Vertical load analysis of cylindrical ACS support structures
International Nuclear Information System (INIS)
Kennedy, J.M.; Belytschko, T.B.
1984-01-01
A new concept in LMFBR design ACS (above-core structures) supports which has generated some interest is to use a single large radius cylinder. The advantages of a single cylinder are reduced cost of fabrication, increased lateral stiffness, which enhances seismic resistance, and easier access to the fuel. However, the performance of these support structures when submitted to vertical loads from the core area may be substantially different, for the buckling and postbuckling behavior of a cylinder differs substantially from that of cylindrical beams. In this paper, a comparative analysis of an old prototypical support by 4 columns is compared with a cylindrical support. It is assumed that the single cylinder replaces the 4 columns in the original design. The dimensions of the two designs are compared
International Nuclear Information System (INIS)
Yu-Yan, Shen; Xiao-Gang, Chen; Wei, Cui; Yan-Hua, Hao; Qian-Qian, Li
2009-01-01
This paper uses the perturbation method to study effective response of nonlinear cylindrical coated composites. Under the external AC and DC electric field E a (1 + sin ωt), the local potentials of composites at all harmonic frequencies are induced. An effective nonlinear response to composite is given for the cylindrical coated inclusions in the dilute limit. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Construction of self-supporting cylindrical multiwire proportional chambers
International Nuclear Information System (INIS)
Kobayashi, Masaaki; Fujitani, Takeo; Omori, Tsunehiko; Sugimoto, Shojiro; Yamaguchi, Yoshitake; Nakagawa, Yuji; Wada, Toshiaki.
1984-08-01
Cylindrical MWPC's have been constructed with 240-430 mm in anode diameter and 750 mm in length. They are supported by inner and outer cathode cylinders made of approximately 6 mm thick aramid fibre/phenolic resin honeycomb, sandwiched between 50 μm thick Kapton sheets with or without Cu strips laminated to them. The chambers have been successfully used throughout the E68(P-barPC) experiment at the KEK 12 GeV Proton Synchrotrons. Constructional details are described. (author)
Wave motion in a thick cylindrical rod undergoing longitudinal impact
Czech Academy of Sciences Publication Activity Database
Červ, Jan; Adámek, V.; Valeš, František; Gabriel, Dušan; Plešek, Jiří
2016-01-01
Roč. 66, November (2016), s. 88-105 ISSN 0165-2125 R&D Projects: GA ČR(CZ) GAP101/12/2315; GA TA ČR(CZ) TH01010772 Institutional support: RVO:61388998 Keywords : elastic waves * impact * thick cylindrical rod * analytical solution * semi-analytical solution Subject RIV: BI - Acoustics Impact factor: 1.575, year: 2016 http://ac.els-cdn.com/S0165212516300427/1-s2.0-S0165212516300427-main.pdf?_tid=d91eee02-7a55-11e6-8c02-00000aab0f6c&acdnat=1473842161_c56543aaec31b7e091ab47d3fb38f361
Cylindrical multiwire two-coordinate chamber with foam-polyurethane supporting element
International Nuclear Information System (INIS)
Vakhtin, V.G.; Travkin, V.I.
1988-01-01
Construction and technology of producing the two-coordinate cylindrical chamber with foam-polyurethane supporting element are described. Use of foam-polyurethane permits to reduce the substance quantity at particle path up to 0.2 g/cm 2 . The supporting element represents a foam-polyurethane tube the outside diameter being 126 mm, the thickness - 6.5 mm and the length 600 mm. Special attention was paid to study of elastic properties of foam-polyurethane tubes and to the effect of the chamber working fluid vapors on the tube sizes. It is stated that after a sustained load (3750 N for 6 days) the tube shrinks by 1.25 %. The foam-polyurethane supporting element arranged in 50% argon + 33% methane + 17% methylane mixture didn't change its sizes in the limit of 0.05% for three weeks. The chamber operates under self-qquenching streamer conditions
Analysis of Precursor Properties of mixed Al/Alumel Cylindrical Wire Arrays*
Stafford, A.; Safronova, A. S.; Kantsyrev, V. L.; Esaulov, A. A.; Weller, M. E.; Shrestha, I.; Osborne, G. C.; Shlyaptseva, V. V.; Keim, S. F.; Coverdale, C. A.; Chuvatin, A. S.
2012-10-01
Previous studies of mid-Z (Cu and Ni) cylindrical wire arrays (CWAs) on Zebra have found precursors with high electron temperatures of >300 eV. However, past experiments with Al CWAs did not find the same high temperature precursors. New precursor experiments using mixed Al/Alumel (Ni 95%, Si 2%, and Al 2%) cylindrical wire arrays have been performed to understand how the properties of L-shell Ni precursor will change and whether Al precursor will be observed. Time gated spectra and pinholes are used to determine precursor plasma conditions for comparison with previous Alumel precursor experiments. A full diagnostic set which included more than ten different beam-lines was implemented. Future work in this direction is discussed. [4pt] *This work was supported by NNSA under DOE Cooperative Agreements DE-FC52-06NA27588, and in part by DE-FC52-06NA27586, and DE-FC52-06NA27616. Sandia is a multi-program laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy under Contract DE-AC04-94AL85000.
Thermoelastic buckling of plates in a cylindrical geometry against an elastic back support
International Nuclear Information System (INIS)
Simmons, L.D.; Wierman, R.W.
1980-01-01
A plate which is fixed at its edges to a strong edge support structure will develop large compressive stresses when heated from ambient temperature more rapidly than the support structure. Determining the response of the plate to this situation requires stability analysis to ascertain whether the plate might buckle, or whether the constrained thermal expansion will lead to compressive stresses exceeding the yield point because it did not buckle. A special case is considered here, both analytically and experimentally, in which the plate is curved slightly into a cylindrical shape and the convex face of the plate is against a supporting surface. This case is more complex because the buckling mode will be a harmonic rather than the fundamental mode which is usually encountered
International Nuclear Information System (INIS)
Surov, A V; Popov, S D; Serba, E O; Nakonechny, G V; Spodobin, V A; Ovchinnikov, R V; Kumkova, I I; Shabalin, S A
2012-01-01
Stationary electric arc alternating current plasma torches are used today for realization of plasma chemical technologies requiring relatively high energy input. Waste treatment is one these directions. The paper reports on experiment results directed towards the increase in the lifetime characteristics of electrode units of the powerful high-voltage electric-arc AC plasma torches. The solution to the problem of obtainment the uniform wear of a copper hollow cylindrical electrode achieved by the controlled movement of the arc attachment along the working surface was offered. Organization of gas supply in the near electrode area and application of alternating magnetic field ensured movement of arc attachment along the surface with average speed from 2 to 14 m/s. Arc current was about 47 A and 84 A, gas flow rate in near electrode area was about 5 and 4.5 g/s. Due to researches on the experimental prototype of a hollow cylindrical electrode, the erosion of its material reached only 3 μg/C, that enables production of the electrode assembly with life time above 1000 hours at currents in the arc up to 100–200 A.
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
Energy Technology Data Exchange (ETDEWEB)
Kikuma, T.; Tomita, M.; Ishiyama, A. [Waseda Univ., Tokyo (Japan)
1999-11-10
For the purpose of we examining the effect of characteristics and ac loss under real machine operating environment of the alternating current superconductivity winding for a realization of the superconductive AC machine vessel, cylindrical shortness first linear guiding motor which used NbTi/CuNi superconducting cable for the primary winding was produced experimentally. The coil number was increased from 6 in 14 this time, and the optimization of the primary current was done, and the improvement on characteristics was attempted. Here, starting torque characteristics, quenching detection protection control circuit are reported. (NEDO)
Sun, Yao; Yang, Tiejun; Chen, Yuehua
2018-06-01
In this paper, sound radiation modes of baffled cylinders have been derived by constructing the radiation resistance matrix analytically. By examining the characteristics of sound radiation modes, it is found that radiation coefficient of each radiation mode increases gradually with the increase of frequency while modal shapes of sound radiation modes of cylindrical shells show a weak dependence upon frequency. Based on understandings on sound radiation modes, vibro-acoustics behaviors of cylindrical shells have been analyzed. The vibration responses of cylindrical shells are described by modified Fourier series expansions and solved by Rayleigh-Ritz method involving Flügge shell theory. Then radiation efficiency of a resonance has been determined by examining whether the vibration pattern is in correspondence with a sound radiation mode possessing great radiation efficiency. Furthermore, effects of thickness and boundary conditions on sound radiation of cylindrical shells have been investigated. It is found that radiation efficiency of thicker shells is greater than thinner shells while shells with a clamped boundary constraint radiate sound more efficiently than simply supported shells under thin shell assumption.
Analysis on Forced Vibration of Thin-Wall Cylindrical Shell with Nonlinear Boundary Condition
Directory of Open Access Journals (Sweden)
Qiansheng Tang
2016-01-01
Full Text Available Forced vibration of thin-wall cylindrical shell under nonlinear boundary condition was discussed in this paper. The nonlinear boundary was modeled as supported clearance in one end of shell and the restraint was assumed as linearly elastic in the radial direction. Based on Sanders’ shell theory, Lagrange equation was utilized to derive the nonlinear governing equations of cylindrical shell. The displacements in three directions were represented by beam functions and trigonometric functions. In the study of nonlinear dynamic responses of thin-wall cylindrical shell with supported clearance under external loads, the Newmark method is used to obtain time history, frequency spectrum plot, phase portraits, Poincare section, bifurcation diagrams, and three-dimensional spectrum plot with different parameters. The effects of external loads, supported clearance, and support stiffness on nonlinear dynamics behaviors of cylindrical shell with nonlinear boundary condition were discussed.
Analysis on Coupled Vibration of a Radially Polarized Piezoelectric Cylindrical Transducer
Directory of Open Access Journals (Sweden)
Jie Xu
2017-12-01
Full Text Available Coupled vibration of a radially polarized piezoelectric cylindrical transducer is analyzed with the mechanical coupling coefficient method. The method has been utilized to analyze the metal cylindrical transducer and the axially polarized piezoelectric cylindrical transducer. In this method, the mechanical coupling coefficient is introduced and defined as the stress ratio in different directions. Coupled vibration of the cylindrical transducer is regarded as the interaction of the plane radial vibration of a ring and the longitudinal vibration of a tube. For the radially polarized piezoelectric cylindrical transducer, the radial and longitudinal electric admittances as functions of mechanical coupling coefficients and angular frequencies are derived, respectively. The resonance frequency equations are obtained. The dependence of resonance frequency and mechanical coupling coefficient on aspect ratio is studied. Vibrational distributions on the surfaces of the cylindrical transducer are presented with experimental measurement. On the support of experiments, this work is verified and provides a theoretical foundation for the analysis and design of the radially polarized piezoelectric cylindrical transducer.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Zhaohong, E-mail: lnuhjhx@163.com [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Ning [Experiment Center of Environmental Monitoring of Liaoning Province, Shenyang 110161 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)
2014-08-15
Graphical abstract: - Highlights: • Generation of {sup •} OH in MW integrated with loaded TiO{sub 2}/AC system was confirmed. • Confirmation of {sup •} OH was conducted using radical scavenger such as BHT, MT and VC. • More {sup •} OH was formed using anatase TiO{sub 2}/AC than rutile TiO{sub 2}/AC under MW irradiation. • Effect of mass ratio, irradiation time, catalyst dose and DPCI on {sup •} OH was studied. - Abstract: In order to study the degradation mechanism of technology of microwave (MW) combined with TiO{sub 2} supported on activated carbon (TiO{sub 2}/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ({sup •} OH). In addition, the influence of some parameters such as TiO{sub 2} mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of {sup •} OH were examined. The results showed that the {sup •} OH could be generated under MW combined with loaded TiO{sub 2}/AC. Also, anatase TiO{sub 2}/AC can generate more {sup •} OH radicals than rutile TiO{sub 2}/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO{sub 2}/AC coupled with MW technology.
Vibrational analysis of submerged cylindrical shells based on elastic foundations
International Nuclear Information System (INIS)
Shah, A.G.; Naeem, M.N.
2014-01-01
In this study a vibration analysis was performed of an isotropic cylindrical shell submerged in fluid, resting on Winkler and Pasternak elastic foundations for simply supported boundary condition. Love's thin shell theory was exploited for strain- and curvature- displacement relationship. Shell problem was solved by using wave propagation approach. Influence of fluid and Winkler as well as Pasternak elastic foundations were studied on the natural frequencies of submerged isotropic cylindrical shells. Results were validated by comparing with the existing results in literature. Vibration, Submerged cylindrical shell, Love's thin shell theory, Wave propagation method, Winkler and Pasternak foundations. (author)
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
Development of magneto-rheologial fluid (MRF) based clutch for output torque control of AC motors
Nguyen, Q. Hung; Do, H. M. Hieu; Nguyen, V. Quoc; Nguyen, N. Diep; Le, D. Thang
2018-03-01
In industry, the AC motor is widely used because of low price, power availability, low cost maintenance. The main disadvantages of AC motors compared to DC motors are difficulty in speed and torque control, requiring expensive controllers with complex control algorithms. This is the basic limitations in the widespread adoption of AC motor systems for industrial automation. One feasible solution for AC motor control is using MRF (magneto-rheological fluid) based clutches (shortly called MR clutches) Although there have been many studies on MR clutches, most of these clutches used traditional configuration with coils wound on the middle cylindrical part and a compotator is used to supply power to the coils. Therefore, this type of MR clutches possesses many disadvantages such as high friction and unstable applied current due to commutator, complex structure which causes difficulty in manufacture, assembly, and maintenance. In addition, the bottleneck problem of magnetic field is also a challenging issue. In this research, we will develop a new type of MR clutches that overcomes the abovementioned disadvantages of traditional MR clutches and more suitable for application in controlling of AC motor. Besides, in this study, speed and torque control system for AC motors using developed MR clutches is designed and experimental validated.
Leung, Ka-Ngo [Hercules, CA
2008-04-22
A cylindrical neutron generator is formed with a coaxial RF-driven plasma ion source and target. A deuterium (or deuterium and tritium) plasma is produced by RF excitation in a cylindrical plasma ion generator using an RF antenna. A cylindrical neutron generating target is coaxial with the ion generator, separated by plasma and extraction electrodes which contain many slots. The plasma generator emanates ions radially over 360.degree. and the cylindrical target is thus irradiated by ions over its entire circumference. The plasma generator and target may be as long as desired. The plasma generator may be in the center and the neutron target on the outside, or the plasma generator may be on the outside and the target on the inside. In a nested configuration, several concentric targets and plasma generating regions are nested to increase the neutron flux.
