicetre, 78 Avenue General Leclerc, 94275 Le Kremlin Bicetre (France); Birer, Alain [INSERM, Unite 556, 151 Cours Albert Thomas, 69424 Lyon (France); Cathignol, Dominique [INSERM, Unite 556, 151 Cours Albert Thomas, 69424 Lyon (France)

    2002-12-07

    This work was undertaken to investigate the feasibility of constructing a cylindrical phased array composed of 64 elements spread around the periphery (OD 10.6 mm) for transoesophageal ultrasound thermotherapy. The underlying operating principle of this applicator is to rotate a plane ultrasound beam electronically. For this purpose, eight adjacent transducers were successively excited with appropriate delay times so as to generate a plane wave. The exposure direction was changed by exciting a different set of eight elements. For these feasibility studies, we used a cylindrical prototype (OD 10.6 mm) composed of 16 elementary transducers distributed over a quarter of the cylinder, all operating at 4.55 MHz. The active part was mechanically reinforced by a rigid damper structure behind the transducers. It was shown that an ultrasound field similar to that emitted by a plane transducer could be generated. Ex vivo experiments on pig's liver demonstrated that the ultrasound beam could be accurately rotated to generate sector-based lesions to a suitable depth (up to 19 mm). Throughout these experiments, exposures lasting 20 s were delivered at an acoustic intensity of 17 W cm{sup -2}. By varying the power from exposure to exposure, the depth of the lesion at different angles could be controlled.

  16. Coupled dilaton and electromagnetic field in cylindrically symmetric spacetime

    Indian Academy of Sciences (India)

    A Banerjee; S Chatterjee; Tanwi Ghosh

    2000-03-01

    An exact solution is obtained for coupled dilaton and electromagnetic field in a cylindrically symmetric spacetime where an axial magnetic field as well as a radial electric field both are present. Depending on the choice of the arbitrary constants our solution reduces either to dilatonic gravity with pure electric field or to that with pure magnetic field. In the first case we have a curvature singularity at a finite distance from the axis indicating the existence of the boundary of a charged cylinder which may represent the source of the electric field. For the second case we have a singularity on the axis. When the dilaton field is absent the electromagnetic field disappears in both the cases. Whereas the contrary is not true. It is further shown that light rays except for those proceeding in the radial direction are either trapped or escape to infinity depending on the magnitudes of certain constant parameters as well as on the nature of the electromagnetic field. Nature of circular geodesics is also studied in the presence of dilaton field in the cylindrically symmetric spacetime.

  17. Stability of perfect and imperfect cylindrical shells under axial compression and torsion

    Institute of Scientific and Technical Information of China (English)

    袁喆; 霍世慧; 耿小亮

    2014-01-01

    Stability analyses of perfect and imperfect cylindrical shells under axial compression and torsion were presented. Finite element method for the stability analysis of perfect cylindrical shells was put forward through comparing critical loads and the first buckling modes with those obtained through theoretical analysis. Two typical initial defects, non-circularity and uneven thickness distribution, were studied. Critical loads decline with the increase of non-circularity, which exist in imperfect cylindrical shells under both axial compression and torsion. Non-circularity defect has no effect on the first buckling mode when cylindrical shell is under torsion. Unfortunately, it has a completely different buckling mode when cylindrical shell is under axial compression. Critical loads decline with the increase of thickness defect amplitude, which exist in imperfect cylindrical shells under both axial compression and torsion, too. A greater wave number is conducive to the stability of cylindrical shells. The first buckling mode of imperfect cylindrical shells under torsion maintains its original shape, but it changes with wave number when the cylindrical shell is under axial compression.

  18. Rotation, inversion and perversion in anisotropic elastic cylindrical tubes and membranes

    KAUST Repository

    Goriely, A.

    2013-03-06

    Cylindrical tubes and membranes are universal structural elements found in biology and engineering over a wide range of scales.Working in the framework of nonlinear elasticity, we consider the possible deformations of elastic cylindrical shells reinforced by one or two families of fibres. We consider both small and large deformations and the reduction from thick cylindrical shells (tubes) to thin shells (cylindrical membranes). In particular, a number of universal parameter regimes can be identified where the response behaviour of the cylinder is qualitatively different. This include the possibility of inversion of twist or axial strain when the cylinder is subject to internal pressure. Copyright © The Royal Society 2013.

  19. Unique features of cylindrical type solar-module contrasted with plane or conventional type ones

    Science.gov (United States)

    Hiraki, Hirohisa; Hiraki, Akio; Maeda, Masakatsu; Takahashi, Yasuo

    2012-08-01

    Due to their shape and construction, Cu(In,Ga)Se2 [CIGS] cylindrical photovoltaic [PV] panels have unique features that planar or conventional PV panels do not have. For example, a) they capture sunlight over an angular range of 360°, b) they are self-ballasting (no roof penetrations, no attachments required) and c) they are high-reliability hermetically sealed cylindrical packages. In field tests in Japan, cylindrical PV panels have proven their durability against typhoons, and also their excellent electrical properties. Finally, as a new application of cylindrical PV panels, we suggest the new concept of fusion or combination of PV generation and agriculture.

  20. Design of a piezoelectric transducer cylindrical phase modulator for simulating acoustic emission signals

    Institute of Scientific and Technical Information of China (English)

    HE Cunfu; HANG Lijun; WU Bin

    2007-01-01

    To conveniently carry out the pipeline leak experiment in a laboratory,leak acoustic signals are simulated by using the converse piezoelectric effect of a piezoelectric transducer (PZT) cylindrical phase modulator.On the basis of the piezoelectric equations and electromechanical equivalence principle,the transfer function of a PZT cylindrical phase modulator is delivered.A PZT cylindrical phase modulator is designed,and the numerical simulation is conducted.Results prove that the PZT cylindrical phase modulator can effectively simulate leak acoustic emission signals when the frequency is lower than 25 KHz.

  1. Cylindrical Jet-Wind Interaction Model of Gamma-Ray Burst Afterglows

    Institute of Scientific and Technical Information of China (English)

    Hai-Tao Ma; Yong-Feng Huang; Zi-Gao Dai; Tan Lu

    2003-01-01

    Observations on relativistic jets in radio galaxies, active galactic nuclei,and "microquasars" revealed that many of these outflows are cylindrical, not coni-cal. So it is worthwhile to investigate the evolution of cylindrical jets in gamma-raybursts. We discuss afterglows from cylindrical jets in a wind environment. Numeri-cal results as well as analytic solutions in some special cases are presented. Our lightcurves are steeper compared to those in the homogeneous interstellar medium case,carefully considered by Cheng, Huang & Lu. We conclude that some afterglows,used to be interpreted as isotropic fireballs in a wind environment, can be fitted aswell by cylindrical jets interacting with a wind.

  2. Support open access publishing

    DEFF Research Database (Denmark)

    Ekstrøm, Jeannette

    2013-01-01

    Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante tidsskriftsinformati......Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante...... tidsskriftsinformationer (faglig disciplin, BFI niveau, Impact Factor, Open Access) vil kunne danne sig et hurtigt overblik, for derved at kunne træffe et kvalificeret valg om, hvor og hvordan man skal publicere sine forskningsresultater....

  3. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  4. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  5. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  6. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  7. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  8. Power Limits in Cylindrical Gyromonotrons Using TEonl Modes.

    Science.gov (United States)

    1980-11-13

    New Mexico 87545 (1) Massachusetts Institute of Technology Research Laboratory of Electronics Attn: Dr. G. Bekefi Bldg. 36, Rm. 36-225 Cambridge...Fontenay-auix Roses France (1) Thompson C.S.F./DET/ TDH Attn: Dr. G. Mourier 2 Rue Latecoere 78140 Velizy Villa conblay France (1) UKAEA Culham Laboratory Attn: Dr. A.C. Riviere Abingdon Oxfordshire United Kingdom fi 24 I, 24

  9. A novel concept for stabilization of AC/DC network with UPFC

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, R.K. [Banaras Hindu Univ., Inst. of Technology, Varanasi (India). Dept. of Electrical Engineering

    2006-07-01

    In a power system network, 2 regional grids can be interconnected by HVDC back-to-back. The 2 converter stations are connected through the DC link and the converters have their individual controls. The risk of network tripping can be significantly minimized by modulating the real and reactive power, thereby improving the stability of the AC/DC system. This paper described a unified power flow controller (UPFC), an innovative concept for stabilizing AC/DC networks. It also presented the results of a study that investigated the perturbation in AC bus voltages along with the effect on the stability deterioration. The new concept of control was proposed by embedding UPFC and then generating the control decisions to sufficiently stabilize the earlier ones. The Novel Discrete-Time model for AC/DC systems was used to study the complete system stability under varying perturbations of AC system voltage. The study revealed that the HVDC-SVC alone was not able to handle the perturbation of line to line voltage change after a certain value because the SVC cannot support external reactive power variations which are meant to regulate the Var requirements during converter control. In such situations, the UPFC along with the HVDC-SVC damped the oscillations, thereby adequately matching the real and reactive power demands. This combination can be used effectively in situations when the AC system bus voltage fluctuates due to changing P and Q requirements. 9 refs., 1 tab., 5 figs.