Dynamic response of cylindrical ACS support structures to core energy release
International Nuclear Information System (INIS)
Kennedy, J.M.; Belytschko, T.B.
1985-01-01
The code SAFE/RAS is applied to the analysis of a new design concept for the above-core structures when subjected to the loads of a core disruptive accident. The analysis involves the determination of the postbuckling response of a thin cylinder loaded both axially and vertically. The effects of variation of cylinder thickness and fluid-structure interaction are investigated
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Grid support of a wind farm with active stall wind turbines and AC grid connection
DEFF Research Database (Denmark)
Hansen, Anca Daniela; Sørensen, Poul Ejnar; Iov, F.
2006-01-01
grid connection. The designed control system has the task of enabling such a wind farm to provide the best grid support. It is based on two control levels: a supervisory control level, which controls the power production of the whole farm by sending out reference signals to each individual wind turbine......One of the main concerns in the grid integration of large wind farms is their ability to behave as active controllable components in the power system. This article presents the design of a new integrated power control system for a wind farm made up exclusively of active stall wind turbines with AC......, and a local control level, which ensures that the reference power signals at the wind turbine level are reached. The ability of active stall wind farms with AC grid connection to control the power production to the reference power ordered by the operators is assessed and discussed by means of simulations....
Crawshaw, Jacob; Auyeung, Vivian; Ashworth, Lucy; Norton, Sam; Weinman, John
2017-01-01
We conducted a systematic review and meta-analysis to determine the effectiveness of healthcare provider-led (HCPs) interventions to support medication adherence in patients with acute coronary syndrome (ACS). A systematic search of Cochrane Library, Medline, EMBASE, PsycINFO, Web of Science, IPA, CINAHL, ASSIA, OpenGrey, EthOS, WorldCat and PQDT was undertaken. Interventions were deemed eligible if they included adult ACS patients, were HCP-led, measured medication adherence and randomised participants to parallel groups. Intervention content was coded using the Behaviour Change Technique (BCT) Taxonomy and data were pooled for analysis using random-effects models. Our search identified 8870 records, of which 27 were eligible (23 primary studies). A meta-analysis (n=9735) revealed HCP-led interventions increased the odds of medication adherence by 54% compared to control interventions (k=23, OR 1.54, 95% CI 1.26 to 1.88, I 2 =57.5%). After removing outliers, there was a 41% increase in the odds of medication adherence with moderate heterogeneity (k=21, OR 1.41, 95% CI 1.21 to 1.65, I 2 =35.3%). Interventions that included phone contact yielded (k=12, OR 1.63, 95% CI 1.25 to 2.12, I 2 =32.0%) a larger effect compared to those delivered exclusively in person. A total of 32/93 BCTs were identified across interventions (mean=4.7, SD=2.2) with 'information about health consequences' (BCT 5.1) (19/23) the most common. HCP-led interventions for ACS patients appear to have a small positive impact on medication adherence. While we were able to identify BCTs among interventions, data were insufficient to determine the impact of particular BCTs on study effectiveness. CRD42016037706.
AC magnetic transport on heterogeneous ferromagnetic wires and tubes
International Nuclear Information System (INIS)
Sinnecker, J.P.; Pirota, K.R.; Knobel, M.; Kraus, L.
2002-01-01
The AC current density radial distribution is calculated on heterogeneous composite materials with cylindrical geometry. The composites have an inner core and thin outer shell that can be either from the same material (homogenous material like simple wires) or from different materials with different physical properties. The case in which a non-magnetic inner core is surrounded by a magnetic layer, like electrodeposited wires, is mainly studied. The effect of frequency and applied magnetic field is simulated. The current density distribution as a function of frequency and applied field, as well as the total current over the inner core and outer shells are calculated. The results agree substantially well with the experimentally observed data for simple electrodeposited wires
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
Telescoping cylindrical piezoelectric fiber composite actuator assemblies
Allison, Sidney G. (Inventor); Shams, Qamar A. (Inventor); Fox, Robert L. (Inventor); Fox, legal representative, Christopher L. (Inventor); Fox Chattin, legal representative, Melanie L. (Inventor)
2010-01-01
A telescoping actuator assembly includes a plurality of cylindrical actuators in a concentric arrangement. Each cylindrical actuator is at least one piezoelectric fiber composite actuator having a plurality of piezoelectric fibers extending parallel to one another and to the concentric arrangement's longitudinal axis. Each cylindrical actuator is coupled to concentrically-adjacent ones of the cylindrical actuators such that the plurality of cylindrical actuators can experience telescopic movement. An electrical energy source coupled to the cylindrical actuators applies actuation energy thereto to generate the telescopic movement.
Karam, Gebran Nizar
1994-01-01
Thin walled cylindrical shell structures are widespread in nature: examples include plant stems, porcupine quills, and hedgehog spines. All have an outer shell of almost fully dense material supported by a low density, cellular core. In nature, all are loaded in combination of axial compression and bending: failure is typically by buckling. Natural structures are often optimized. Here we have analyzed the elastic buckling of a thin cylindrical shell supported by an elastic core to show that this structural configuration achieves significant weight saving over a hollow cylinder. The results of the analysis are compared with data from an extensive experimental program on uniaxial compression and four point bending tests on silicone rubber shells with and without compliant foam cores. The analysis describes the results of the mechanical tests well. Characterization of the microstructures of several natural tubular structures with foamlike cores (plant stems, quills, and spines) revealed them to be close to the optimal configurations predicted by the analytical model. Biomimicking of natural cylindrical shell structures and evolutionary design processes may offer the potential to increase the mechanical efficiency of engineering cylindrical shells.
Dynamic Behaviour and Seismic Response of Ground Supported Cylindrical Water Tanks
Asha, Joseph; Glory, Joseph
2018-05-01
Liquid storage tank such as in water distribution systems, petroleum plants etc., constitute a vital component of life line systems. Reducing earthquake effects on liquid storage tanks, to minimize the environmental and economic impact of these effects, have always been an important engineering concern. In this paper, the dynamic behavior of cylindrical ground supported concrete water tanks with different aspect ratios is investigated using finite element software ANSYS. The natural frequencies and modal responses are obtained for impulsive and convective modes of vibration. The natural frequency of vibration of the tank is observed to be the lowest at maximum water depth. The fundamental impulsive frequency increases as water level reduces and for water level less than 1/3 of tank height, there is significantly no change in impulsive frequency. The effect of wall flexibility on dynamic behavior of the tank is investigated by performing the modal analysis of flexible and rigid tanks. For a partially filled tank, the results of the present study are of significant relevance. The response of the tank to the transient loading as horizontal ground motion of El Centro earthquake is studied for various water heights. As the height of water on the tank increases, the ultimate maximum seismic response parameters are also observed to be increased. The location of maximum hoop stress varies in accordance with the variations in input ground motion and water fill condition whereas shear and bending moment are maximum at the base.
International Nuclear Information System (INIS)
Zav'yalov, D. V.; Kryuchkov, S. V.
2008-01-01
The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.
Research on cylindrical indexing cam’s unilateral machining
Directory of Open Access Journals (Sweden)
Junhua Chen
2015-08-01
Full Text Available The cylindrical cam ridge of the indexer is a spatial curved surface, which is difficult to design and machine. The cylindrical cam has some defects after machining because conventional machining methods have inaccuracies. This article aims at proposing a precise way to machine an indexing cam, using basic motion analysis and analytic geometry approach. Analytical methodology is first applied in the cam’s motion analysis, to obtain an error-free cam follower’s trajectory formula, and then separate the continuous trajectory curve by thousandth resolution, to create a three-dimensional discrete trajectory curve. Planar formulae and spherical formulae can be built on the loci. Based on the machine principle, the cutting cutter’s position and orientation will be taken into account. This article calculates the formula set as presented previously and obtains the ultimate cutter path coordinate value. The new error-free cutter path trajectory is called the unilateral machining trajectory. The earned results will compile into numerical control processing schedule. This processing methodology gives a convenient and precision way to manufacture a cylindrical indexing cam. Experimental results are also well supported.
Travel Support for Scientists to Participate in ACS Symposium
2017-08-31
ESPCI- Paris , France) at the 252nd ACS National Meeting in Philadelphia, Aug 21-25, 2016. In this two-day event, we have 30 oral presentations (17...Scott Grayson (Tulane University), Prof. Jemeriah Johnson (MIT), Prof. Julien Nicolas (Université Paris -Sud). Training Opportunities: Among the 30...polymer catalysts, to self-healing materials and pollution salvation materials. On this aspect, both academia and industrial laboratories have reached
Cylindrical fabric-confined soil structures
Harrison, Richard A.
A cylindrical fabric-soil structural concept for implementation on the moon and Mars which provides many advantages is proposed. The most efficient use of fabric is to fashion it into cylindrical tubes, creating cylindrical fabric-confined soil structures. The length, diameter, and curvature of the tubes will depend on the intended application. The cylindrical hoop forces provide radial confinement while end caps provide axial confinement. One of the ends is designed to allow passage of the soil into the fabric tube before sealing. Transportation requirements are reduced due to the low mass and volume of the fabric. Construction requirements are reduced due to the self-erection capability via the pneumatic exoskeleton. Maintenance requirements are reduced due to the passive nature of the concept. The structure's natural ductility is well suited for any seismic activity.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
The Pulsed Cylindrical Magnetron for Deposition
Korenev, Sergey
2012-10-01
The magnetron sputtering deposition of films and coatings broadly uses in microelectronics, material science, environmental applications and etc. The rate of target evaporation and time for deposition of films and coatings depends on magnetic field. These parameters link with efficiency of gas molecules ionization by electrons. The cylindrical magnetrons use for deposition of films and coatings on inside of pipes for different protective films and coatings in oil, chemical, environmental applications. The classical forming of magnetic field by permanent magnets or coils for big and long cylindrical magnetrons is complicated. The new concept of pulsed cylindrical magnetron for high rate deposition of films and coating for big and long pipes is presented in this paper. The proposed cylindrical magnetron has azimuthally pulsed high magnetic field, which allows forming the high ionized plasma and receiving high rate of evaporation material of target (central electrode). The structure of proposed pulsed cylindrical magnetron sputtering system is given. The main requirements to deposition system are presented. The preliminary data for forming of plasma and deposition of Ta films and coatings on the metal pipers are discussed. The comparison of classical and proposed cylindrical magnetrons is given. The analysis of potential applications is considered.
Skouteris, Dimitris; Gervasi, Osvaldo; Laganà, Antonio
2009-03-01
A program that uses the time-dependent wavepacket method to study the motion of structureless particles in a force field of quasi-cylindrical symmetry is presented here. The program utilises cylindrical polar coordinates to express the wavepacket, which is subsequently propagated using a Chebyshev expansion of the Schrödinger propagator. Time-dependent exit flux as well as energy-dependent S matrix elements can be obtained for all states of the particle (describing its angular momentum component along the nanotube axis and the excitation of the radial degree of freedom in the cylinder). The program has been used to study the motion of an H atom across a carbon nanotube. Program summaryProgram title: CYLWAVE Catalogue identifier: AECL_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AECL_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.: 3673 No. of bytes in distributed program, including test data, etc.: 35 237 Distribution format: tar.gz Programming language: Fortran 77 Computer: RISC workstations Operating system: UNIX RAM: 120 MBytes Classification: 16.7, 16.10 External routines: SUNSOFT performance library (not essential) TFFT2D.F (Temperton Fast Fourier Transform), BESSJ.F (from Numerical Recipes, for the calculation of Bessel functions) (included in the distribution file). Nature of problem: Time evolution of the state of a structureless particle in a quasicylindrical potential. Solution method: Time dependent wavepacket propagation. Running time: 50000 secs. The test run supplied with the distribution takes about 10 minutes to complete.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
A three-dimensional elasticity solution of functionally graded piezoelectric cylindrical panels
International Nuclear Information System (INIS)
Sedighi, M R; Shakeri, M
2009-01-01
This research presents an exact solution of finitely long, simply supported, orthotropic, functionally graded piezoelectric (FGP), cylindrical shell panels under pressure and electrostatic excitation. The FGP cylindrical panel is first divided into linearly inhomogeneous elements (LIEs). The general solution of governing partial differential equations of the LIEs is obtained by separation of variables. The highly coupled partial differential equations are reduced to ordinary differential equations with variable coefficients by means of appropriate trigonometric expansion of displacements and electric potential in circumferential and axial directions. The resulting governing ordinary differential equations are solved by the Galerkin finite element method. In this procedure the quadratic shape function is used in each element. The present method is applied to several benchmark problems. The coupled electromechanical effect on the structural behavior of functionally graded piezoelectric cylindrical shell panels is evaluated. The influence of the material property gradient index on the variables of electric and mechanical fields is studied. Finally some results are compared with published results
History of the small cylindrical melter
International Nuclear Information System (INIS)
Allen, T.L.; Iverson, D.C.; Plodinec, M.J.
1985-08-01
The small cylindrical melter (SCM) was designed to provide engineering data useful for operation and design of full-scale glass melters for vitrification of high-level radioactive waste. This melter was part of the research and development program for the Defense Waste Processing Facility (DWPF) at the Savannah River Plant (SRP). Extensive corrosion testing of melter materials of construction (Monofrax K3, Inconel 690), simulated radioactive waste glass characterization, and melter component development were conducted in support of the DWPF full-scale melter design. 66 figs., 14 tabs
Cylindrical-shaped nanotube field effect transistor
Hussain, Muhammad Mustafa; Fahad, Hossain M.; Smith, Casey E.; Rojas, Jhonathan Prieto
2015-01-01
A cylindrical-shaped nanotube FET may be manufactured on silicon (Si) substrates as a ring etched into a gate stack and filled with semiconductor material. An inner gate electrode couples to a region of the gate stack inside the inner circumference of the ring. An outer gate electrode couples to a region of the gate stack outside the outer circumference of the ring. The multi-gate cylindrical-shaped nanotube FET operates in volume inversion for ring widths below 15 nanometers. The cylindrical-shaped nanotube FET demonstrates better short channel effect (SCE) mitigation and higher performance (I.sub.on/I.sub.off) than conventional transistor devices. The cylindrical-shaped nanotube FET may also be manufactured with higher yields and cheaper costs than conventional transistors.
Cylindrical-shaped nanotube field effect transistor
Hussain, Muhammad Mustafa
2015-12-29
A cylindrical-shaped nanotube FET may be manufactured on silicon (Si) substrates as a ring etched into a gate stack and filled with semiconductor material. An inner gate electrode couples to a region of the gate stack inside the inner circumference of the ring. An outer gate electrode couples to a region of the gate stack outside the outer circumference of the ring. The multi-gate cylindrical-shaped nanotube FET operates in volume inversion for ring widths below 15 nanometers. The cylindrical-shaped nanotube FET demonstrates better short channel effect (SCE) mitigation and higher performance (I.sub.on/I.sub.off) than conventional transistor devices. The cylindrical-shaped nanotube FET may also be manufactured with higher yields and cheaper costs than conventional transistors.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Analysis of a cylindrical shell vibrating in a cylindrical fluid region
International Nuclear Information System (INIS)
Chung, H.; Turula, P.; Mulcahy, T.M.; Jendrzejczyk, J.A.
1976-08-01
Analytical and experimental methods are presented for evaluating the vibration characteristics of cylindrical shells such as the thermal liner of the Fast Flux Test Facility (FFTF) reactor vessel. The NASTRAN computer program is used to calculate the natural frequencies, mode shapes, and response to a harmonic loading of a thin, circular cylindrical shell situated inside a fluid-filled rigid circular cylinder. Solutions in a vacuum are verified with an exact solution method and the SAP IV computer code. Comparisons between analysis and experiment are made, and the accuracy and utility of the fluid-solid interaction package of NASTRAN is assessed
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Cylindrical acoustic levitator/concentrator
Kaduchak, Gregory; Sinha, Dipen N.
2002-01-01
A low-power, inexpensive acoustic apparatus for levitation and/or concentration of aerosols and small liquid/solid samples having particulates up to several millimeters in diameter in air or other fluids is described. It is constructed from a commercially available, hollow cylindrical piezoelectric crystal which has been modified to tune the resonance frequency of the breathing mode resonance of the crystal to that of the interior cavity of the cylinder. When the resonance frequency of the interior cylindrical cavity is matched to the breathing mode resonance of the cylindrical piezoelectric transducer, the acoustic efficiency for establishing a standing wave pattern in the cavity is high. The cylinder does not require accurate alignment of a resonant cavity. Water droplets having diameters greater than 1 mm have been levitated against the force of gravity using; less than 1 W of input electrical power. Concentration of aerosol particles in air is also demonstrated.
The electrostatic cylindrical sheath in a plasma
International Nuclear Information System (INIS)
Wang Chunhua; Sun Xiaoxia; Bai Dongxue
2004-01-01
The electrostatic sheath with a cylindrical geometry in an ion-electron plasma is investigated. Assuming a Boltzmann response to electrons and cold ions with bulk flow, it is shown that the radius of the cylindrical geometry do not affect the sheath potential significantly. The authors also found that the sheath potential profile is steeper in the cylindrical sheath compared to the slab sheath. The distinct feature of the cylindrical sheath is that the ion density distribution is not monotonous. The sheath region can be divided into three regions, two ascendant regions and one descendant region. (author)
Homotheties of cylindrically symmetric static spacetimes
International Nuclear Information System (INIS)
Qadir, A.; Ziad, M.; Sharif, M.
1998-08-01
In this note we consider the homotheties of cylindrically symmetric static spacetimes. We find that we can provide a complete list of all metrics that admit non-trivial homothetic motions and are cylindrically symmetric static. (author)
Forced Vibration Analysis for a FGPM Cylindrical Shell
Directory of Open Access Journals (Sweden)
Hong-Liang Dai
2013-01-01
Full Text Available This article presents an analytical study for forced vibration of a cylindrical shell which is composed of a functionally graded piezoelectric material (FGPM. The cylindrical shell is assumed to have two-constituent material distributions through the thickness of the structure, and material properties of the cylindrical shell are assumed to vary according to a power-law distribution in terms of the volume fractions for constituent materials, the exact solution for the forced vibration problem is presented. Numerical results are presented to show the effect of electric excitation, thermal load, mechanical load and volume exponent on the static and force vibration of the FGPM cylindrical shell. The goal of this investigation is to optimize the FGPM cylindrical shell in engineering, also the present solution can be used in the forced vibration analysis of cylindrical smart elements.
Scanning and/or treating surface device for weak bending radius cylindrical airlock
International Nuclear Information System (INIS)
Gemma, A.
1988-01-01
The device for scanning or treating the surface of a weak bending cylindrical airlock has a support mounted on the airlock outside flange, a central mast perpendicular to the support mounted to rotate about its axis, a geared motor turning the mast, an exploration or treatment tool fixed to the mast and a controller for the motor and the tool [fr
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Structured cylindrical targets
International Nuclear Information System (INIS)
Arnold, R.
1986-01-01
A variety of experimental concepts using high-energy heavy-ion beams in cylindrical targets have been studied through numerical simulation. With an accelerator planned for GSl, plasma temperatures of 100 eV can be reached by cylindrical compression, using inhomogeneous hollow-shell targets. Magnetic insulation, using external fields, has been explored as an aid in reaching high core temperatures. Experiments on collision-pumped x-ray laser physics are also discussed. (ii) Two-dimensional PlC code simulations of homogeneous solid targets show hydrodynamic effects not found in previous 1-D calculations. (iii) Preliminary ideas for an experiment on non-equilibrium heavy-ion charge-states using an existing accelerator and a pre-formed plasma target are outlined. (author)
Structured cylindrical targets
International Nuclear Information System (INIS)
Arnold, R.; Lackner-Russo, D.; Meyer-ter-Vehn, J.; Hoffmann, I.
1986-01-01
A variety of experimental concepts using high-energy heavy-ion beams in cylindrical targets have been studied through numerical simulation. With an accelerator planned for GSl, plasma temperatures of 100 eV can be reached by cylindrical compression, using inhomogenous hollow-shell targets. Magnetic insulation, using external fields, has been explored as an aid in reaching high core temperatures. Experiments on collision-pumped x-ray laser physics are also discussed. (ii) Two-dimensional PlC code simulations of homogeneous solid targets show hydrodynamic effects not found in previous l-D calculations. (iii) Preliminary ideas for an experiment on non-equilibrium heavy-ion charge-states using an existing accelerator and a pre-formed plasma target are outlined. (author)
Magnetostatic interactions and forces between cylindrical permanent magnets
International Nuclear Information System (INIS)
Vokoun, David; Beleggia, Marco; Heller, Ludek; Sittner, Petr
2009-01-01
Permanent magnets of various shapes are often utilized in magnetic actuators, sensors or releasable magnetic fasteners. Knowledge of the magnetic force is required to control devices reliably. Here, we introduce an analytical expression for calculating the attraction force between two cylindrical permanent magnets on the assumption of uniform magnetization. Although the assumption is not fulfilled exactly in cylindrical magnets, we obtain a very good agreement between the calculated and measured forces between two identical cylindrical magnets and within an array of NdFeB cylindrical magnets.
SNS AC Power Distribution and Reliability of AC Power Supply
Holik, Paul S
2005-01-01
The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
ACS and prevented ACS-induced DNA damage and chlorination of 2-aminopurine. This study identified a novel and unique mechanism of SDG radioprotection, through ACS scavenging, and supports the potential usefulness of SDG as a radioprotector and mitigator for radiation exposure as part of cancer therapy or accidental exposure. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1977-01-01
A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface
Theory and modeling of cylindrical thermo-acoustic transduction
Energy Technology Data Exchange (ETDEWEB)
Tong, Lihong, E-mail: lhtong@ecjtu.edu.cn [School of Civil Engineering and Architecture, East China Jiaotong University, Nanchang, Jiangxi (China); Lim, C.W. [Department of Architecture and Civil Engineering, City University of Hong Kong, Kowloon, Hong Kong SAR (China); Zhao, Xiushao; Geng, Daxing [School of Civil Engineering and Architecture, East China Jiaotong University, Nanchang, Jiangxi (China)
2016-06-03
Models both for solid and thinfilm-solid cylindrical thermo-acoustic transductions are proposed and the corresponding acoustic pressure solutions are obtained. The acoustic pressure for an individual carbon nanotube (CNT) as a function of input power is investigated analytically and it is verified by comparing with the published experimental data. Further numerical analysis on the acoustic pressure response and characteristics for varying input frequency and distance are also examined both for solid and thinfilm-solid cylindrical thermo-acoustic transductions. Through detailed theoretical and numerical studies on the acoustic pressure solution for thinfilm-solid cylindrical transduction, it is concluded that a solid with smaller thermal conductivity favors to improve the acoustic performance. In general, the proposed models are applicable to a variety of cylindrical thermo-acoustic devices performing in different gaseous media. - Highlights: • Theory and modeling both for solid and thinfilm-solid cylindrical thermo-acoustic transductions are proposed. • The modeling is verified by comparing with the published experimental data. • Acoustic response characteristics of cylindrical thermo-acoustic transductions are predicted by the proposed model.
International Nuclear Information System (INIS)
Saion, E.B.; Watt, D.E.
1994-01-01
An additional feature incorporated in a coaxial double-cylindrical tissue-equivalent proportional counter, is the presence of a common tissue-equivalent dividing wall between the inner and outer counters of thickness equivalent to the corresponding maximum range of protons at the energy of interest. By appropriate use of an anti-coincidence arrangement with the outer counter, the inner counter could be used to discriminate microdosimetric spectra of neutrons at the desired low energy range from those of the faster neutrons. The construction of an A-150 self-supporting tissue-equivalent dividing wall and an anti-coincidence unit are described. Some operational characteristic tests have been performed to determine the operation of the new microdosimeter. (author)
Optimization of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fisch, Nathaniel J.
2007-01-01
The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation.
Optimization of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fi, Nathaniel J.
2007-01-01
The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation
On isotropic cylindrically symmetric stellar models
International Nuclear Information System (INIS)
Nolan, Brien C; Nolan, Louise V
2004-01-01
We attempt to match the most general cylindrically symmetric vacuum spacetime with a Robertson-Walker interior. The matching conditions show that the interior must be dust filled and that the boundary must be comoving. Further, we show that the vacuum region must be polarized. Imposing the condition that there are no trapped cylinders on an initial time slice, we can apply a result of Thorne's and show that trapped cylinders never evolve. This results in a simplified line element which we prove to be incompatible with the dust interior. This result demonstrates the impossibility of the existence of an isotropic cylindrically symmetric star (or even a star which has a cylindrically symmetric portion). We investigate the problem from a different perspective by looking at the expansion scalars of invariant null geodesic congruences and, applying to the cylindrical case, the result that the product of the signs of the expansion scalars must be continuous across the boundary. The result may also be understood in relation to recent results about the impossibility of the static axially symmetric analogue of the Einstein-Straus model
Directory of Open Access Journals (Sweden)
Chi-Chieh Huang
2014-06-01
Full Text Available We present a wide-angle, broad-spectrum cylindrical lens based on reflections from an array of three-dimensional, high-aspect-ratio micro-mirrors fabricated on a cylindrical elastomeric substrate, functionally inspired by natural reflecting superposition compound eyes. Our device can perform one-dimensional focusing and beam-shaping comparable to conventional refraction-based cylindrical lenses, while avoiding chromatic aberration. The focal length of our cylindrical lens is 1.035 mm, suitable for micro-optical systems. Moreover, it demonstrates a wide field of view of 152° without distortion, as well as modest spherical aberrations. Our work could be applied to diverse applications including laser diode collimation, barcode scanning, holography, digital projection display, microlens arrays, and optical microscopy.
Spiral modes in cold cylindrical systems
International Nuclear Information System (INIS)
Robe, H.
1975-01-01
The linearized hydrodynamical equations governing the non-axisymmetric free modes of oscillation of cold cylindrical stellar systems are separated in cylindrical coordinates and solved numerically for two models. Short-wavelength unstable modes corresponding to tight spirals do not exist; but there exists an unstable growing mode which has the form of trailing spirals which are quite open. (orig.) [de
Parametric Investigation of Miniaturized Cylindrical and Annular Hall Thrusters
International Nuclear Information System (INIS)
Smirnov, A.; Raitses, Y.; Fisch, N.J.
2002-01-01
Conventional annular Hall thrusters become inefficient when scaled to low power. An alternative approach, a 2.6-cm miniaturized cylindrical Hall thruster with a cusp-type magnetic field distribution, was developed and studied. Its performance was compared to that of a conventional annular thruster of the same dimensions. The cylindrical thruster exhibits discharge characteristics similar to those of the annular thruster, but it has a much higher propellant ionization efficiency. Significantly, a large fraction of multi-charged xenon ions might be present in the outgoing ion flux generated by the cylindrical thruster. The operation of the cylindrical thruster is quieter than that of the annular thruster. The characteristic peak in the discharge current fluctuation spectrum at 50-60 kHz appears to be due to ionization instabilities. In the power range 50-300 W, the cylindrical and annular thrusters have comparable efficiencies (15-32%) and thrusts (2.5-12 mN). For the annular configuration, a voltage less than 200 V was not sufficient to sustain the discharge at low propellant flow rates. The cylindrical thruster can operate at voltages lower than 200 V, which suggests that a cylindrical thruster can be designed to operate at even smaller power
Robotic Hand with Flexible Fingers for Grasping Cylindrical Objects
柴田, 瑞穂
2015-01-01
In this manuscript, a robotic hand for grasping a cylindrical object is proposed. This robotic hand has flexible fingers that can hold a cylindrical object during moving. We introduce a grasping strategy for a cylindrical object in terms of state transition graph. In this strategy the robotic hand picks up the cylindrical object utilizing a suction device before the hand grasp the object. We also design the flexible fingers; then, we investigate the validity of this robotic hand via several e...
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Cylindrical continuous martingales and stochastic integration in infinite dimensions
Veraar, M.C.; Yaroslavtsev, I.S.