  10. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  11. Seeded and unseeded helical modes in magnetized, non-imploding cylindrical liner-plasmas

    Science.gov (United States)

    Yager-Elorriaga, D. A.; Zhang, P.; Steiner, A. M.; Jordan, N. M.; Lau, Y. Y.; Gilgenbach, R. M.

    2016-10-01

    In this research, we generated helical instability modes using unseeded and kink-seeded, non-imploding liner-plasmas at the 1 MA Linear Transformer Driver facility at the University of Michigan in order to determine the effects of externally applied, axial magnetic fields. In order to minimize the coupling of sausage and helical modes to the magneto Rayleigh-Taylor instability, the 400 nm-thick aluminum liners were placed directly around straight-cylindrical (unseeded) or threaded-cylindrical (kink-seeded) support structures to prevent implosion. The evolution of the instabilities was imaged using a combination of laser shadowgraphy and visible self-emission, collected by a 12-frame fast intensified CCD camera. With no axial magnetic field, the unseeded liners developed an azimuthally correlated m = 0 sausage instability (m is the azimuthal mode number). Applying a small external axial magnetic field of 1.1 T (compared to peak azimuthal field of 30 T) generated a smaller amplitude, helically oriented instability structure that is interpreted as an m = +2 helical mode. The kink-seeded liners showed highly developed helical structures growing at the seeded wavelength of λ = 1.27 mm. It was found that the direction of the axial magnetic field played an important role in determining the overall stabilization effects; modes with helices spiraling in the opposite direction of the global magnetic field showed the strongest stabilization. Finally, the Weis-Zhang analytic theory [Weis et al., Phys. Plasmas 22, 032706 (2015)] is used to calculate sausage and helical growth rates for experimental parameters in order to study the effects of axial magnetic fields.

  12. Dynamic stability of nearly cylindrical orthotropic shells of revolution subjected to meridional forces

    Science.gov (United States)

    Kukudzhanov, S. N.

    2008-10-01

    We study the natural vibrations and the dynamic stability of nearly cylindrical orthotropic shells of revolution subjected to meridional forces uniformly distributed over the shell ends. We consider shells of medium length for which the shape of the midsurface generatrix is described by a parabolic function. Using the theory of shallow shells, we obtain the resolving equation for the vibrations of the corresponding prestressed shell. In the isotropic case, this equation differs from the well-known equation [1] by an additional term, which can be of the same order as the other terms taken into account. We consider shells of both positive and negative Gaussian curvature. We assumed that the shell ends are freely supported. The formulas and universal curves describing the dependence of the minimum frequency, the wave generation shape, and the dynamic instability domain boundaries on the orthotropy parameters, the preliminary stress, the Gaussian curvature, and the amplitude of the shell deviation from the cylinder are given in dimensionless form. We find that in the case of prestresses the orthotropy parameters and the shell deviation from the cylinder (of the order of thickness) can significantly change the least frequencies, the wave generation shape, and the dynamic instability domain boundaries of the corresponding prestressed orthotropic cylindrical shell. In this case, we note that for convex shells under preliminary compression the influence of the elastic parameter in the axial direction is stronger than the influence of the elastic parameter in the circular direction, while the situation is opposite in the case of concave shells. In the case of preliminary extension, the leading role of any orthotropy parameter can vary depending on the value of the preliminary stress and the Gaussian curvature.

  13. Self-assembled large-area annular cavity arrays with tunable cylindrical surface plasmons for sensing.

    Science.gov (United States)

    Ni, Haibin; Wang, Ming; Shen, Tianyi; Zhou, Jing

    2015-02-24

    Surface plasmons that propagate along cylindrical metal/dielectric interfaces in annular apertures in metal films, called cylindrical surface plasmons (CSPs), exhibit attractive optical characteristics. However, it is challenging to fabricate these nanocoaxial structures. Here, we demonstrate a practical low-cost route to manufacture highly ordered, large-area annular cavity arrays (ACAs) that can support CSPs with great tunability. By employing a sol-gel coassembly method, reactive ion etching and metal sputtering techniques, regular, highly ordered ACAs in square-centimeter-scale with a gap width tunable in the range of several to hundreds of nanometers have been produced with good reproducibility. Ag ACAs with a gap width of 12 nm and a gap height of 635 nm are demonstrated. By finite-difference time-domain simulation, we confirm that the pronounced dips in the reflectance spectra of ACAs are attributable to CSP resonances excited in the annular gaps. By adjusting etching time and Ag film thickness, the CSP dips can be tuned to sweep the entire optical range of 360 to 1800 nm without changing sphere size, which makes them a promising candidate for forming integrated plasmonic sensing arrays. The high tunability of the CSP resonant frequencies together with strong electric field enhancement in the cavities make the ACAs promising candidates for surface plasmon sensors and SERS substrates, as, for example, they have been used in liquid refractive index (RI) sensing, demonstrating a sensitivity of 1505 nm/RIU and a figure of merit of 9. One of the CSP dips of ACAs with a certain geometry size is angle- (0-70 degrees) and polarization-independent and can be used as a narrow-band absorber. Furthermore, the nano annular cavity arrays can be used to construct solar cells, nanolasers and nanoparticle plasmonic tweezers.

  14. ACTIVE CONTROL OF THE PIEZOELASTIC LAMINATED CYLINDRICAL SHELL‘’‘’‘’‘’S VIBRATION UNDER HYDEROSTATIC PRESSURE

    Institute of Scientific and Technical Information of China (English)

    LIHong-yun; LINQi-yong; LIUZheng-xing; WANGChao

    2003-01-01

    The control of the piezoelastic laminated cylindrical shell''''''''s vibration under hydrostatic pressure was discussed.From Hamilton''''''''s principle nonlinear dynamic equations of the piezoelpasic laminated cylindrical shell were derived.Based on which,the dynamic equations of a closed piezoelastic cylindrical shell under hydrostatic pressure are obtained.An analytical solution was presented for the case of vibration of a simply supported piezoelastic laminated cylindrical shell under hydrostatic presure.Using veloctity feedback control,a model for active vibration control of the laminated cylindrica shell with piezoelastic sensor/actuator is established.Numerical results show that,the static difiection of the cyindrical shell can be changed when voltages with suitable value and direction are applied on the piezoelectric layers.For the dynamic response problem of the system,the larger the gain is ,the more the vibration of the system is suppressed in the vicinity of the resonant zone.This presents a potential way to actively reduce the harmful effect of the resonance on the system and verify the feasibility of the active vibration control model.

  15. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  16. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  17. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  18. Bio-Inspired Wide-Angle Broad-Spectrum Cylindrical Lens Based on Reflections from Micro-Mirror Array on a Cylindrical Elastomeric Membrane

    Directory of Open Access Journals (Sweden)

    Chi-Chieh Huang

    2014-06-01

    Full Text Available We present a wide-angle, broad-spectrum cylindrical lens based on reflections from an array of three-dimensional, high-aspect-ratio micro-mirrors fabricated on a cylindrical elastomeric substrate, functionally inspired by natural reflecting superposition compound eyes. Our device can perform one-dimensional focusing and beam-shaping comparable to conventional refraction-based cylindrical lenses, while avoiding chromatic aberration. The focal length of our cylindrical lens is 1.035 mm, suitable for micro-optical systems. Moreover, it demonstrates a wide field of view of 152° without distortion, as well as modest spherical aberrations. Our work could be applied to diverse applications including laser diode collimation, barcode scanning, holography, digital projection display, microlens arrays, and optical microscopy.

  19. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  20. A simple construction for a cylindrical cloak via inverse homogenization

    CERN Document Server

    Anderson, Tom H; Lakhtakia, Akhlesh

    2011-01-01

    An effective cylindrical cloak may be conceptualized as an assembly of adjacent local neighbourhoods, each of which is made from a homogenized composite material (HCM). The HCM is required to be a certain uniaxial dielectric-magnetic material, characterized by positive-definite constitutive dyadics. It can arise from the homogenization of remarkably simple component materials, such as two isotropic dielectric-magnetic materials, randomly distributed as oriented spheroidal particles. By carefully controlling the spheroidal shape of the component particles, a high degree of HCM anisotropy may be achieved, which is necessary for the cloaking effect to be realized. The inverse Bruggeman formalism can provide estimates of the shape and constitutive parameters for the component materials, as well as their volume fractions.

  1. Kaluza-Klein magnetized cylindrical wormhole and its gravitational lensing

    Science.gov (United States)

    Hashemi, S. Sedigheh; Riazi, Nematollah

    2016-10-01

    A new exact vacuum solution in five dimensions, which describes a magnetized cylindrical wormhole in 3+1 dimensions is presented. The magnetic field lines are stretched along the wormhole throat and are concentrated near to it. We study the motion of neutral and charged test particles under the influence of the magnetized wormhole. The effective potential for a neutral test particle around and across the magnetized wormhole has a repulsive character. The gravitational lensing for the magnetized wormhole for various lens parameters are calculated and compared. The total magnetic flux on either side of the wormhole is obtained. We present analytic expressions which show regions in which the null energy condition is violated.

  2. Non-linear effects for cylindrical gravitational two-soliton

    CERN Document Server

    Tomizawa, Shinya

    2015-01-01

    Using a cylindrical soliton solution to the four-dimensional vacuum Einstein equation, we study non-linear effects of gravitational waves such as Faraday rotation and time shift phenomenon. In the previous work, we analyzed the single-soliton solution constructed by the Pomeransky's improved inverse scattering method. In this work, we construct a new two-soliton solution with complex conjugate poles, by which we can avoid light-cone singularities unavoidable in a single soliton case. In particular, we compute amplitudes of such non-linear gravitational waves and time-dependence of the polarizations. Furthermore, we consider the time shift phenomenon for soliton waves, which means that a wave packet can propagate at slower velocity than light.

  3. Symbolic Solution for Generalized Quantum Cylindrical Wells using Computer Algebra

    CERN Document Server

    Villegas, Edward Yesid

    2012-01-01

    This paper present how to solve the problem of cylindrical quantum wells with potential energy different from zero and with singularity of the energy on the axis of the cylinder. The solution to the problem was obtained using methods of computer algebra. The results depend of Bessel and Kummer functions. This paper present energy levels and wave functions in some of the cases with an exactly form and in other cases with an approximated form, this form depended on the possibility of integrating the special functions and calculating the zeros of these functions. Here we can see the power of the method in the applications concerning complex problems of quantum mechanics, and the possibility of being able to apply this method in order to solve other problems in science and also in engineering.

  4. Theoretical analysis on x-ray cylindrical grating interferometer

    CERN Document Server

    Cong, Wenxiang; Wang, Ge

    2015-01-01

    Grating interferometer is a state of art x-ray imaging approach, which can simultaneously acquire information of x-ray attenuation, phase shift, and small angle scattering. This approach is very sensitive to micro-structural variation and offers superior contrast resolution for biological soft tissues. The present grating interferometer often uses flat gratings, with serious limitations in the field of view and the flux of photons. The use of curved gratings allows perpendicular incidence of x-rays on the gratings, and gives higher visibility over a larger field of view than a conventional interferometer with flat gratings. In the study, we present a rigorous theoretical analysis of the self-imaging of curved transmission gratings based on Rayleigh-Sommerfeld diffraction. Numerical simulations have demonstrated the self-imaging phenomenon of cylindrical grating interferometer. The theoretical results are in agreement with the results of numerical simulations.

  5. Linear stability analysis of capillary instabilities for concentric cylindrical shells

    CERN Document Server

    Liang, X; Nave, J -C; Johnson, S G

    2010-01-01

    Motivated by complex multi-fluid geometries currently being explored in fibre-device manufacturing, we study capillary instabilities in concentric cylindrical flows of N fluids with arbitrary viscosities, thicknesses, densities, and surface tensions in both the Stokes regime and for the full Navier--Stokes problem. Generalising previous work by Tomotika (N=2), Stone & Brenner (N=3, equal viscosities) and others, we present a full linear stability analysis of the growth modes and rates, reducing the system to a linear generalised eigenproblem in the Stokes case. Furthermore, we demonstrate by Plateau-style geometrical arguments that only axisymmetric instabilities need be considered. We show that the N=3 case is already sufficient to obtain several interesting phenomena: limiting cases of thin shells or low shell viscosity that reduce to N=2 problems, and a system with competing breakup processes at very different length scales. The latter is demonstrated with full 3-dimensional simulations. Many $N > 3$ c...

  6. The compliance contact model of cylindrical joints with clearances

    Institute of Scientific and Technical Information of China (English)

    Caishan Liu; Ke Zhang; Lei Yang; Keren Wang

    2005-01-01

    This paper is concerned with the determination of the normal force-displacement (NFD) relation for the contact problem of cylindrical joints with clearance. A simple formulation for this contact problem is developed by modeling the pin as a rigid wedge and the elastic plate as a simple Winkler elastic foundation. The numerical results show that the normal displacement relation based on Hertz theory is only valid for the case of large clearance with a small normal load, and the NFD relation based on Persson theory is only effective in the case of very small clearance. The proposed approximate model in this paper gives better results than Hertz theory and Persson theory in a large range of clearances as seen from the comparison with the results of FEM.

  7. Cylindrically symmetric solitons in Einstein-Yang-Mills theory

    CERN Document Server

    Galtsov, D V; Davydov, Evgeny A.; Gal'tsov, Dmitri V.

    2006-01-01

    Recently new Einstein-Yang-Mills (EYM) soliton solutions were presented which describe superconducting strings with Kasner asymptotic (hep-th/0610183). Here we study the static cylindrically symmetric SU(2) EYM system in more detail. The ansatz for the gauge field corresponds to superposition of the azimuthal $B_\\phi$ and the longitudinal $B_z$ components of the color magnetic field. We derive sum rules relating data on the symmetry axis to asymptotic data and show that generic asymptotic structure of regular solutions is Kasner. Solutions starting with vacuum data on the axis generically are divergent. Regular solutions correspond to some bifurcation manifold in the space of parameters which has the low-energy limiting point corresponding to string solutions in flat space (with the divergent total energy) and the high-curvature point where gravity is crucial. Some analytical results are presented for the low energy limit, and numerical bifurcation curves are constructed in the gravitating case. Depending on ...

  8. Note: Continuous synthesis of uniform vertical graphene on cylindrical surfaces.

    Science.gov (United States)

    Bo, Zheng; Cui, Shumao; Yu, Kehan; Lu, Ganhua; Mao, Shun; Chen, Junhong

    2011-08-01

    This note describes a new reactor design for continuous synthesis of vertically oriented graphene (VG) sheets on cylindrical wire substrates using an atmospheric plasma-enhanced chemical vapor deposition (PECVD) system. Through combining a U-shaped reactor design with "dynamic mode" synthesis featuring simultaneous rotational and axial movements of the metallic wire substrate, the new setup can enable continuous synthesis of VG sheets on the wire surface with remarkable uniformity in both circumferential and axial directions. In contrast, synthesis of VG at "static mode" with a fixed substrate can only lead to non-uniform growth of VG sheets on the wire surface. Potential applications of the resulting uniform-VG-coated metallic wire could include field emitters, field-ionization-based neutral atom detectors, and indoor corona discharges.

  9. Radiation and scattering from imperfect cylindrical electromagnetic cloaks.

    Science.gov (United States)

    Isic, G; Gajic, R; Novakovic, B; Popovic, Z V; Hingerl, K

    2008-02-04

    The design of electromagnetic invisibility cloaks is based on singular mappings prescribing zero or infinite values for material parameters on the inner surface of the cloak. Since this is only approximately feasible, an asymptotic analysis is necessary for a sound description of cloaks. We adopt a simple and effective approach for analyzing electromagnetic cloaks - instead of the originally proposed singular mapping, nonsingular mappings asymptotically approaching the ideal one are considered. Scattering and radiation from this type of imperfect cylindrical cloaks is solved analytically and the results are confirmed by full-wave finite element simulations. Our analysis sheds more light on the influence of this kind of imperfection on the cloaking performance and further explores the physics of cloaking devices.