2016-01-01
In this paper we define a new type of quadratic variation for cylindrical continuous local martingales on an infinite dimensional spaces. It is shown that a large class of cylindrical continuous local martingales has such a quadratic variation. For this new class of cylindrical continuous local
Fast calculation method for computer-generated cylindrical holograms.
Yamaguchi, Takeshi; Fujii, Tomohiko; Yoshikawa, Hiroshi
2008-07-01
Since a general flat hologram has a limited viewable area, we usually cannot see the other side of a reconstructed object. There are some holograms that can solve this problem. A cylindrical hologram is well known to be viewable in 360 deg. Most cylindrical holograms are optical holograms, but there are few reports of computer-generated cylindrical holograms. The lack of computer-generated cylindrical holograms is because the spatial resolution of output devices is not great enough; therefore, we have to make a large hologram or use a small object to fulfill the sampling theorem. In addition, in calculating the large fringe, the calculation amount increases in proportion to the hologram size. Therefore, we propose what we believe to be a new calculation method for fast calculation. Then, we print these fringes with our prototype fringe printer. As a result, we obtain a good reconstructed image from a computer-generated cylindrical hologram.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Xenon NMR of liquid crystals confined to cylindrical nanocavities: a simulation study
Czech Academy of Sciences Publication Activity Database
Karjalainen, J.; Vaara, J.; Straka, Michal; Lantto, P.
2015-01-01
Roč. 17, č. 11 (2015), s. 7158-7171 ISSN 1463-9076 R&D Projects: GA ČR(CZ) GA14-03564S Institutional support: RVO:61388963 Keywords : 129Xe NMR * liquid crystals * cylindrical cavities * phase transition s * Monte-Carlo simulations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.449, year: 2015
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Ion peak narrowing by applying additional AC voltage (ripple voltage) to FAIMS extractor electrode.
Pervukhin, Viktor V; Sheven, Dmitriy G
2010-01-01
The use of a non-uniform electric field in a high-field asymmetric waveform ion mobility spectrometry (FAIMS) analyzer increases sensitivity but decreases resolution. The application of an additional AC voltage to the extractor electrode ("ripple" voltage, U(ripple)) can overcome this effect, which decreases the FAIMS peak width. In this approach, the diffusion ion loss remains minimal in the non-uniform electric field in the cylindrical part of the device, and all ion losses under U(ripple) occur in a short portion of their path. Application of the ripple voltage to the extractor electrode is twice as efficient as the applying of U(ripple) along the total length of the device. 2010 American Society for Mass Spectrometry. Published by Elsevier Inc. All rights reserved.
Read/write performance of perpendicular double-layered cylindrical media
International Nuclear Information System (INIS)
Yamada, H.; Shimatsu, T.; Watanabe, I.; Tsuchiyama, R.; Aoi, H.; Muraoka, H.; Nakamura, Y.
2005-01-01
A cylindrical magnetic storage system using perpendicular double-layered media has been developed. CoCrTa/CoZrNb deposited on a rotating cylindrical substrate shows perpendicular anisotropy and magnetic properties, which have almost the same characteristics as conventional disk-media. The fundamental read/write characteristics of perpendicular double-layered cylindrical media were measured using a single-pole-type (SPT) writer with a sliding-contact-type slider and a merged giant magneto-resistive (GMR) reader with a one-pad-type slider designed for use with cylindrical media. Preliminary studies for improving the characteristics of the recording layer are also described
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
The decrease of cylindrical pempek quality during boiling
Karneta, R.; Gultom, N. F.
2017-09-01
The research objective was to study the effects of temperature and formulation on quality of pempek lenjer during boiling. Treatments in this study were four levels of pempek formulation and five levels of temperature. Data was processed by using analysis of variance (Anova). If test results showed that samples were significantly different or highly significantly different, then further test was conducted by using Honestly Significant Different. The results showed that chemical analysis showed that fish dominant formula of cylindrical pempek had higher water content, protein content, lipid content and ash content than that of tapioca starch dominant formula, but it had lower carbohydrate content and fibre content than that of tapioca starch dominant formula.The higher the temperature at center point of cylindrical pempek, the lower the chemical quality of cylindrical pempek. The effect of formula on physical quality of cylindrical pempek showed that tapioca starch dominant formula had more rubbery texture, more neutral pH and brighter color than that of fish dominant formula.The temperature change had no significant effect on texture and pH of cylindrical pempek, but it had significant effect on lightness, intensity and chromatic color especially after exceeding optimum time of boiling.
Cylindrical solitons in shallow water of variable depth
International Nuclear Information System (INIS)
Carbonaro, P.; Floris, R.; Pantano, P.
1983-01-01
The propagation and the interaction of cylindrical solitons in shallow water of variable depth are studied. Starting from the cylindrically symmetric version of the equations describing long waves in a beach, a Korteweg-de Vries equation is derived. Since no exact analytical solution has been found to date for this equation, some remarkable cases in which the equation takes up a tractable form are analyzed. Finally the intercation between cylindrical imploding and expanding waves is considered and the phase shifts caused by the head-on collision are given
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
The size-dependent vibration of embedded magneto-electro-elastic cylindrical nanoshells
International Nuclear Information System (INIS)
Ke, Liao-Liang; Wang, Yue-Sheng; Yang, Jie; Kitipornchai, Sritawat
2014-01-01
Based on the nonlocal Love’s shell theory, this paper develops an embedded magneto-electro-elastic (MEE) cylindrical nanoshell model. This model incorporates effects of the small scale parameter and thermo-electro-magnetic loadings. The surrounding elastic medium is described as the Winkler model characterized by the spring. By using this model and the Hamilton principle, the governing equations and boundary conditions are derived for free vibration of the embedded MEE cylindrical nanoshells. The Navier’s method is first utilized to obtain the analytical solution for the simply supported MEE nanoshell. Then, numerical solutions for MEE nanoshells under various boundary conditions are obtained by using the differential quadrature (DQ) method. A detailed parametric study is conducted to highlight the influences of the nonlocal parameter, temperature rise, external electric potential, external magnetic potential, spring constant, radius-to-thickness ratio and length-to-radius ratio on natural frequencies of MEE nanoshells. (paper)
Effects of Activated Carbon Surface Property on Structure and Activity of Ru/AC Catalysts
Xu, S. K.; Li, L. M.; Guo, N. N.
2018-05-01
The activated carbon (AC) was modified by supercritical (SC) methanol, HNO3 oxidation, or HNO3 oxidation plus SC methanol, respectively. Then, the original and the modified AC were used as supports for Ru/AC catalysts prepared via the impregnation method. The results showed that the SC methanol modification decreased the content of surface acidic groups of AC. While HNO3 oxidation displayed the opposite behavior. Furthermore, the dispersion of ruthenium and the activity of catalysts were highly dependent on the content of surface acidic groups, and the SC methanol modified sample exhibited the highest activity for hydrogenation of glucose.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Plastic buckling of cylindrical shells
International Nuclear Information System (INIS)
Bandyopadhyay, K.; Xu, J.; Shteyngart, S.; Eckert, H.
1994-01-01
Cylindrical shells exhibit buckling under axial loads at stresses much less than the respective theoretical critical stresses. This is due primarily to the presence of geometrical imperfections even though such imperfections could be very small (e.g., comparable to thickness). Under internal pressure, the shell regains some of its buckling strength. For a relatively large radius-to-thickness ratio and low internal pressure, the effect can be reasonably estimated by an elastic analysis. However, for low radius-to-thickness ratios and greater pressures, the elastic-plastic collapse controls the failure load. in order to quantify the elastic-plastic buckling capacity of cylindrical shells, an analysis program was carried out by use of the computer code BOSOR5 developed by Bushnell of Lockheed Missiles and Space Company. The analysis was performed for various radius-to-thickness ratios and imperfection amplitudes. The purpose of the analytical program was to compute the buckling strength of underground cylindrical tanks, that are used for storage of nuclear wastes, for realistic geometric imperfections and internal pressure loads. This paper presents the results of the elastic-plastic analyses and compares them with other available information for various pressure loads
Cylindrical Piezoelectric Fiber Composite Actuators
Allison, Sidney G.; Shams, Qamar A.; Fox, Robert L.
2008-01-01
The use of piezoelectric devices has become widespread since Pierre and Jacques Curie discovered the piezoelectric effect in 1880. Examples of current applications of piezoelectric devices include ultrasonic transducers, micro-positioning devices, buzzers, strain sensors, and clocks. The invention of such lightweight, relatively inexpensive piezoceramic-fiber-composite actuators as macro fiber composite (MFC) actuators has made it possible to obtain strains and displacements greater than those that could be generated by prior actuators based on monolithic piezoceramic sheet materials. MFC actuators are flat, flexible actuators designed for bonding to structures to apply or detect strains. Bonding multiple layers of MFC actuators together could increase force capability, but not strain or displacement capability. Cylindrical piezoelectric fiber composite (CPFC) actuators have been invented as alternatives to MFC actuators for applications in which greater forces and/or strains or displacements may be required. In essence, a CPFC actuator is an MFC or other piezoceramic fiber composite actuator fabricated in a cylindrical instead of its conventional flat shape. Cylindrical is used here in the general sense, encompassing shapes that can have circular, elliptical, rectangular or other cross-sectional shapes in the planes perpendicular to their longitudinal axes.
Ingestion of six cylindrical and four button batteries
DEFF Research Database (Denmark)
Nielsen, Simon U; Rasmussen, Morten; Hoegberg, Lotte C G
2010-01-01
We report a suicidal ingestion of six cylindrical and four button batteries, in combination with overdosed prescription medicine and smoking of cannabis.......We report a suicidal ingestion of six cylindrical and four button batteries, in combination with overdosed prescription medicine and smoking of cannabis....
Cylindric-like algebras and algebraic logic
Ferenczi, Miklós; Németi, István
2013-01-01
Algebraic logic is a subject in the interface between logic, algebra and geometry, it has strong connections with category theory and combinatorics. Tarski’s quest for finding structure in logic leads to cylindric-like algebras as studied in this book, they are among the main players in Tarskian algebraic logic. Cylindric algebra theory can be viewed in many ways: as an algebraic form of definability theory, as a study of higher-dimensional relations, as an enrichment of Boolean Algebra theory, or, as logic in geometric form (“cylindric” in the name refers to geometric aspects). Cylindric-like algebras have a wide range of applications, in, e.g., natural language theory, data-base theory, stochastics, and even in relativity theory. The present volume, consisting of 18 survey papers, intends to give an overview of the main achievements and new research directions in the past 30 years, since the publication of the Henkin-Monk-Tarski monographs. It is dedicated to the memory of Leon Henkin.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Coupled dilaton and electromagnetic field in cylindrically symmetric ...
Indian Academy of Sciences (India)
The dilaton black hole solutions have attracted considerable attention for the ... theory and study the corresponding cylindrically symmetric spacetime, where .... where Йm and Йe are integration constants to be interpreted later as the ..... feature is apparent for the cylindrically symmetric spacetime in the presence of the dila-.
Study of Cylindrical Honeycomb Solar Collector
Directory of Open Access Journals (Sweden)
Atish Mozumder
2014-01-01
Full Text Available We present the results of our investigation on cylindrical honeycomb solar collector. The honeycomb has been fabricated with transparent cellulose triacetate polymer sheets. Insulation characteristics of the honeycomb were studied by varying the separation between the honeycomb and the absorber plate. The optimal value of the separation was found to be 3.3 mm for which the heat transfer coefficient is 3.06 W m−2 K−1. This supports result of previous similar experiments. Further we test the honeycomb through a field experiment conducted in Delhi (28.6°N, 77°E and found that when the incident angle of the solar radiation is within 20° then the performance of the system with the honeycomb is better than the one without the honeycomb.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Energy Technology Data Exchange (ETDEWEB)
Mora-Cantallops, Marcal; Gomis-Bellmunt, Oriol; Sumper, Andreas; Rull-Duran, Joan [Univ. Politecnica de Catalunya, Barcelona (ES). Centre d' Innovacio Tecnologica en Convertidors Estatics i Accionaments (CITCEA-UPC)
2009-07-01
Wind power constitutes one of the more viable alternatives to conventional power generation technology. In the previous years, wind power penetration on electric grids has grown notably, and has brought several new issues related to its integration into power grids. Flexible AC Transmission Systems (FACTS) installed in the right place and controlled conveniently are able to mitigate and solve many of these issues. In the present work, a STATCOM and a SSSC are used coordinately to fully support an electric grid. Simulations include normal and fault operation. (orig.)
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Tearing instability in cylindrical plasma configuration
International Nuclear Information System (INIS)
Zelenyj, L.M.
1979-01-01
The effect of the neutral-layer cylindrical geometry on the development of the tearing instability has been investigated in detail. The increments of the instability for all the regimes have been found. The influence of cylindrical effects becomes manifesting itself at small, as compared to the layer characteristic thickness, distances from the axis, and, finally, the electron regime of the instability development transforms into an ion one. The results obtained are of interest for studying the plasma stability in the devices of the ''Astron'' type and in magnetospheres of cosmic objects
Magnetic guns with cylindrical permanent magnets
DEFF Research Database (Denmark)
Vokoun, David; Beleggia, Marco; Heller, Luděk
2012-01-01
The motion of a cylindrical permanent magnet (projectile) inside a tubular permanent magnet, with both magnets magnetized axially, illustrates nicely the physical principles behind the operation of magnetic guns. The force acting upon the projectile is expressed semi-analytically as derivative...... of the magnetostatic interaction energy. For comparison, the forces involved are also calculated numerically using finite elements methods. Based on the conservation of the magnetostatic and kinetic energies, the exit and asymptotic velocities are determined. The derived formulas can be used to optimize the generated...... forces and motion of the inner cylindrical magnet....
Cylindrical dust acoustic waves with transverse perturbation
International Nuclear Information System (INIS)
Xue Jukui
2003-01-01
The nonlinear dust acoustic waves in dusty plasmas with the combined effects of bounded cylindrical geometry and the transverse perturbation are studied. Using the perturbation method, a cylindrical Kadomtsev-Petviashvili (CKP) equation that describes the dust acoustic waves is deduced for the first time. A particular solution of this CKP equation is also obtained. It is shown that the dust acoustic solitary waves can exist in the CKP equation
AC Electric Field Communication for Human-Area Networking
Kado, Yuichi; Shinagawa, Mitsuru
We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.
AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)
El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.
2012-11-01
AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.
Radon progeny distribution in cylindrical diffusion chambers
International Nuclear Information System (INIS)
Pressyanov, Dobromir S.
2008-01-01
An algorithm to model the diffusion of radioactive decay chain atoms is presented. Exact mathematical solutions in cylindrical geometry are given. They are used to obtain expressions for the concentrations of 222 Rn progeny atoms in the volume and deposited on the wall surface in cylindrical diffusion chambers. The dependence of volume fractions of 222 Rn progeny and chamber sensitivity on the coefficient of diffusion of 222 Rn progeny atoms in air is modeled.
Cylindrical geometry for proportional and drift chambers
International Nuclear Information System (INIS)
Sadoulet, B.
1975-06-01
For experiments performed around storage rings such as e + e - rings or the ISR pp rings, cylindrical wire chambers are very attractive. They surround the beam pipe completely without any dead region in the azimuth, and fit well with the geometry of events where particles are more or less spherically produced. Unfortunately, cylindrical proportional or drift chambers are difficult to make. Problems are discussed and two approaches to fabricating the cathodes are discussed. (WHK)
Development of new cylindrical magnetrons for industrial use
International Nuclear Information System (INIS)
Clayton, B.
2000-09-01
A number of alternative techniques were considered and tested with a view to the construction of a cylindrical sputtering device. This device was required to be capable of depositing tribological coatings inside approximately cylindrical substrates of diameters less than 100mm, in an industrial situation. A cylindrical magnetron device was designed, and constructed as a prototype, using a magnetic assembly inside a cylindrical target with outside diameter (o.d.) 40mm. Two alternative magnetic assemblies were tested, and found to have complimentary advantages. The magnetron characteristics of the device were tested, as were key properties (such as adhesion level and hardness) of the coatings deposited. In all cases good results were obtained. A 22mm o.d. device based on the same design was shown to operate, but with less satisfactory characteristics. In an attempt to improve the miniaturised design, the feasibility of gas cooling (rather than water cooling) the cylindrical magnetron was demonstrated. A system incorporating four 40mm o.d. cylindrical magnetrons was designed, constructed and briefly tested. This was intended to prove the feasibility of using a multi-magnetron system to reduce the cost to coat. Its dimensions and design were tailored to an industrially specified engine block. In use the plasma rings formed on the 40mm magnetron target surfaces during operation were found to be of unequal intensities, especially on the shorter magnetron design used in the four-fold system. In an attempt to tackle this problem, a finite element model of the magnetic field generated by the magnetic assembly was built, run and verified. Changes were made to this model, and a new .magnet assembly was built and tested based on the results obtained. This did not lead to a final solution of the problem, but has set bounds within which the solution must lie. (author)
A Clustering Method for Data in Cylindrical Coordinates
Directory of Open Access Journals (Sweden)
Kazuhisa Fujita
2017-01-01
Full Text Available We propose a new clustering method for data in cylindrical coordinates based on the k-means. The goal of the k-means family is to maximize an optimization function, which requires a similarity. Thus, we need a new similarity to obtain the new clustering method for data in cylindrical coordinates. In this study, we first derive a new similarity for the new clustering method by assuming a particular probabilistic model. A data point in cylindrical coordinates has radius, azimuth, and height. We assume that the azimuth is sampled from a von Mises distribution and the radius and the height are independently generated from isotropic Gaussian distributions. We derive the new similarity from the log likelihood of the assumed probability distribution. Our experiments demonstrate that the proposed method using the new similarity can appropriately partition synthetic data defined in cylindrical coordinates. Furthermore, we apply the proposed method to color image quantization and show that the methods successfully quantize a color image with respect to the hue element.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Micromagnetic simulations of cylindrical magnetic nanowires
Ivanov, Yurii P.
2015-05-27
This chapter reviews micromagnetic simulations of cylindrical magnetic nanowires and their ordered arrays. It starts with a description of the theoretical background of micromagnetism. The chapter discusses main magnetization reversal modes, domain wall types, and state diagrams in cylindrical nanowires of different types and sizes. The results of the hysteresis process in individual nanowires and nanowire arrays also are presented. Modeling results are compared with experimental ones. The chapter also discusses future trends in nanowire applications in relation to simulations, such as current-driven dynamics, spintronics, and spincaloritronics. The main micromagnetic programs are presented and discussed, together with the corresponding links.
A cylindrical specimen holder for electron cryo-tomography
International Nuclear Information System (INIS)
Palmer, Colin M.; Löwe, Jan
2014-01-01
The use of slab-like flat specimens for electron cryo-tomography restricts the range of viewing angles that can be used. This leads to the “missing wedge” problem, which causes artefacts and anisotropic resolution in reconstructed tomograms. Cylindrical specimens provide a way to eliminate the problem, since they allow imaging from a full range of viewing angles around the tilt axis. Such specimens have been used before for tomography of radiation-insensitive samples at room temperature, but never for frozen-hydrated specimens. Here, we demonstrate the use of thin-walled carbon tubes as specimen holders, allowing the preparation of cylindrical frozen-hydrated samples of ribosomes, liposomes and whole bacterial cells. Images acquired from these cylinders have equal quality at all viewing angles, and the accessible tilt range is restricted only by the physical limits of the microscope. Tomographic reconstructions of these specimens demonstrate that the effects of the missing wedge are substantially reduced, and could be completely eliminated if a full tilt range was used. The overall quality of these tomograms is still lower than that obtained by existing methods, but improvements are likely in future. - Highlights: • The missing wedge is a serious problem for electron cryo-tomography. • Cylindrical specimens allow the missing wedge to be eliminated. • Carbon nanopipettes can be used as cylindrical holders for tomography of frozen-hydrated specimens. • Cryo-tomography of cylindrical biological samples demonstrates a reduction of deleterious effects associated with the missing wedge
Low-energy impact of adaptive cylindrical piezoelectric-composite shells
Energy Technology Data Exchange (ETDEWEB)
Saravanos, D.A. [University of Patras (United Kingdom). Dept. of Mechanical Engineering and Aeronautics; Christoforou, A.P. [Kuwait Univ. (Kuwait). Dept. of Mechanical Engineering
2002-04-01
A theoretical framework for analyzing low-energy impacts of laminated shells with active and sensory piezoelectric layers is presented, including impactor dynamics and contact law. The formulation encompasses a coupled piezoelectric shell theory mixing first order shear displacement assumptions and layerwise variation of electric potential. An exact in-plane Ritz solution for the impact of open cylindrical piezoelectric-composite shells is developed and solved numerically using an explicit time integration scheme. The active impact control problem of adaptive cylindrical shells with distributed curved piezoelectric actuators is addressed. The cases of optimized state feedback controllers and output feedback controllers using piezoelectric sensors are analyzed. Numerical results quantify the impact response of cylindrical shells of various curvatures including the signal of curved piezoelectric sensors. Additional numerical studies quantify the impact response of adaptive cylindrical panels and investigate the feasibility of actively reducing the impact force. (author)
Note: Electrochemical etching of cylindrical nanoprobes using a vibrating electrolyte
International Nuclear Information System (INIS)
Wang, Yufeng; Zeng, Yongbin; Qu, Ningsong; Zhu, Di
2015-01-01
An electrochemical etching process using a vibrating electrolyte of potassium hydroxide to prepare tungsten cylindrical nanotips is developed. The vibrating electrolyte eases the effects of a diffusion layer and extends the etching area, which aid in the production of cylindrical nanotips. Larger amplitudes and a vibration frequency of 35 Hz are recommended for producing cylindrical nanotips. Nanotips with a tip radius of approximately 43 nm and a conical angle of arctan 0.0216 are obtained
Far-field potentials in cylindrical and rectangular volume conductors.
Dumitru, D; King, J C; Rogers, W E
1993-07-01
The occurrence of a transient dipole is one method of producing a far-field potential. This investigation qualitatively defines the characteristics of the near-field and far-field electrical potentials produced by a transient dipole in both cylindrical and rectangular volume conductors. Most body segments of electrophysiologic interest such as arms, legs, thorax, and neck are roughly cylindrical in shape. A centrally located dipole generator produces a nonzero equipotential region which is found to occur along the cylindrical wall at a distance from the dipole of approximately 1.4 times the cylinder's radius and 1.9 times the cylinder's radius for the center of the cylinder. This distance to the equi-potential zone along the surface wall expands but remains less than 3.0 times the cylindrical radius when the dipole is eccentrically placed. The magnitude of the equipotential region resulting from an asymmetrically placed dipole remains identical to that when the dipole is centrally located. This behavior is found to be very similar in rectangular shallow conducting volumes that model a longitudinal slice of the cylinder, thus allowing a simple experimental model of the cylinder to be utilized. Amplitudes of the equipotential region are inversely proportional to the cylindrical or rectangular volume's cross-sectional area at the location of dipolar imbalance. This study predicts that referential electrode montages, when placed at 3.0 times the radius or greater from a dipolar axially aligned far-field generator in cylindrical homogeneous volume conductors, will record only equipotential far-field effects.
Energy Technology Data Exchange (ETDEWEB)
Kikuma, T.; Ishiyama, A. [Waseda Univ., Tokyo (Japan)
2000-05-29
For the purpose of examining the characteristics (effect of stability and ac loss by the higher harmonic wave etc.) of an alternating current superconductivity winding under a real machine operating environment of the super-conductive AC machine vessel, authors produced a cylindrical shortness first linear guiding motor (SCLIM) which used the NbTi/CuNi super-conducting cable for the first excitation winding experimentally. In this study, the evaluation of the start up thrust and operation confirmation of the quenching detection protection circuit were carried out using the produced SCLIM. In the quenching detection protection control circuit, the first excitation winding was divided into an internal layer and an outer layer, and both layers were excited in the 2 layer division and a quenching detection protection circuit was installed on the 2 layers respectively. The circuit of a part of fact by this of the phase in which the quench was generated and observed was cut off, and the operation would be able to be continued in part of the remainder of the phase and other two phases. Here, it is to cut off the quenched phase from the circuit, when the phase current becomes zero, and the other effect on the phase is held as small as possible. (NEDO)
Sensitivity optimization in whispering gallery mode optical cylindrical biosensors
Khozeymeh, F.; Razaghi, M.
2018-01-01
Whispering-gallery-mode resonances propagated in cylindrical resonators have two angular and radial orders of l and i. In this work, the higher radial order whispering-gallery-mode resonances, (i = 1 - 4), at a fixed l are examined. The sensitivity of theses resonances is analysed as a function of the structural parameters of the cylindrical resonator like different radii and refractive index of composed material of the resonator. A practical application where cylindrical resonators are used for the measurement of glucose concentration in water is presented as a biosensor demonstrator. We calculate the wavelength shifts of the WG1-4, in several glucose/water solutions, with concentrations spanning from 0.0% to 9.0.% (weight/weight). Improved sensitivity can be achieved using multi-WGM cylindrical resonators with radius of R = 100 μm and resonator composed material of MgF 2 with refractive index of nc = 1.38. Also the effect of polarization on sensitivity is considered for all four WGMs. The best sensitivity of 83.07 nm/RIU for the fourth WGM with transverse magnetic polarization, is reported. These results propose optimized parameters aimed to fast designing of cylindrical resonators as optical biosensors, where both the sensitivity and the geometries can be optimized.
Modeling the fusion of cylindrical bioink particles in post bioprinting structure formation
McCune, Matt; Shafiee, Ashkan; Forgacs, Gabor; Kosztin, Ioan
2015-03-01
Cellular Particle Dynamics (CPD) is an effective computational method to describe the shape evolution and biomechanical relaxation processes in multicellular systems. Thus, CPD is a useful tool to predict the outcome of post-printing structure formation in bioprinting. The predictive power of CPD has been demonstrated for multicellular systems composed of spherical bioink units. Experiments and computer simulations were related through an independently developed theoretical formalism based on continuum mechanics. Here we generalize the CPD formalism to (i) include cylindrical bioink particles often used in specific bioprinting applications, (ii) describe the more realistic experimental situation in which both the length and the volume of the cylindrical bioink units decrease during post-printing structure formation, and (iii) directly connect CPD simulations to the corresponding experiments without the need of the intermediate continuum theory inherently based on simplifying assumptions. Work supported by NSF [PHY-0957914]. Computer time provided by the University of Missouri Bioinformatics Consortium.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Cylindrical and spherical dust-acoustic wave modulations in dusty ...
Indian Academy of Sciences (India)
Abstract. The nonlinear wave modulation of planar and non-planar (cylindrical and spherical) dust-acoustic waves (DAW) propagating in dusty plasmas, in the presence of non-extensive distribu- tions for ions and electrons is investigated. By employing multiple scales technique, a cylindrically and spherically modified ...
Settling of a cylindrical particle in a stagnant fluid
DEFF Research Database (Denmark)
Sørensen, Henrik; Rosendahl, Lasse; Yin, Chungen
The objective of this work is to collect data and develop models for cylindrical particles which could be used in numerical multiphase flow modeling. Trajectories of cylindrical particles settling in stagnant water are filmed from two directions in order to derive detailed information on their mo...
Power deposition in a cylindrical geometry using B-10 coatings
International Nuclear Information System (INIS)
Chung, A.K.; Prelas, M.A.
1983-01-01
The transport of charged particles produced by 10 B (n, α) Li and 235 U (n, νn) ff nuclear reactions in a two region cylindrical geometry is predicted. We employed a mean-range straight-flight approximation to calculate the power deposition by the charged particles in a gaseous medium. Our model demonstrated some features in a cylindrical experiment which were suspected but not proven. In the common slab model used by Guyot et al 1 and Romero 2 , the spatial distribution of power deposition is much flatter than it would be in a cylindrical model. A steeper gradient in the power deposition is expected in a cylindrical geometry than in a slab geometry. We also found that for a standard thickness of Boron-10 coating (1.73 μm) used in NPLs, the expected efficiency of a cylindrical geometry (7.5%) is much lower than the 12% efficiency predicted by the slab model. Indeed the use of slab geometry in modeling current NPL experimental devices is not accurate
Tight multilattices calculated by extended-cell cylindrization
Energy Technology Data Exchange (ETDEWEB)
Segev, M; Carmona, S
1983-01-01
Among the common features of advanced LWR concepts are the tightness of lattices and the symbiotic setting of different fuels. Such symbioses often come in the form of multilattices, whose numerically-repeated unit is a configuration of several pins, typically with one pin type at the center and pins of a second type surrounding the center pin. If this extended-cell (EC) unit is cylindricized, then a simple transport calculation of the unit will be possible. If the lattice of such units is tight, there is further an a priori reason to expect the cylindrization to introduce only a small distortion of the true neutron fluxes in the lattice. A strict numerical validation of the EC cylindrization approximation is impractical, but similar validations can be carried out for regular lattices, viewed as being made up of multicell units whose centers are moderators and whose peripheries are fuel pins. In these comparisons the EC cylindrization approximation gives good results.