  10. Vector cylindrical harmonics for low-dimensional convection models

    CERN Document Server

    Kelley, Douglas H; Knox, Catherine A

    2016-01-01

    Approximate empirical models of thermal convection can allow us to identify the essential properties of the flow in simplified form, and to produce empirical estimates using only a few parameters. Such "low-dimensional" empirical models can be constructed systematically by writing numerical or experimental measurements as superpositions of a set of appropriate basis modes, a process known as Galerkin projection. For Boussinesq convection in a cylinder, those basis modes should be defined in cylindrical coordinates, vector-valued, divergence-free, and mutually orthogonal. Here we construct two such basis sets, one using Bessel functions in the radial direction, and one using Chebyshev polynomials. We demonstrate that each set has those desired characteristics and demonstrate the advantages and drawbacks of each set. We show their use for representing sample simulation data and point out their potential for low-dimensional convection models.

  11. Mode-selectable ultrasonic transducer for cylindrical ferromagnetic waveguides

    Science.gov (United States)

    Kim, Youngkyu; Lee, Hocheol; Cho, Seung Hyun; Kim, Yoon Young

    2003-07-01

    Ultrasonic inspection techniques using magnetostrictive transducers have received much attention in recent years as non-contact, non-destructive means of inspecting ferromagnetic materials. By the selection of a desired mode and thus the rejection of the unwanted modes among propagating waves in a waveguide, different types of flaws existing in a cylindrical ferromagnetic waveguide can be effectively detected. However, desired mode selection methods have not been fully developed yet. The purpose of this research is to present a mangetostrictive sensor based technique for the selection of either the bending or longitudinal waves alone in a ferromagnetic waveguide. To achieve this goal, new bias magnet configurations, particularly for bending mode selection are suggested. Several experimental results are conducted to verify the effectiveness of the suggested magnetostrictive sensors.

  12. Nonobvious features of dynamics of circular cylindrical shells

    Science.gov (United States)

    Leizerovich, G. S.; Taranukha, N. A.

    2008-04-01

    In the framework of the nonlinear theory of flexible shallow shells, we study free bending vibrations of a thin-walled circular cylindrical shell hinged at the end faces. The finite-dimensional shell model assumes that the excitation of large-amplitude bending vibrations inevitably results in the appearance of radial vibrations of the shell. The modal equations are obtained by the Bubnov-Galerkin method. The periodic solutions are found by the Krylov-Bogolyubov method. We show that if the tangential boundary conditions are satisfied "in the mean," then, for a shell of finite length, significant errors arise in determining its nonlinear dynamic characteristics. We prove that small initial irregularities split the bending frequency spectrum, the basic frequency being smaller than in the case of an ideal shell.

  13. Transverse shear effect in a circumferentially cracked cylindrical shell

    Science.gov (United States)

    Delale, F.; Erdogan, F.

    1979-01-01

    The objectives of the paper are to solve the problem of a circumferentially-cracked cylindrical shell by taking into account the effect of transverse shear, and to obtain the stress intensity factors for the bending moment as well as the membrane force as the external load. The formulation of the problem is given for a specially orthotropic material within the framework of a linearized shallow shell theory. The particular theory used permits the consideration of all five boundary conditions as to moment and stress resultants on the crack surface. The effect of Poisson's ratio on the stress intensity factors and the nature of the out-of-plane displacement along the edges of the crack, i.e., bulging, are also studied.

  14. Vibrations of cantilevered shallow cylindrical shells of rectangular planform

    Science.gov (United States)

    Leissa, A. W.; Lee, J. K.; Wang, A. J.

    1981-01-01

    A cantilevered, shallow shell of circular cylindrical curvature and rectangular planform exhibits free vibration behavior which differs considerably from that of a cantilevered beam or of a flat plate. Some numerical results can be found for the problem in the previously published literature, mainly obtained by using various finite element methods. The present paper is the first definitive study of the problem, presenting accurate non-dimensional frequency parameters for wide ranges of aspect ratio, shallowness ratio and thickness ratio. The analysis is based upon shallow shell theory. Numerical results are obtained by using the Ritz method, with algebraic polynomial trial functions for the displacements. Convergence is investigated, with attention being given both to the number of terms taken for each co-ordinate direction and for each of the three components of displacement. Accuracy of the results is also established by comparison with finite element results for shallow shells and with other accurate flat plate solutions.

  15. Cylindrically symmetric cosmological model of the universe in modified gravity

    Science.gov (United States)

    Mishra, B.; Vadrevu, Samhita

    2017-02-01

    In this paper, we have constructed the cosmological models of the universe in a cylindrically symmetric space time in two classes of f(R,T) gravity (Harko et al. in Phys. Rev. D 84:024020, 2011). We have discussed two cases: one in the linear form and the other in the quadratic form of R. The matter is considered to be in the form of perfect fluid. It is observed that in the first case, the pressure and energy density remain the same, which reduces to a Zeldovich fluid. In the second case we have studied the quadratic function of f(R,T) gravity in the form f(R)=λ(R+R2) and f(T)=λ T. In the second case the pressure is in the negative domain and the energy density is in the positive domain, which confirms that the equation of state parameter is negative. The physical properties of the constructed models are studied.

  16. From Cylindrical to Stretching Ridges and Wrinkles in Twisted Ribbons

    Science.gov (United States)

    Pham Dinh, Huy; Démery, Vincent; Davidovitch, Benny; Brau, Fabian; Damman, Pascal

    2016-09-01

    Twisted ribbons under tension exhibit a remarkably rich morphology, from smooth and wrinkled helicoids, to cylindrical or faceted patterns. This complexity emanates from the instability of the natural, helicoidal symmetry of the system, which generates both longitudinal and transverse stresses, thereby leading to buckling of the ribbon. Here, we focus on the tessellation patterns made of triangular facets. Our experimental observations are described within an "asymptotic isometry" approach that brings together geometry and elasticity. The geometry consists of parametrized families of surfaces, isometric to the undeformed ribbon in the singular limit of vanishing thickness and tensile load. The energy, whose minimization selects the favored structure among those families, is governed by the tensile work and bending cost of the pattern. This framework describes the coexistence lines in a morphological phase diagram, and determines the domain of existence of faceted structures.

  17. Circumferential buckling instability of a growing cylindrical tube

    KAUST Repository

    Moulton, D.E.

    2011-03-01

    A cylindrical elastic tube under uniform radial external pressure will buckle circumferentially to a non-circular cross-section at a critical pressure. The buckling represents an instability of the inner or outer edge of the tube. This is a common phenomenon in biological tissues, where it is referred to as mucosal folding. Here, we investigate this buckling instability in a growing elastic tube. A change in thickness due to growth can have a dramatic impact on circumferential buckling, both in the critical pressure and the buckling pattern. We consider both single- and bi-layer tubes and multiple boundary conditions. We highlight the competition between geometric effects, i.e. the change in tube dimensions, and mechanical effects, i.e. the effect of residual stress, due to differential growth. This competition can lead to non-intuitive results, such as a tube growing to be thinner and yet buckle at a higher pressure. © 2011 Elsevier Ltd. All rights reserved.

  18. First and second sound in cylindrically trapped gases.

    Science.gov (United States)

    Bertaina, G; Pitaevskii, L; Stringari, S

    2010-10-08

    We investigate the propagation of density and temperature waves in a cylindrically trapped gas with radial harmonic confinement. Starting from two-fluid hydrodynamic theory we derive effective 1D equations for the chemical potential and the temperature which explicitly account for the effects of viscosity and thermal conductivity. Differently from quantum fluids confined by rigid walls, the harmonic confinement allows for the propagation of both first and second sound in the long wavelength limit. We provide quantitative predictions for the two sound velocities of a superfluid Fermi gas at unitarity. For shorter wavelengths we discover a new surprising class of excitations continuously spread over a finite interval of frequencies. This results in a nondissipative damping in the response function which is analytically calculated in the limiting case of a classical ideal gas.

  19. INTERNAL FINISHING OF CYLINDRICAL PIPES USING SINTERED MAGNETIC ABRASIVES

    Directory of Open Access Journals (Sweden)

    PALWINDER SINGH

    2011-07-01

    Full Text Available An internal magnetic abrasive finishing (MAF process was proposed to produce highly finished inner surfaces of workpieces used in critical applications. The process principle and the finishing characteristics of magnetic abrasive finishing of cylindrical pipes using sintered magnetic abrasives are described in this research work. Thesintered magnetic abrasive is a mixture of Al2O3 abrasive and ferromagnetic particles. The Al2O3 based sintered magnetic abrasives have been developed in sintering machine. The surface roughness measurements resulting from finishing experiments demonstrate the effects of the abrasive behavior on the surface modifications. Thesurface finish was analysed in terms of percent improvement in surface finish (PISF. Also surface finish was analysed using Response Surface Methodology (RSM. The obtained maximum PISF was 95% and minimum surface roughness was 0.05 μm Ra. To further study the improvement in surface finish, the surface was microscopically examined using X-Ray Diffraction (XRD.

  20. Evaluation of hybrid composite materials in cylindrical specimen geometries

    Science.gov (United States)

    Liber, T.; Daniel, I. M.

    1976-01-01

    Static and fatigue properties of three composite materials and hybrids were examined. The materials investigated were graphite/epoxy, S-glass/epoxy, PRD-49 (Kevlar 49)/epoxy, and hybrids in angle-ply configurations. A new type of edgeless cylindrical specimen was developed. It is a flattened tube with two flat sides connected by curved sections and it is handled much like the standard flat coupon. Special specimen fabrication, tabbing, and tab region reinforcing techniques were developed. Axial modulus, Poisson's ratio, strength, and ultimate strain were obtained under static loading from flattened tube specimens of nine laminate configurations. In the case of graphite/epoxy the tubular specimens appeared to yield somewhat higher strength and ultimate strain values than flat specimens. Tensile fatigue tests were conducted with all nine types of specimens and S-N curves obtained. Specimens surviving 10 million cycles of tensile loading were subsequently tested statically to failure to determine residual properties.

  1. Photoacoustic section imaging with an integrating cylindrical detector

    Science.gov (United States)

    Gratt, Sibylle; Passler, Klaus; Nuster, Robert; Paltauf, Guenther

    2011-07-01

    A piezoelectric detector with cylindrical shape for photoacoustic section imaging is characterized. This detector is larger than the imaging object in direction of the cylinder axis, giving rise to its integrating properties. Its focal volume has the shape of a slice and the acquisition of signals for one section image requires rotation of an object about an axis perpendicular to this slice. Image reconstruction from the signals requires the application of the inverse Radon transform. It is shown that implementing the Abel transform is a suitable step in data processing, allowing speeding up the data acquisition since the scanning angle can be reduced. The resolution of the detector was estimated in directions perpendicular and parallel to the detection plane. An upper limit for the out of plane resolution is given and section images of a zebra fish are shown.

  2. NONLINEAR WAVE INDUCED BY AN ACCELERATING CYLINDRICAL TANK

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    This paper presents a method of solving Lagrangian version of governing equations that allows boundary conditions at the free surface to be satisfied exactly, which is a three-dimensional generalization of a method first put forward by Stoker. Analytical expressions of nonlinear hydrodynamic pressure up to the third order and of free surface displacement up to the fourth order of an accelerating cylindrical tank were obtained. Here only the motions of objects in their early stage after initial impulses was considered. As a justification of the method, the importment special case when the ratio of tank diameter to fluid depth tends to infinity was taken as an exainple, which shows that the linear hydrodynamic pressure obtained agrees completely with Westergaard or von Karman's classical result.

  3. Rotating solitary wave at the wall of a cylindrical container

    KAUST Repository

    Amaouche, Mustapha

    2013-04-30

    This paper deals with the theoretical modeling of a rotating solitary surface wave that was observed during water drainage from a cylindrical reservoir, when shallow water conditions were reached. It represents an improvement of our previous study, where the radial flow perturbation was neglected. This assumption led to the classical planar Korteweg–de Vries equation for the wall wave profile, which did not account for the rotational character of the base flow. The present formulation is based on a less restricting condition and consequently corrects the last shortcoming. Now the influence of the background flow appears in the wave characteristics. The theory provides a better physical depiction of the unique experiment by predicting fairly well the wave profile at least in the first half of its lifetime and estimating the speed of the observed wave with good accuracy.

  4. Large Scale Magnetohydrodynamic Dynamos from Cylindrical Differentially Rotating Flows

    CERN Document Server

    Ebrahimi, F

    2015-01-01

    For cylindrical differentially rotating plasmas threaded with a uniform vertical magnetic field, we study large-scale magnetic field generation from finite amplitude perturbations using analytic theory and direct numerical simulations. Analytically, we impose helical fluctuations, a seed field, and a background flow and use quasi-linear theory for a single mode. The predicted large-scale field growth agrees with numerical simulations in which the magnetorotational instability (MRI) arises naturally. The vertically and azimuthally averaged toroidal field is generated by a fluctuation-induced EMF that depends on differential rotation. Given fluctuations, the method also predicts large-scale field growth for MRI-stable rotation profiles and flows with no rotation but shear.

  5. The Einstein field equations for cylindrically symmetric elastic configurations

    Energy Technology Data Exchange (ETDEWEB)

    Brito, I; Vaz, E G L R [Departamento de Matematica e Aplicacoes, Universidade do Minho, 4800-058 Guimaraes (Portugal); Carot, J, E-mail: ireneb@math.uminho.pt, E-mail: jcarot@uib.cat, E-mail: evaz@math.uminho.pt [Departament de Fisica, Universitat de les Illes Balears, Cra Valdemossa pk 7.5, E-07122 Palma (Spain)

    2011-09-22

    In the context of relativistic elasticity it is interesting to study axially symmetric space-times due to their significance in modeling neutron stars and other astrophysical systems of interest. To approach this problem, here, a particular class of these space-times is considered. A cylindrically symmetric elastic space-time configuration is studied, where the material metric is taken to be flat. The components of the energy-momentum tensor for elastic matter are written in terms of the invariants of the strain tensor, here chosen to be the eigenvalues of the pulled-back material metric. The Einstein field equations are presented and a condition confirming the existence of a constitutive function is obtained. This condition leads to special cases, in one of which a new system for the metric functions and an expression for the constitutive function are deduced. The new system depends on a particular function, which builds up the constitutive equation.

  6. Magnetoelectroelastic fields in rotating multiferroic composite cylindrical structures

    Institute of Scientific and Technical Information of China (English)

    Ji YING; Hui-ming WANG

    2009-01-01

    An analytical solution is obtained for a rotating multiferroic composite hollow cylinder made of radially polarized piezoelectric and piezomagnetic materials. Both the number of layers and the stacking sequence of the composite cylinder can be arbitrary. General mechanical, electric and magnetic boundary conditions can be applied at both the inner and outer cylindrical surfaces. The state space method is employed so that only a 2×2 matrix is involved in the whole solving procedure. In the nu-merical experiments, the distributions of elastic, electric as well as magnetic fields in an internally pressurized rotating BaTiO3/CoFe204 composite hollow cylinder subjected to different boundary conditions are presented graphically. The results clearly show that the stress fields in a multiferroic composite cylinder are controllable.

  7. The cylindrical magnetic Rayleigh-Taylor instability for viscous fluids

    Energy Technology Data Exchange (ETDEWEB)

    Chambers, K.; Forbes, L. K. [School of Mathematics and Physics, University of Tasmania, Private Bag 37-Hobart, Tasmania 7005 (Australia)

    2012-10-15

    This paper considers a cylindrical Rayleigh-Taylor instability, in which a heavy fluid surrounds a light fluid, and gravity is directed radially inwards. A massive object is located at the centre of the light fluid, and it behaves like a line dipole both for fluid flow and magnetic field strength. The initially circular interface between the two conducting fluids evolves into plumes, dependent on the magnetic and fluid dipole strengths and the nature of the initial disturbance to the interface. A spectral method is presented to solve the time-dependent interface shapes, and results are presented and discussed. Bipolar solutions are possible, and these are of particular relevance to astrophysics. The solutions obtained resemble structures of some HII regions and nebulae.