Directory of Open Access Journals (Sweden)
Yuanwei Zhu
2018-06-01
Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.
Scattering of spermatozoa off cylindrical pillars
Bukatin, Anton; Lushi, Enkeleida; Kantsler, Vasily
2017-11-01
The motion of micro-swimmers in structured environments, even though crucial in processes such as in vivo and in vitro egg fertilization, is still not completely understood. We combine microfluidic experiments with mathematical modeling of 3D swimming near convex surfaces to quantify the dynamics of individual sperm cells in the proximity of cylindrical pillars. Our results show that the hydrodynamic and contact forces that account for the shape asymmetry and flagellar motion, are crucial in correctly describing the dynamics observed in the experiments. Last, we discuss how the size of the cylindrical obstacles determines whether the swimmers scatter off or get trapped circling the pillar.
Non-Federal participation in AC Intertie: Final environmental impact statement
International Nuclear Information System (INIS)
1994-01-01
This document contains the appendices for the Non-Federal Participation in AC Intertie Final Environmental Impact Statement. It contains all the supporting materials, documents and data for the EIS in nine appendices: A. Life-of-facilities capacity ownership proposal; B. Long-term Intertie access policy; C. Glossary; D. Biological assessment and supporting materials; E. Environmental impacts of generic resource types; F. Technical information on analysis methods and results; G. Affected environment supporting documentation; H. Public involvement activities; and I. Bibliography
Two-dimensional collapse calculations of cylindrical clouds
International Nuclear Information System (INIS)
Bastien, P.; Mitalas, R.
1979-01-01
A two-dimensional hydrodynamic computer code has been extensively modified and expanded to study the collapse of non-rotating interstellar clouds. The physics and the numerical methods involved are discussed. The results are presented and discussed in terms of the Jeans number. The critical Jeans number for collapse of non-rotating cylindrical clouds whose length is the same as their diameter is 1.00. No evidence for fragmentation has been found for these clouds, but fragmentation seems quite likely for more elongated cylindrical clouds. (author)
A method for decreasing transport ac losses in multifilamentary and multistrip superconductors
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)
2000-07-01
A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)
Rotation, inversion and perversion in anisotropic elastic cylindrical tubes and membranes
Goriely, A.
2013-03-06
Cylindrical tubes and membranes are universal structural elements found in biology and engineering over a wide range of scales.Working in the framework of nonlinear elasticity, we consider the possible deformations of elastic cylindrical shells reinforced by one or two families of fibres. We consider both small and large deformations and the reduction from thick cylindrical shells (tubes) to thin shells (cylindrical membranes). In particular, a number of universal parameter regimes can be identified where the response behaviour of the cylinder is qualitatively different. This include the possibility of inversion of twist or axial strain when the cylinder is subject to internal pressure. Copyright © The Royal Society 2013.
Axially symmetrical stresses measurement in the cylindrical tube using DIC with hole-drilling
Ma, Yinji; Yao, Xuefeng; Zhang, Danwen
2015-03-01
In this paper, a new method combining the digital image correlation (DIC) with the hole-drilling technology to characterize the axially symmetrical stresses of the cylindrical tube is developed. First, the theoretical expressions of the axially symmetrical stresses in the cylindrical tube are derived based on the displacement or strain fields before and after hole-drilling. Second, the release of the axially symmetrical stresses for the cylindrical tube caused by hole-drilling is simulated by the finite element method (FEM), which indicates that the axially symmetrical stresses of the cylindrical tube calculated by the cylindrical solution is more accuracy than that for traditionally planar solution. Finally, both the speckle image information and the displacement field of the cylindrical tube before and after hole-drilling are extracted by combining the DIC with the hole-drilling technology, then the axially symmetrical loading induced stresses of the cylindrical tube are obtained, which agree well with the results from the strain gauge method.
Antibubbles and fine cylindrical sheets of air
Beilharz, D.
2015-08-14
Drops impacting at low velocities onto a pool surface can stretch out thin hemispherical sheets of air between the drop and the pool. These air sheets can remain intact until they reach submicron thicknesses, at which point they rupture to form a myriad of microbubbles. By impacting a higher-viscosity drop onto a lower-viscosity pool, we have explored new geometries of such air films. In this way we are able to maintain stable air layers which can wrap around the entire drop to form repeatable antibubbles, i.e. spherical air layers bounded by inner and outer liquid masses. Furthermore, for the most viscous drops they enter the pool trailing a viscous thread reaching all the way to the pinch-off nozzle. The air sheet can also wrap around this thread and remain stable over an extended period of time to form a cylindrical air sheet. We study the parameter regime where these structures appear and their subsequent breakup. The stability of these thin cylindrical air sheets is inconsistent with inviscid stability theory, suggesting stabilization by lubrication forces within the submicron air layer. We use interferometry to measure the air-layer thickness versus depth along the cylindrical air sheet and around the drop. The air film is thickest above the equator of the drop, but thinner below the drop and up along the air cylinder. Based on microbubble volumes, the thickness of the cylindrical air layer becomes less than 100 nm before it ruptures.
Antibubbles and fine cylindrical sheets of air
Beilharz, D.; Guyon, A.; Li, E. Q.; Thoraval, M.-J.; Thoroddsen, Sigurdur T
2015-01-01
Drops impacting at low velocities onto a pool surface can stretch out thin hemispherical sheets of air between the drop and the pool. These air sheets can remain intact until they reach submicron thicknesses, at which point they rupture to form a myriad of microbubbles. By impacting a higher-viscosity drop onto a lower-viscosity pool, we have explored new geometries of such air films. In this way we are able to maintain stable air layers which can wrap around the entire drop to form repeatable antibubbles, i.e. spherical air layers bounded by inner and outer liquid masses. Furthermore, for the most viscous drops they enter the pool trailing a viscous thread reaching all the way to the pinch-off nozzle. The air sheet can also wrap around this thread and remain stable over an extended period of time to form a cylindrical air sheet. We study the parameter regime where these structures appear and their subsequent breakup. The stability of these thin cylindrical air sheets is inconsistent with inviscid stability theory, suggesting stabilization by lubrication forces within the submicron air layer. We use interferometry to measure the air-layer thickness versus depth along the cylindrical air sheet and around the drop. The air film is thickest above the equator of the drop, but thinner below the drop and up along the air cylinder. Based on microbubble volumes, the thickness of the cylindrical air layer becomes less than 100 nm before it ruptures.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
DC response of dust to low frequency AC signals
McKinlay, Michael; Konopka, Uwe; Thomas, Edward
2017-10-01
Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.
Cylindrical pressure vessel constructed of several layers
International Nuclear Information System (INIS)
Yamauchi, Takeshi.
1976-01-01
For a cylindrical pressure vessel constructed of several layers whose jacket has at least one circumferential weld joining the individual layers, it is proposed to provide this at least at the first bending line turning point (counting from the weld between the jacket and vessel floor), which the sinusoidally shaped jacket has. The section of the jacket extending in between should be made as a full wall section. The proposal is based on calculations of the bending stiffness of cylindrical jackets, which could not yet be confirmed for jackets having several layers. (UWI) [de
Zhang, Guoqiang; Li, Zhong; Zheng, Huayan; Hao, Zhiqiang; Wang, Xia; Wang, Jiajun
2016-12-01
Activated carbon (AC) supported Cu catalysts are employed to study the influence of surface oxygenated groups on the formation of active Cu species and the catalytic activity of Cu/AC catalyst for oxidative carbonylation of methanol to dimethyl carbonate (DMC). The AC supports are thermal treated under different temperatures in order to adjust the levels of surface oxygenated groups. The AC supports are characterized by BET, TPD-MS and XRD, and the Cu/AC catalysts are characterized by BET, XRD, TEM, XPS, AAS, CH3OH-TPD and N2O chemisorption. The results show that as the treatment temperature is below 800 °C, the BET surface area of the corresponding AC supports are nearly unchanged and close to that of the original AC (1529.6 m2/g). But as the thermal treatment temperature is elevated from 1000 to 1600 °C, the BET surface area of AC supports gradually decreases from 1407.6 to 972.2 m2/g. After loading of Cu, the BET surface area of copper catalysts is in the range of 834.4 to 1545.3 m2/g, which is slightly less than that of the respective supports. When AC is thermal treated at 400 and 600 °C, the unstable carboxylic acid and anhydrides groups are selectively removed, which has weakened the mobility and agglomeration of Cu species during the calcination process, and thus improve the Cu species dispersion over AC support. But as the treatment temperature is elevated from 600 °C to 1200 °C, the Cu species dispersion begins to decline suggesting further removal of stable surface oxygenated groups is unfavorable for Cu species dispersion. Moreover, higher thermal treatment temperature (above 1200 °C) promotes the graphitization degree of AC and leds to the decrease of Cu loading on AC support. Meanwhile, the removal of surface oxygenated groups by thermal treatment is conducive to the formation of more π-sites, and thus promote the reduction of Cu2+ to Cu+ and Cu0 as active centers. The specific surface area of (Cu+ + Cu0) is improved by thermal treatment of AC
Soliton motion in a parametrically ac-driven damped Toda lattice
International Nuclear Information System (INIS)
Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.
1998-01-01
We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society
Novel spherical hohlraum with cylindrical laser entrance holes and shields
Energy Technology Data Exchange (ETDEWEB)
Lan, Ke [Institute of Applied Physics and Computational Mathematics, Beijing 100088 (China); Center for Applied Physics and Technology, Peking University, Beijing 100871 (China); Zheng, Wudi [Institute of Applied Physics and Computational Mathematics, Beijing 100088 (China)
2014-09-15
Our recent works [K. Lan et al., Phys. Plasmas 21, 010704 (2014); K. Lan et al., Phys. Plasmas 21, 052704 (2014)] have shown that the octahedral spherical hohlraums are superior to the cylindrical hohlraums in both higher symmetry during the capsule implosion and lower backscatter without supplementary technology. However, both the coupling efficiency from the drive laser energy to the capsule and the capsule symmetry decrease remarkably when larger laser entrance holes (LEHs) are used. In addition, the laser beams injected at angles > 45° transport close to the hohlraum wall, thus the wall blowoff causes the LEH to close faster and results in strong laser plasma interactions inside the spherical hohlraums. In this letter, we propose a novel octahedral hohlraum with LEH shields and cylindrical LEHs to alleviate these problems. From our theoretical study, with the LEH shields, the laser coupling efficiency is significantly increased and the capsule symmetry is remarkably improved in the spherical hohlraums. The cylindrical LEHs take advantage of the cylindrical hohlraum near the LEH and mitigate the influence of the blowoff on laser transport inside a spherical hohlraum. The cylindrical LEHs can also be applied to the rugby and elliptical hohlraums.
Novel spherical hohlraum with cylindrical laser entrance holes and shields
International Nuclear Information System (INIS)
Lan, Ke; Zheng, Wudi
2014-01-01
Our recent works [K. Lan et al., Phys. Plasmas 21, 010704 (2014); K. Lan et al., Phys. Plasmas 21, 052704 (2014)] have shown that the octahedral spherical hohlraums are superior to the cylindrical hohlraums in both higher symmetry during the capsule implosion and lower backscatter without supplementary technology. However, both the coupling efficiency from the drive laser energy to the capsule and the capsule symmetry decrease remarkably when larger laser entrance holes (LEHs) are used. In addition, the laser beams injected at angles > 45° transport close to the hohlraum wall, thus the wall blowoff causes the LEH to close faster and results in strong laser plasma interactions inside the spherical hohlraums. In this letter, we propose a novel octahedral hohlraum with LEH shields and cylindrical LEHs to alleviate these problems. From our theoretical study, with the LEH shields, the laser coupling efficiency is significantly increased and the capsule symmetry is remarkably improved in the spherical hohlraums. The cylindrical LEHs take advantage of the cylindrical hohlraum near the LEH and mitigate the influence of the blowoff on laser transport inside a spherical hohlraum. The cylindrical LEHs can also be applied to the rugby and elliptical hohlraums
Directory of Open Access Journals (Sweden)
Salvatore Brischetto
2014-01-01
equilibrium written in orthogonal curvilinear coordinates for the free vibrations of simply supported structures. These equations consider an exact geometry for shells without simplifications. The main novelty is the possibility of a general formulation for different geometries. The equations written in general orthogonal curvilinear coordinates allow the analysis of spherical shell panels and they automatically degenerate into cylindrical shell panel, cylindrical closed shell, and plate cases. Results are proposed for isotropic and orthotropic structures. An exhaustive overview is given of the vibration modes for a number of thickness ratios, imposed wave numbers, geometries, embedded materials, and angles of orthotropy. These results can also be used as reference solutions to validate two-dimensional models for plates and shells in both analytical and numerical form (e.g., closed solutions, finite element method, differential quadrature method, and global collocation method.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Cylindrical optical resonators: fundamental properties and bio-sensing characteristics
Khozeymeh, Foroogh; Razaghi, Mohammad
2018-04-01
In this paper, detailed theoretical analysis of cylindrical resonators is demonstrated. As illustrated, these kinds of resonators can be used as optical bio-sensing devices. The proposed structure is analyzed using an analytical method based on Lam's approximation. This method is systematic and has simplified the tedious process of whispering-gallery mode (WGM) wavelength analysis in optical cylindrical biosensors. By this method, analysis of higher radial orders of high angular momentum WGMs has been possible. Using closed-form analytical equations, resonance wavelengths of higher radial and angular order WGMs of TE and TM polarization waves are calculated. It is shown that high angular momentum WGMs are more appropriate for bio-sensing applications. Some of the calculations are done using a numerical non-linear Newton method. A perfect match of 99.84% between the analytical and the numerical methods has been achieved. In order to verify the validity of the calculations, Meep simulations based on the finite difference time domain (FDTD) method are performed. In this case, a match of 96.70% between the analytical and FDTD results has been obtained. The analytical predictions are in good agreement with other experimental work (99.99% match). These results validate the proposed analytical modelling for the fast design of optical cylindrical biosensors. It is shown that by extending the proposed two-layer resonator structure analyzing scheme, it is possible to study a three-layer cylindrical resonator structure as well. Moreover, by this method, fast sensitivity optimization in cylindrical resonator-based biosensors has been possible. Sensitivity of the WGM resonances is analyzed as a function of the structural parameters of the cylindrical resonators. Based on the results, fourth radial order WGMs, with a resonator radius of 50 μm, display the most bulk refractive index sensitivity of 41.50 (nm/RIU).
Analysis of radial vibrations of poroelastic circular cylindrical shells ...
African Journals Online (AJOL)
DR OKE
vanished, the considered problem reduces to the problem of radial vibrations of fluid-filled poroelastic circular cylindrical shell. (2). When the .... the volume change of the solid to that of liquid. ..... When the outer fluid density is zero, that is, ρof = 0 then the poroelastic cylindrical shell immersed in an acoustic medium will.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
On cylindrically converging shock waves shaped by obstacles
Energy Technology Data Exchange (ETDEWEB)
Eliasson, V; Henshaw, W D; Appelo, D
2007-07-16
Motivated by recent experiments, numerical simulations were performed of cylindrically converging shock waves. The converging shocks impinged upon a set of zero to sixteen regularly space obstacles. For more than two obstacles the resulting diffracted shock fronts formed polygonal shaped patterns near the point of focus. The maximum pressure and temperature as a function of number of obstacles were studied. The self-similar behavior of cylindrical, triangular and square-shaped shocks were also investigated.
Security analysis of interconnected AC/DC systems
DEFF Research Database (Denmark)
Eriksson, Robert
2015-01-01
This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
Dismantling OPAL's cylindrical magnet core
Laurent Guiraud
2001-01-01
Lifting a handling device for dismounting the pressure bells, which are inside the cylindrical magnet coil on the central section of OPAL, on the right part of the photo. OPAL was a detector on the LEP accelerator, which ran from 1989 to 2000.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Foda, O.; Welsh, T. A.
2016-04-01
We study the Andrews-Gordon-Bressoud (AGB) generalisations of the Rogers-Ramanujan q-series identities in the context of cylindric partitions. We recall the definition of r-cylindric partitions, and provide a simple proof of Borodin’s product expression for their generating functions, that can be regarded as a limiting case of an unpublished proof by Krattenthaler. We also recall the relationships between the r-cylindric partition generating functions, the principal characters of {\\hat{{sl}}}r algebras, the {{\\boldsymbol{ M }}}r r,r+d minimal model characters of {{\\boldsymbol{ W }}}r algebras, and the r-string abaci generating functions, providing simple proofs for each. We then set r = 2, and use two-cylindric partitions to re-derive the AGB identities as follows. Firstly, we use Borodin’s product expression for the generating functions of the two-cylindric partitions with infinitely long parts, to obtain the product sides of the AGB identities, times a factor {(q;q)}∞ -1, which is the generating function of ordinary partitions. Next, we obtain a bijection from the two-cylindric partitions, via two-string abaci, into decorated versions of Bressoud’s restricted lattice paths. Extending Bressoud’s method of transforming between restricted paths that obey different restrictions, we obtain sum expressions with manifestly non-negative coefficients for the generating functions of the two-cylindric partitions which contains a factor {(q;q)}∞ -1. Equating the product and sum expressions of the same two-cylindric partitions, and canceling a factor of {(q;q)}∞ -1 on each side, we obtain the AGB identities.
Simplified vibrocreep buckling analysis of circular cylindrical shells
International Nuclear Information System (INIS)
Simeonova, K.; Hadjikov, L.; Georgiev, K.; Iotov, I.
1981-01-01
The circular cylindrical shells are used as a mathematical model in the investigation of the reactions of the supporting elements in nuclear reactor core, airplane designing etc. The buckling in the process of vibrocreep is one of the possible catastrophes during the exploitation of those elements. The paper presents a simplified investigation of the vibro-creep stability of a shell axially pressed. The main simplification consists of the fact that the average process of vibro-creep is considered stationary. The modified constitutive equations of Maxwell-Gurevitch-Rabinovitch, concerning elasto-viscous and elasto-plastic material is used. The critical time is calculated after two criteria. Theoretical relations between the critical time and the dynamic loading velocity amplitude are obtained. Those relations are compared to relations experimentally proved. (orig.)
Micropatterning on cylindrical surfaces via electrochemical etching using laser masking
International Nuclear Information System (INIS)
Cho, Chull Hee; Shin, Hong Shik; Chu, Chong Nam
2014-01-01
Highlights: • Various micropatterns were fabricated on the cylindrical surface of a stainless steel shaft. • Selective electrochemical dissolution was achieved via a series process of laser masking and electrochemical etching. • Laser masking characteristics on the non-planar surface were investigated. • A uniform mask layer was formed on the cylindrical surface via synchronized laser line scanning with a rotary system. • The characteristics of electrochemical etching on the non-planar surface were investigated. - Abstract: This paper proposes a method of selective electrochemical dissolution on the cylindrical surfaces of stainless steel shafts. Selective electrochemical dissolution was achieved via electrochemical etching using laser masking. A micropatterned recast layer was formed on the surface via ytterbium-doped pulsed fiber laser irradiation. The micropatterned recast layer could be used as a mask layer during the electrochemical etching process. Laser masking condition to form adequate mask layer on the planar surface for etching cannot be used directly on the non-planar surface. Laser masking condition changes depending on the morphological surface. The laser masking characteristics were investigated in order to form a uniform mask layer on the cylindrical surface. To minimize factors causing non-uniformity in the mask layer on the cylindrical surface, synchronized laser line scanning with a rotary system was applied during the laser masking process. Electrochemical etching characteristics were also investigated to achieve deeper etched depth, without collapsing the recast layer. Consequently, through a series process of laser masking and electrochemical etching, various micropatternings were successfully performed on the cylindrical surfaces
Yuan, Li-Yun; Xiang, Yu; Lu, Jing; Jiang, Hong-Hua
2015-12-01
Based on the transfer matrix method of exploring the circular cylindrical shell treated with active constrained layer damping (i.e., ACLD), combined with the analytical solution of the Helmholtz equation for a point source, a multi-point multipole virtual source simulation method is for the first time proposed for solving the acoustic radiation problem of a submerged ACLD shell. This approach, wherein some virtual point sources are assumed to be evenly distributed on the axial line of the cylindrical shell, and the sound pressure could be written in the form of the sum of the wave functions series with the undetermined coefficients, is demonstrated to be accurate to achieve the radiation acoustic pressure of the pulsating and oscillating spheres respectively. Meanwhile, this approach is proved to be accurate to obtain the radiation acoustic pressure for a stiffened cylindrical shell. Then, the chosen number of the virtual distributed point sources and truncated number of the wave functions series are discussed to achieve the approximate radiation acoustic pressure of an ACLD cylindrical shell. Applying this method, different radiation acoustic pressures of a submerged ACLD cylindrical shell with different boundary conditions, different thickness values of viscoelastic and piezoelectric layer, different feedback gains for the piezoelectric layer and coverage of ACLD are discussed in detail. Results show that a thicker thickness and larger velocity gain for the piezoelectric layer and larger coverage of the ACLD layer can obtain a better damping effect for the whole structure in general. Whereas, laying a thicker viscoelastic layer is not always a better treatment to achieve a better acoustic characteristic. Project supported by the National Natural Science Foundation of China (Grant Nos. 11162001, 11502056, and 51105083), the Natural Science Foundation of Guangxi Zhuang Autonomous Region, China (Grant No. 2012GXNSFAA053207), the Doctor Foundation of Guangxi
Forced vibrations of rotating circular cylindrical shells
International Nuclear Information System (INIS)
Igawa, Hirotaka; Maruyama, Yoshiyuki; Endo, Mitsuru
1995-01-01
Forced vibrations of rotating circular cylindrical shells are investigated. Basic equations, including the effect of initial stress due to rotation, are formulated by the finite-element method. The characteristic relations for finite elements are derived from the energy principle by considering the finite strain. The equations of motion can be separated into quasi-static and dynamic ones, i.e., the equations in the steady rotating state and those in the vibration state. Radial concentrated impulses are considered as the external dynamic force. The transient responses of circular cylindrical shells are numerically calculated under various boundary conditions and rotating speeds. (author)
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Study on emergency power control strategy for AC/DC hybrid power system containing VSC-HVDC
Liu, Lin; Hu, Zhenda; Ye, Rong; Lin, Zhangsui; Yang, Xiaodong; Yi, Yang
2018-04-01
This paper presents a comprehensive emergency power control strategy for AC/DC hybrid power systems containing VSC-HVDC. Firstly, the paper analyzes the power support of the VSC-HVDC to the AC lines using the Power Transferring Relativity Factor (PTRF). Then the power adjustment of the VSC-HVDC in several different circumstances are calculated. Finally, the online power control strategies of VSC-HVDC are designed, which could rapidly control the power of the VSC-HVDC, keeping the power flow of AC lines below the upper limit. Furthermore, the strategy is proven to be effective by the simulations with EMTDC/PSCAD.
Cylindrical thin-shell wormholes
International Nuclear Information System (INIS)
Eiroa, Ernesto F.; Simeone, Claudio
2004-01-01
A general formalism for the dynamics of nonrotating cylindrical thin-shell wormholes is developed. The time evolution of the throat is explicitly obtained for thin-shell wormholes whose metric has the form associated with local cosmic strings. It is found that the throat collapses to zero radius, remains static, or expands forever, depending only on the sign of its initial velocity
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Coordinated Control Scheme for Ancillary Services from Offshore Wind Power Plants to AC and DC Grids
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela
2016-01-01
This paper proposes a new approach of providing ancillary services to AC and DC grids from offshore wind power plants (OWPPs), connected through multi-terminal HVDC network. A coordinated control scheme where OWPP’s AC grid frequency modulated according to DC grid voltage variations is used...... to detect and provide the ancillary service requirements of both AC and DC grids, is proposed in this paper. In particular, control strategies for onshore frequency control, fault ridethrough support in the onshore grid, and DC grid voltage control are considered. The proposed control scheme involves only...
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Formation of vortex breakdown in conical–cylindrical cavities
International Nuclear Information System (INIS)
Martins, Diego Alves de Moro; Souza, Francisco José de; Salvo, Ricardo de Vasconcelos
2014-01-01
Highlights: • Rotating flows in conical–cylindrical cavities were simulated via an in-house code using unstructured meshes. • The vortex breakdown phenomenon was verified in the geometries analyzed. • The influence of Stewartson and Bödewadt layers was observed in the vortex breakdown formation. • A curve of stability and number of breakdowns was obtained as a function of Reynolds number. • Spiral vortex breakdown was observed in some situations. - Abstract: Numerical simulations in confined rotating flows were performed in this work, in order to verify and characterize the formation of the vortex breakdown phenomenon. Cylindrical and conical–cylindrical geometries, both closed, were used in the simulations. The rotating flow is induced by the bottom wall, which rotates at constant angular velocity. Firstly the numerical results were compared to experimental results available in references, with the purpose to verify the capacity of the computational code to predict the vortex breakdown phenomenon. Further, several simulations varying the parameters which govern the characteristics of the flows analyzed in this work, i.e., the Reynolds number and the aspect ratio, were performed. In these simulations, the limits for the transitional regime and the vortex breakdown formation were verified. Steady and transient cases, with and without turbulence modeling, were simulated. In general, some aspects of the process of vortex breakdown in conical–cylindrical geometries were observed to be different from that in cylinders
The magnetic properties of the hollow cylindrical ideal remanence magnet
DEFF Research Database (Denmark)
Bjørk, Rasmus
2016-01-01
We consider the magnetic properties of the hollow cylindrical ideal remanence magnet. This magnet is the cylindrical permanent magnet that generates a uniform field in the cylinder bore, using the least amount of magnetic energy to do so. The remanence distribution of this magnet is derived...
arXiv The new cylindrical GEM inner tracker of BESIII
Lavezzi, L.; Amoroso, A.; Ferroli, R. Baldini; Bertani, M.; Bettoni, D.; Bianchi, F.; Calcaterra, A.; Canale, N.; Capodiferro, M.; Carassiti, V.; Cerioni, S.; Chai, Jy; Chiozzi, S.; Cibinetto, G.; Cossio, F.; Cotta Ramusino, A.; De Mori, F.; Destefanis, M.; Dong, J.; Evangelisti, F.; Farinelli, R.; Fava, L.; Felici, G.; Fioravanti, E.; Garzia, I.; Gatta, M.; Greco, M.; Leng, Cy; Li, H.; Maggiora, M.; Malaguti, R.; Marcello, S.; Melchiorri, M.; Mezzadri, G.; Mignone, M.; Morello, G.; Pacetti, S.; Patteri, P.; Pellegrino, J.; Pelosi, A.; Rivetti, A.; Rolo,; Savrié, M.; Scodeggio, M.; Soldani, E.; Sosio, S.; Spataro, S.; Tskhadadze, E.; Verma, S.; Wheadon, R.; Yan, L.
2018-05-03
The Cylindrical GEM-Inner Tracker (CGEM-IT) is the upgrade of the internal tracking system of the BESIII experiment. It consists of three layers of cylindrically-shaped triple GEMs, with important innovations with respect to the existing GEM detectors, in order to achieve the best performance with the lowest material budget. It will be the first cylindrical GEM running with analog readout inside a 1T magnetic field. The simultaneous measurement of both the deposited charge and the signal time will permit to use a combination of two algorithms to evaluate the spatial position of the charged tracks inside the CGEM-IT: the charge centroid and the micro time projection chamber modes. They are complementary and can cope with the asymmetry of the electron avalanche when running in magnetic field and with non-orthogonal incident tracks. To evaluate the behaviour under different working settings, both planar chambers and the first cylindrical prototype have been tested during various test beams at CERN with 150 GeV/c...