  8. Geometric design constratins for controlled fragmentation of metallic cylindrical shells

    Science.gov (United States)

    Pike, Allen William

    Geometric designs for the controlled fragmentation of cylindrical shells have been successfully modeled by means of CTH hydrocode simulation. Design parameters varied include the shell radius, thickness, and the depth and spacing of interior notches. A large number of shell designs were analyzed and their controlled fragmentation effectiveness categorized. The best overall controlled fragmentation designs exhibit full and complete fragment breakup as prescribed along the system of interior grooves or notches without any of the individual fragments naturally fragmenting throughout their thicknesses. For the combination of the Composition C-4 explosive and the 4340 steel, the best performing designs were shown to commonly possess the following characteristics: (1) they each have notch or groove depths greater than half of the shell thickness, (2) they each have notch or groove spacing within a range that is approximately the same as the shell thickness, and (3) they each have shell thicknesses many times smaller than the shell radius.

  9. Polaronic Effects of an Exciton in a Cylindrical Quantum Wire

    Institute of Scientific and Technical Information of China (English)

    WANG Rui-Qiang; XIE Hong-Jing; GUO Kang-Xian; YU You-Bin; DENG Yong-Qing

    2005-01-01

    The effects of exciton-optical phonon interaction on the binding energy and the total and reduced effective masses of an exciton in a cylindrical quantum wire have been investigated. We adopt a perturbative-PLL [T.D. Lee,F. Low, and D. Pines, Phys. Rev. B90 (1953) 297] technique to construct an effective Hamiltonian and then use a variational solution to deal with the exciton-phonon system. The interactions of exciton with the longitudinal-optical phonon and the surface-optical phonon have been taken into consideration. The numerical calculations for GaAs show that the influences of phonon modes on the exciton in a quasi-one-dimensional quantum wire are considerable and should not be neglected. Moreover the numerical results for heavy- and light-hole exciton are obtained, which show that the polaronic effects on two types of excitons are very different but both depend heavily on the sizes of the wire.

  10. SOLUTIONS FOR CYLINDRICAL CAVITY IN SATURATED THERMOPOROELASTIC MEDIUM

    Institute of Scientific and Technical Information of China (English)

    Bing Bai; Tao Li

    2009-01-01

    Based on the thermodynamics of irreversible processes, the mass conservation equa-tion and heat energy balance equation are established. The governing equations of thermal con-solidation for homogeneous isotropic materials are presented, accounting for the coupling effects of the temperature, stress and displacement fields. The ease of a saturated medium with a long cylindrical cavity subjected to a variable thermal loading and a variable hydrostatic pressure (or a variable radial water flux) with time is considered. The analytical solutions are derived in the Laplace transform space. Then, the time domain solutions are obtained by a numerical inversion scheme. The results of a typical example indicate that thermodynamically coupled effects have considerable influences on thermal responses.

  11. Traveling circumferential unstable wave of cylindrical flame front

    Science.gov (United States)

    Trilis, A. V.; Vasiliev, A. A.; Sukhinin, S. V.

    2016-06-01

    The researches of stability of cylindrical front of deflagration combustion in an annular combustion chamber were made using phenomenological model. The flame front is described as discontinuity of gasdynamic parameters. It is considered that the combustion products are under chemical equilibrium. The combustible mixture and the combustion products are ideal gases. The velocity of deflagration combustion is determined using the Chapman-Jouget theory. It depends on the temperature of combustible mixture only. It is found that the combustible flame front is unstable for several types of small disturbances in the system Mechanics of instabilities are examined using both the numeric and analytical methods. The cases of evolution of the unstable waves rotating in circular channel are presented.

  12. Cylindrical Antenna With Partly Adaptive Phased-Array Feed

    Science.gov (United States)

    Hussein, Ziad; Hilland, Jeff

    2003-01-01

    A proposed design for a phased-array fed cylindrical-reflector microwave antenna would enable enhancement of the radiation pattern through partially adaptive amplitude and phase control of its edge radiating feed elements. Antennas based on this design concept would be attractive for use in radar (especially synthetic-aperture radar) and other systems that could exploit electronic directional scanning and in which there are requirements for specially shaped radiation patterns, including ones with low side lobes. One notable advantage of this design concept is that the transmitter/ receiver modules feeding all the elements except the edge ones could be identical and, as a result, the antenna would cost less than in the cases of prior design concepts in which these elements may not be identical.

  13. Slow light with electromagnetically induced transparency in cylindrical waveguide

    CERN Document Server

    Hatta, Agus Muhamad; Al-Hagan, Ola A; Moiseev, Sergey A

    2014-01-01

    Slow light with electromagnetically induced transparency (EIT) in the core of cylindrical waveguide (CW) for an optical fiber system containing three-level atoms is investigated. The CW modes are treated in the weakly guiding approximation which renders the analysis into manageable form. The transparency window and permittivity profile of the waveguide due to the strong pump field in the EIT scheme is calculated. For a specific permittivity profile of the waveguide due to EIT, the propagation constant of the weak signal field and spatial shape of fundamental guided mode are calculated by solving the vector wave equation using the finite difference method. It is found that the transparency window and slow light field can be controlled via the CW parameters. The reduced group velocity of slow light in this configuration is useful for many technological applications such as optical memories, effective control of single photon fields, optical buffer and delay line.

  14. NUMERICAL SIMULATION OF ORIENTATION DISTRIBUTION FUNCTION OF CYLINDRICAL PARTICLE SUSPENSIONS

    Institute of Scientific and Technical Information of China (English)

    林建忠; 张凌新

    2002-01-01

    The orientation distribution function of cylindrical particle suspensions was deduced and numerically simulated, and an application was taken in a wedge-shaped flow field. The relationship between the orientation distribution function and particle orientation angles was obtained. The results show that comparing with the most probable angle distribution which comes to being in short time, the distribution of the steady state doesn' t vary much in range ; the main difference is the anti-clockwise rotation in the right and upper field, that is, particles rotate more at the points where the velocity gradients are larger.The most probable orientations are close to the direction of local streamlines. In the direction of streamlines, with poleradius decreasing, the most probable angles increase,but the angles between their orientations and the local streamlines decrease.

  15. Vibratory behaviors of Jeffcott system on cylindrical roller bearings

    Institute of Scientific and Technical Information of China (English)

    Hao WU; Jianwen WANG; Qi AN

    2009-01-01

    A Jeffcott rotor system on cylindrical roller beatings is studied in detail. Its critical speed is calculated by a new calculation method with roller bearing stiffness and damping. The influences of beating parameters, such as the roller length, rotor mass, distance between the bearings and the kinematics viscosity of lubrication on the system critical speed are numerically studied, and the influences of an oil film and damping on the critical speed are also studied. Regular curves of the relationship between the geometric parameters and the system critical speed are obtained. The results show that with increasing roller length and radial load, the critical speed increases; and with increasing rotor mass and the distance between the beatings and the kinematics viscosity, the critical speed decreases. This means that an oil film will decrease the critical rotational speed of the rotor system.

  16. On several static cylindrically symmetric solutions of the Einstein equations

    Science.gov (United States)

    Grigoryev, Sergey; Leonov, Arkadiy

    2016-04-01

    We study the Einstein equations in the static cylindrically symmetric case with the stress-energy tensor of the form T νμ = diag{μ,-αμ,-βμ,-γμ}, where μ is an unknown function and α, β, γ are arbitrary real constants (α is assumed to be nonzero). The stress-energy tensor of this form includes as special cases several well-known solutions, such as the perfect fluid solution with the barotropic equation of state, the solution with the static electric field and the solution with the massless scalar field. We solve the Einstein equations with this stress-energy tensor and study some properties of the obtained metric.

  17. ADVANCES IN THE MODEL OF CYLINDRICAL ALKALINE CELLS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The advancement of a systematic investigation on the modeling of cylindrical alkaline cells is presented.Initial analysis utilizes thermodynamic and kinetic information to predict alkaline cell performance under low discharge rates.Subsequent modling has taken into consideration detailed information on the chemistry of electrode reactions,mass tranport of dissolved species,physical and chemical properties of the electrolyte and solid phases,and internal geonetry of cell systems.The model is capable of predicting alkaline cell performance under a variety of dicharge conditions.The model also provides information regarding internal cell changes during discharge.The model is the basis of a rational approach for the optimal design of cells.

  18. Magnified imaging based on non-Hermitian nonlocal cylindrical metasurfaces

    Science.gov (United States)

    Savoia, Silvio; Valagiannopoulos, Constantinos A.; Monticone, Francesco; Castaldi, Giuseppe; Galdi, Vincenzo; Alà, Andrea

    2017-03-01

    We show that a cylindrical lensing system composed of two metasurfaces with suitably tailored non-Hermitian (i.e., with distributed gain and loss) and nonlocal (i.e., spatially dispersive) properties can perform magnified imaging with reduced aberrations. More specifically, we analytically derive the idealized surface-impedance values that are required for "perfect" magnification and imaging and elucidate the role and implications of non-Hermiticity and nonlocality in terms of spatial resolution and practical implementation. For a basic demonstration, we explore some proof-of-principle quasilocal and multilayered implementations and independently validate the outcomes via full-wave numerical simulations. We also show that the metasurface frequency-dispersion laws can be chosen so as to ensure unconditional stability with respect to arbitrary temporal excitations. These results, which extend previous studies on planar configurations, may open intriguing venues in the design of metastructures for field imaging and processing.

  19. Dimension effects in plasma immersion ion implantation of cylindrical bore

    CERN Document Server

    Tian Xiu Bo; Tong Hong Hui; Chu, P K

    2002-01-01

    Plasma immersion ion implantation is a new technique pertaining to ion implantation. Different from the case of exterior surface treatment, plasma immersion ion implantation of interior surface possesses dimension effects. Consequently it is a challenge to implant the inner wall of a cylindrical bore due to this finite dimension.The ion energy cannot be linearly changed with applied voltage and there exists a saturation value due to overlap effect of plasma sheath. The plasma in the bore may rapidly be depleted, which is attributed to finite plasma volume and plasma-sheath con-flowing effect. For instance the plasma depletion time is about 0.55 mu s when a bore with a diameter of 20 cm is treated under conditions of applied voltage of 30 kV and plasma density of 2 x 10 sup 1 sup 5 ions/cm sup 3. Interior plasma-source hardware may be an effective solution

  20. DOA Estimation of Cylindrical Conformal Array Based on Geometric Algebra

    Directory of Open Access Journals (Sweden)

    Minjie Wu

    2016-01-01

    Full Text Available Due to the variable curvature of the conformal carrier, the pattern of each element has a different direction. The traditional method of analyzing the conformal array is to use the Euler rotation angle and its matrix representation. However, it is computationally demanding especially for irregular array structures. In this paper, we present a novel algorithm by combining the geometric algebra with Multiple Signal Classification (MUSIC, termed as GA-MUSIC, to solve the direction of arrival (DOA for cylindrical conformal array. And on this basis, we derive the pattern and array manifold. Compared with the existing algorithms, our proposed one avoids the cumbersome matrix transformations and largely decreases the computational complexity. The simulation results verify the effectiveness of the proposed method.

  1. Vibrations of cantilevered shallow cylindrical shells of rectangular planform

    Science.gov (United States)

    Leissa, A. W.; Lee, J. K.; Wang, A. J.

    1981-10-01

    A cantilevered, shallow shell of circular cylindrical curvature and rectangular planform exhibits free vibration behavior which differs considerably from that of a cantilevered beam or of a flat plate. Some numerical results can be found for the problem in the previously published literature, mainly obtained by using various finite element methods. The present paper is the first definitive study of the problem, presenting accurate non-dimensional frequency parameters for wide ranges of aspect ratio, shallowness ratio and thickness ratio. The analysis is based upon shallow shell theory. Numerical results are obtained by using the Ritz method, with algebraic polynomial trial functions for the displacements. Convergence is investigated, with attention being given both to the number of terms taken for each co-ordinate direction and for each of the three components of displacement. Accuracy of the results is also established by comparison with finite element results for shallow shells and with other accurate flat plate solutions.

  2. Effect of Light Conducting Cylindrical Inserts on Gingival Microleakage

    Directory of Open Access Journals (Sweden)

    SM. Moazzami

    2007-03-01

    Full Text Available Objective: Microleakage in the gingival floor of class II composite restorations can compromise the marginal adaptation of the filling material to the cavity edges. The aim of this study was to evaluate the effect of light conducting cylindrical inserts in decreasing the microleakage of the gingival floor in cavities 1mm below the CEJ.Materials and Methods: Eighty maxillary first molars were randomly divided into eight groups according to use of glass inserts, type of resin (Coltene unfilled resin versus Scotchbond multi purpose and filling technique (one-unit versus incremental. Proximal class II cavities were prepared in all samples with the gingival floor one millimeter below the CEJ. Etched and silan-treated glass inserts were made from 2mm cylindrical bioglass material and cavities were restored according to research protocol. The samples were subjected to 2500 thermal cycles (5-55oC, immersed in 0.5% basic fuchsin solution, embedded in epoxy resin and cut centrally and laterally (buccally or lingually in a mesiodistal direction. Microleakage was scored and collected data were statistically analyzed using Kruskal-Wallis and Mann-Whitney tests.Results: Minimal dye penetration was observed in the group that employed the incre-mental technique along with Scotchbond, with or without glass inserts. A significant difference was observed between the eight groups. In addition the use of the incremental technique and glass inserts had a significant effect on the microleakage of lateral and central sections, respectively. Application of dentin bonding agent signifi-cantly affected both sections.Conclusion: Glass inserts were effective in decreasing cervical microleakage of class II cavities restored with composite resin.

  3. Self-consistent equilibria in cylindrical reversed-field pinch

    Energy Technology Data Exchange (ETDEWEB)

    Lo Surdo, C. [ENEA, Centro Ricerche Frascati, Rome (Italy). Dip. di Energia; Paccagnella, R.; Guo, S. [CNR, Padua (Italy). Istituto Gas Ionizzati

    1995-07-01

    The object of this work is to study the self-consistent magnetofluidstatic equilibria of a 2-region (plasma + gas) reversed-field pinch (RFP) in cylindrical approximation (namely, with vanishing inverse aspect ratio). Differently from what happens in a tokamak, in a RFP a significant part of the plasma current is driven by a dynamo electric field (DEF), in its turn mainly due to plasma turbulence. So, it is worked out a reasonable mathematical model of the above self-consistent equilibria under the following main points it has been: (a) to the lowest order, and according to a standard ansatz, the turbulent DEF say {epsilon}{sup t}, is expressed as a homogeneous transform of the magnetic field B of degree 1, {epsilon}{sup t}=({alpha}) (B), with {alpha}{identical_to}a given 2-nd rank tensor, homogeneous of degree 0 in B and generally depending on the plasma state; (b) {epsilon}{sup t} does not explicitly appear in the plasma energy balance, as it were produced by a Maxwell demon able of extract the corresponding Joule power from the plasma. In particular, it is showed that, if both {alpha} and the resistivity tensor {eta} are isotropic and constant, the magnetic field is force-free with abnormality equal to {alpha}{eta}{sub 0}/{eta}, in the limit of vanishing {beta}; that is, the well-known J.B. Taylor`result is recovered, in this particular conditions, starting from ideas quite different from the usual ones (minimization of total magnetic energy under constrained total elicity). Finally, the general problem is solved numerically under circular (besides cylindrical) symmetry, for simplicity neglecting the existence of gas region (i.e., assuming the plasma in direct contact with the external wall).

  4. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  5. Resonant Excitation of a Truncated Metamaterial Cylindrical Shell by a Thin Wire Monopole

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Erentok, Aycan; Breinbjerg, Olav

    2009-01-01

    A truncated metamaterial cylindrical shell excited by a thin wire monopole is investigated using the integral equation technique as well as the finite element method. Simulations reveal a strong field singularity at the edge of the truncated cylindrical shell, which critically affects the matching...

  6. On the Energy-Momentum Densities of the Cylindrically Symmetric Gravitational Waves

    CERN Document Server

    Havare, A; Yetkin, T; Havare, Ali; Salti, Mustafa; Yetkin, Taylan

    2005-01-01

    In this study, using Moller and Tolman prescriptions we calculate energy and momentum densities for the general cylindrically symmetric spacetime metric. We find that results are finite and well defined in these complexes. We also give the results for some cylindrically symmetric spacetime models.

  7. Numerical computation of the restoring force in a cylindrical bearing containing magnetic liquid

    Directory of Open Access Journals (Sweden)

    Greconici Marian

    2008-01-01

    Full Text Available Present paper deals with the second order of magnetic levitation, applied to a cylindrical bearing holding a magnetized shaft and the magnetic liquid The magnetic restoring force acting on the shaft of the cylindrical bearing. was numerically evaluated, the liquid being considered a nonlinear medium.

  8. Energy-Momentum Pseudo-tensor of Cylindrical Gravitational Waves of Both the Polarized States

    Institute of Scientific and Technical Information of China (English)

    文德华; 李芳昱; 刘良钢

    2002-01-01

    According to the Einstein-Tolman expression of the energy-momentum pseudo-tensor (EMPT), we. calculate the EMPT of cylindrical gravitational waves (CGW) of both the polarized states (BPS) in cylindrical polar coordinates and Cartesian coordinates. We find that Cartesian coordinates are the more suitable coordinates to describe the CGW of BPS.

  9. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  10. A novel vibration mode testing method for cylindrical resonators based on microphones.

    Science.gov (United States)

    Zhang, Yongmeng; Wu, Yulie; Wu, Xuezhong; Xi, Xiang; Wang, Jianqiu

    2015-01-16

    Non-contact testing is an important method for the study of the vibrating characteristic of cylindrical resonators. For the vibratory cylinder gyroscope excited by piezo-electric electrodes, mode testing of the cylindrical resonator is difficult. In this paper, a novel vibration testing method for cylindrical resonators is proposed. This method uses a MEMS microphone, which has the characteristics of small size and accurate directivity, to measure the vibration of the cylindrical resonator. A testing system was established, then the system was used to measure the vibration mode of the resonator. The experimental results show that the orientation resolution of the node of the vibration mode is better than 0.1°. This method also has the advantages of low cost and easy operation. It can be used in vibration testing and provide accurate results, which is important for the study of the vibration mode and thermal stability of vibratory cylindrical gyroscopes.

  11. A Novel Vibration Mode Testing Method for Cylindrical Resonators Based on Microphones

    Directory of Open Access Journals (Sweden)

    Yongmeng Zhang

    2015-01-01

    Full Text Available Non-contact testing is an important method for the study of the vibrating characteristic of cylindrical resonators. For the vibratory cylinder gyroscope excited by piezo-electric electrodes, mode testing of the cylindrical resonator is difficult. In this paper, a novel vibration testing method for cylindrical resonators is proposed. This method uses a MEMS microphone, which has the characteristics of small size and accurate directivity, to measure the vibration of the cylindrical resonator. A testing system was established, then the system was used to measure the vibration mode of the resonator. The experimental results show that the orientation resolution of the node of the vibration mode is better than 0.1°. This method also has the advantages of low cost and easy operation. It can be used in vibration testing and provide accurate results, which is important for the study of the vibration mode and thermal stability of vibratory cylindrical gyroscopes.

  12. Orientation of cylindrical particles in gas-solid circulating fluidized bed

    Institute of Scientific and Technical Information of China (English)

    Jie Cai; Qihe Li; Zhulin Yuan

    2012-01-01

    The orientation of cylindrical particles in a gas-solid circulating fluidized bed was investigated by establishing a three-dimensional Euler-Lagrange model on the basis of rigid kinetics,impact kinetics and gas-solid two-phase flow theory.The resulting simulation indicated that the model could well illustrate the orientation of cylindrical particles in a riser during fluidization,The influences of bed structure and operation parameters on orientation of cylindrical particles were then studied and compared with related experimental results.The simulation results showed that the majority of cylindrical particles move with small nutation angles in the riser,the orientation of cylindrical particles is affected more obviously by their positions than by their slenderness and local gas velocities.The simulation results well agree with experiments,thus validating the proposed model and computation.

  13. Preliminary measurement performance evaluation of a new white light interferometer for cylindrical surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Albertazzi, Armando Jr; Pont, Alex Dal [Federal University of Santa Catarina, Metrology and Automation Laboratory, Cx Postal 5053, CEP 88 040-970, Florianopolis, SC (Brazil)

    2005-01-01

    This paper introduces a new design of a white light interferometer, suitable for measurement of cylindrical or quasi-cylindrical parts. A high precision 45 deg. conical mirror is used to direct collimated light radially, making it possible to measure in true cylindrical coordinates. The image of the measurand, distorted by the conical mirror, is projected in a high resolution digital camera. A mapping algorithm is used to reconstruct the cylindrical geometry from the distorted image. The rest of the interferometer is quite similar to a conventional white light interferometer: A flat reference mirror is scanned through the measurement range while an algorithm is searching for the maximum contrast position of the interference pattern. The performance evaluation of a configuration suitable for measurement of external cylindrical surfaces is also presented in this paper. A master cylinder was used as reference. Uncertainties of about 1.0 {mu}m were found at the present stage of development.

  14. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  15. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  16. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  17. AC optik - visuaalisen identiteetin suunnittelu optikkoliikkeelle

    OpenAIRE

    Valén, Wilma

    2017-01-01

    Toteutin opinnäytetyöni yhdessä pienen loviisalaisen optikkoliikkeen, AC optikin kanssa. Opinnäytetyössäni suunnittelen AC optikille uuden visuaalisen ilmeen ja brändätyn pakkauksen, jossa silmälasit ja oheistavara on helppo luovuttaa asiakkaalle. Taustoitan aihettani yksityisyrittäjälle tärkeistä näkökulmista eli keskittymällä positiivisen asiakaskokemuksen tärkeyteen brändin rakentamisessa. Sen lisäksi käyn läpi visuaalisen identiteetin suunnittelun elementtejä ja pakkauksen asemaa brän...

  18. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  19. Impact of Inner Surface Perturbations on the Stability of Cylindrical Liner Implosion

    Science.gov (United States)

    Weis, Matthew; Peterson, Kyle; Hess, Mark; Lau, Y. Y.; Zhang, Peng; Gilgenbach, Ronald

    2015-11-01

    This paper studies the effects of initial perturbations on the inner liner surface (ILS) of an imploding cylindrical liner. In MagLIF, nonuniform preheat of the fuel could provide an additional source of spatial nonuniformity on the ILS. A blast wave generated by the laser preheat might trigger the Richtmyer-Meshkov instability (RM) on the ILS which then serves as another seed to the Rayleigh-Taylor instability (RT) during the stagnation (deceleration) phase of the implosion. Another scenario is that the shock initiated from the outer liner surface, during current rise, propagates inward and is reflected at the ILS. This reflected shock would carry the initial ILS perturbations which then serve as an additional seed for the magneto-RT (MRT) during the acceleration phase of the implosion. These potentially dangerous interactions are analyzed using the 2D HYDRA code. The effects of axial magnetic fields, of the initial surface roughness spectrum, and of gas fill or water fill (to examine deceleration phase RT) are studied. M. R. Weis was supported by the Sandia National Laboratories. This work was also supported by DoE Grant DE-SC0012328.

  20. Bulging Modes of Circular Bottom Plates in Rigid Cylindrical Containers Filled with a Liquid

    Directory of Open Access Journals (Sweden)

    Marco Amabili

    1997-01-01

    Full Text Available In this article the free vibrations of the bottom plate of an otherwise rigid circular cylindrical tank filled with liquid are studied, considering only the bulging modes (when the amplitude of the plate displacement is predominant with respect to that of the free surface. The tank axis is vertical, thus the free liquid surface is orthogonal to the tank axis. The liquid is assumed to be inviscid, and the contribution of the free surface waves to the dynamic pressure on the free liquid surface is neglected. Wet and dry mode shapes of the plate are assumed to be the same, so that the natural frequencies are obtained by using the nondimensionalized added virtual mass incremental (NA VMI factors and the modal properties of dry plates. This simplifies computations compared to other existing theoretical approaches. NAVMI factors express the nondimensionalized ratio between the reference kinetic energy of the liquid and that of the plate and have the advantage that, due to their nondimensional form, they can be computed once and for all. Numerical results for simply supported and clamped bottom plates, as well as for supported plates with an elastic moment edge constraint are given. For more accurate results, and to exceed the limits of the assumed modes approach, the Rayleigh-Ritz method is applied and results are compared to those obtained by using the NAVMI factors and other existing methods in the literature.