Micromagnetic simulations of cylindrical magnetic nanowires
Ivanov, Yurii P.; Chubykalo-Fesenko, O.
2015-01-01
This chapter reviews micromagnetic simulations of cylindrical magnetic nanowires and their ordered arrays. It starts with a description of the theoretical background of micromagnetism. The chapter discusses main magnetization reversal modes, domain
Filling of charged cylindrical capillaries
Das, Siddhartha; Chanda, Sourayon; Eijkel, J.C.T.; Tas, N.R.; Chakraborty, Suman; Mitra, Sushanta K.
2014-01-01
We provide an analytical model to describe the filling dynamics of horizontal cylindrical capillaries having charged walls. The presence of surface charge leads to two distinct effects: It leads to a retarding electrical force on the liquid column and also causes a reduced viscous drag force because
Rotation, inversion and perversion in anisotropic elastic cylindrical tubes and membranes
Goriely, A.; Tabor, M.
2013-01-01
Cylindrical tubes and membranes are universal structural elements found in biology and engineering over a wide range of scales.Working in the framework of nonlinear elasticity, we consider the possible deformations of elastic cylindrical shells
Analytical modelling of a thin liquid metal layer submitted to an ac magnetic field
Energy Technology Data Exchange (ETDEWEB)
Hinaje, M [Groupe de Recherche en Electrotechnique et Electronique de Nancy, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Vinsard, G [Laboratoire d' Energetique et de Mecanique Theorique et Appliquee, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Dufour, S [Laboratoire d' Energetique et de Mecanique Theorique et Appliquee, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France)
2006-07-07
A cylindrical thin liquid metal layer is submitted to a uniform ac magnetic field. When the intensity of the electromagnetic field exceeds a critical value, an opening in the liquid is shaped from outside to inside. At a given intensity of the electromagnetic field, this opening is in a frozen state, that is, the liquid metal layer reaches a new equilibrium shape. In this paper, we show that this equilibrium corresponds to a minimum of the total energy of the system. This total energy is equal to the sum of the magnetic energy and the mechanical energy. The magnetic energy is computed by assuming that the induced eddy current flowing through the liquid metal layer is concentrated in the cross-section S{sub c} equal to the product of the skin depth and the thickness of the layer. This assumption leads us to study an equivalent electrical circuit. The mechanical energy is composed of the potential energy and the surface energy.
Analytical modelling of a thin liquid metal layer submitted to an ac magnetic field
International Nuclear Information System (INIS)
Hinaje, M; Vinsard, G; Dufour, S
2006-01-01
A cylindrical thin liquid metal layer is submitted to a uniform ac magnetic field. When the intensity of the electromagnetic field exceeds a critical value, an opening in the liquid is shaped from outside to inside. At a given intensity of the electromagnetic field, this opening is in a frozen state, that is, the liquid metal layer reaches a new equilibrium shape. In this paper, we show that this equilibrium corresponds to a minimum of the total energy of the system. This total energy is equal to the sum of the magnetic energy and the mechanical energy. The magnetic energy is computed by assuming that the induced eddy current flowing through the liquid metal layer is concentrated in the cross-section S c equal to the product of the skin depth and the thickness of the layer. This assumption leads us to study an equivalent electrical circuit. The mechanical energy is composed of the potential energy and the surface energy
New Subarray Readout Patterns for the ACS Wide Field Channel
Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.
2017-04-01
At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.
Spin-wave propagation spectrum in magnetization-modulated cylindrical nanowires
Energy Technology Data Exchange (ETDEWEB)
Li, Zhi-xiong; Wang, Meng-ning; Nie, Yao-zhuang; Wang, Dao-wei; Xia, Qing-lin [School of Physics and Electronics, Central South University, Changsha 410083 (China); Tang, Wei [School of Physics and Electronics, Central South University, Changsha 410083 (China); Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Sciences, Suzhou 215123 (China); Zeng, Zhong-ming [Suzhou Institute of Nano-tech and Nano-bionics, Chinese Academy of Sciences, Suzhou 215123 (China); Guo, Guang-hua, E-mail: guogh@mail.csu.edu.cn [School of Physics and Electronics, Central South University, Changsha 410083 (China)
2016-09-15
Spin-wave propagation in periodic magnetization-modulated cylindrical nanowires is studied by micromagnetic simulation. Spin wave scattering at the interface of two magnetization segments causes a spin-wave band structure, which can be effectively tuned by changing either the magnetization modulation level or the period of the cylindrical nanowire magnonic crystal. The bandgap width is oscillating with either the period or magnetization modulation due to the oscillating variation of the spin wave transmission coefficient through the interface of the two magnetization segments. Analytical calculation based on band theory is used to account for the micromagnetic simulation results. - Highlights: • A magnetization-modulated cylindrical nanowire magnonic crystal is proposed. • Propagating characteristics of spin waves in such magnonic crystal are studied. • Spin-wave spectra can be manipulated by changing modulation level and period.
Cylindrical concave body of composite fibrous material
International Nuclear Information System (INIS)
1979-01-01
The invention is concerned with a cylindrical concave body of compound fibrous material which is intended to be exposed to high rotation speeds around its own longitudinal axis. The concave body in question has at least one layer of fibrils that are interwoven and enclose an identical angle with the longitudinal axis of the concave body in both directions. The concave body in question also has at least a second layer of fibrils that run in the direction of the circumference and are fitted radially to the outside. The cylindrical concave body of the invention is particularly well suited for application as a rotor tube in a gas ultra-centrifuge
A Novel Vibration Mode Testing Method for Cylindrical Resonators Based on Microphones
Directory of Open Access Journals (Sweden)
Yongmeng Zhang
2015-01-01
Full Text Available Non-contact testing is an important method for the study of the vibrating characteristic of cylindrical resonators. For the vibratory cylinder gyroscope excited by piezo-electric electrodes, mode testing of the cylindrical resonator is difficult. In this paper, a novel vibration testing method for cylindrical resonators is proposed. This method uses a MEMS microphone, which has the characteristics of small size and accurate directivity, to measure the vibration of the cylindrical resonator. A testing system was established, then the system was used to measure the vibration mode of the resonator. The experimental results show that the orientation resolution of the node of the vibration mode is better than 0.1°. This method also has the advantages of low cost and easy operation. It can be used in vibration testing and provide accurate results, which is important for the study of the vibration mode and thermal stability of vibratory cylindrical gyroscopes.
International Nuclear Information System (INIS)
Wang, L. F.; He, X. T.; Wu, J. F.; Zhang, W. Y.; Ye, W. H.
2013-01-01
A weakly nonlinear (WN) model has been developed for the incompressible Rayleigh-Taylor instability (RTI) in cylindrical geometry. The transition from linear to nonlinear growth is analytically investigated via a third-order solutions for the cylindrical RTI initiated by a single-mode velocity perturbation. The third-order solutions can depict the early stage of the interface asymmetry due to the bubble-spike formation, as well as the saturation of the linear (exponential) growth of the fundamental mode. The WN results in planar RTI [Wang et al., Phys. Plasmas 19, 112706 (2012)] are recovered in the limit of high-mode number perturbations. The difference between the WN growth of the RTI in cylindrical geometry and in planar geometry is discussed. It is found that the interface of the inward (outward) development spike/bubble is extruded (stretched) by the additional inertial force in cylindrical geometry compared with that in planar geometry. For interfaces with small density ratios, the inward growth bubble can grow fast than the outward growth spike in cylindrical RTI. Moreover, a reduced formula is proposed to describe the WN growth of the RTI in cylindrical geometry with an acceptable precision, especially for small-amplitude perturbations. Using the reduced formula, the nonlinear saturation amplitude of the fundamental mode and the phases of the Fourier harmonics are studied. Thus, it should be included in applications where converging geometry effects play an important role, such as the supernova explosions and inertial confinement fusion implosions.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Gravitational Instability of Cylindrical Viscoelastic Medium ...
Indian Academy of Sciences (India)
similar to that of viscoelastic fluid where both properties work together. They also ... cylindrical gravitational waves provides a strong motivation in this regard. .... which represents the solenoidal character of the magnetic field and the total stress.
Confined and interface phonons in combined cylindrical nanoheterosystem
Directory of Open Access Journals (Sweden)
O.M.Makhanets
2006-01-01
Full Text Available The spectra of all types of phonons existing in a complicated combined nanoheterosystem consisting of three cylindrical quantum dots embedded into the cylindrical quantum wire placed into vacuum are studied within the dielectric continuum model. It is shown that there are confined optical (LO and interface phonons of two types: top surface optical (TSO and side surface optical (SSO modes of vibration in such a nanosystem. The dependences of phonon energies on the quasiwave numbers and geometrical parameters of quantum dots are investigated and analysed.
The cylindrical GEM detector of the KLOE-2 experiment
International Nuclear Information System (INIS)
Bencivenni, G.; Ciambrone, P.; De Lucia, E.; Domenici, D.; Felici, G.; Fermani, P.; Morello, G.; Branchini, P.; Cicco, A. Di; Czerwinski, E.
2017-01-01
The KLOE-2 experiment started its data taking campaign in November 2014 with an upgraded tracking system at the DAΦNE electron-positron collider at the Frascati National Laboratory of INFN. The new tracking device, the Inner Tracker, operated together with the KLOE-2 Drift Chamber, has been installed to improve track and vertex reconstruction capabilities of the experimental apparatus. The Inner Tracker is a cylindrical GEM detector composed of four cylindrical triple-GEM detectors, each provided with an X-V strips-pads stereo readout. Although GEM detectors are already used in high energy physics experiments, this device is considered a frontier detector due to its fully-cylindrical geometry: KLOE-2 is the first experiment benefiting of this novel detector technology. Alignment and calibration of this detector will be presented together with its operating performance and reconstruction capabilities.
Cylindrical-confinement-induced phase behaviours of diblock copolymer melts
International Nuclear Information System (INIS)
Mei-Jiao, Liu; Shi-Ben, Li; Lin-Xi, Zhang; Xiang-Hong, Wang
2010-01-01
The phase behaviours of diblock copolymers under cylindrical confinement are studied in two-dimensional space by using the self-consistent field theory. Several phase parameters are adjusted to investigate the cylindrical-confinement-induced phase behaviours of diblock copolymers. A series of lamella-cylinder mixture phases, such as the mixture of broken-lamellae and cylinders and the mixture of square-lamellae and cylinders, are observed by varying the phase parameters, in which the behaviours of these mixture phases are discussed in the corresponding phase diagrams. Furthermore, the free energies of these mixture phases are investigated to illustrate their evolution processes. Our results are compared with the available observations from the experiments and simulations respectively, and they are in good agreement and provide an insight into the phase behaviours under cylindrical confinement. (cross-disciplinary physics and related areas of science and technology)
Buckling localization in a cylindrical panel under axial compression
DEFF Research Database (Denmark)
Tvergaard, Viggo; Needleman, A.
2000-01-01
Localization of an initially periodic buckling pattern is investigated for an axially compressed elastic-plastic cylindrical panel of the type occurring between axial stiffeners on cylindrical shells. The phenomenon of buckling localization and its analogy with plastic flow localization in tensile...... test specimens is discussed in general. For the cylindrical panel, it is shown that buckling localization develops shortly after a maximum load has been attained, and this occurs for a purely elastic panel as well as for elastic-plastic panels. In a case where localization occurs after a load maximum......, but where subsequently the load starts to increase again, it is found that near the local load minimum, the buckling pattern switches back to a periodic type of pattern. The inelastic material behavior of the panel is described in terms of J(2) corner theory, which avoids the sometimes unrealistically high...
Optics Demonstrations Using Cylindrical Lenses
Ivanov, Dragia; Nikolov, Stefan
2015-01-01
In this paper we consider the main properties of cylindrical lenses and propose several demonstrational experiments that can be performed with them. Specifically we use simple glasses full of water to demonstrate some basic geometrical optics principles and phenomena. We also present some less standard experiments that can be performed with such…
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Research on Cylindrical Surface Wave Plasma Fluorescent Lamps
Directory of Open Access Journals (Sweden)
Kun WANG
2013-07-01
Full Text Available This paper presents an application of the well known SPWM technique on a voltage stabilizer, using a microcontroller. The stabilizer is AC/DC/AC type. So, the system rectifies the input AC voltage to a suitable DC level and the intelligent control of an embedded microcontroller regulates the pulse width of the output voltage in order to produce through a filter a perfect sinusoidal AC voltage. The control program on the microcontroller has the ability to change the FET transistor firing in order to compensate any input voltage variation. The applied software using the microcontroller’s interrupts managed to achieve concurrency on the running program.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Characteristic Determination Of Self Shielding Factor And Cadmium Ratio Of Cylindrical Probe
International Nuclear Information System (INIS)
Hamzah, Amir; Budi R, Ita; Pinem, Suriam
1996-01-01
Determination of thermal, epithermal and total self shielding factor and cadmium ratio of cylindrical probe has been done by measurement and calculation. Self shielding factor can be determined by dividing probe activity to Al-alloy probe activity. Due to the lack of cylindrical probe made of Al-alloy, self shielding factor can be determined by parabolic extrapolation of measured activities to 0 cm radius to divide those activities. Theoretically, self shielding factor can be determined by making numerical solution of two dimensional integral equations using Romberg method. To simplify, the calculation is based on single collision theory with the assumption of monoenergetic neutron and isotropic distribution. For gold cylindrical probe, the calculation results are quite close to the measurement one with the relative discrepancy for activities, cadmium ratio and self shielding factor of bare probe are less then 11.5%, 3,5% and 1.5% respectively. The program can be used for the calculation of other kinds of cylindrical probes. Due to dependency to radius, cylindrical probe made of copper has the best characteristic of self shielding factor and cadmium ratio
International Nuclear Information System (INIS)
Xie, Zhong-Xiang; Zhang, Yong; Zhang, Li-Fu; Fan, Dian-Yuan
2017-01-01
Thermal transport contributed by the torsional phonons in cylindrical nanowires is investigated by using the isotropic elastic continuum theory. The numerical calculations for both the concavity-shaped and convexity-shaped cylindrical structures are made to reveal the role of the evanescent modes. Results show that the evanescent modes play an important role in influencing the thermal transport in such structures. For the concavity-shaped cylindrical nanowire, the evanescent modes can enhance the thermal conductance by about 20 percent, while for the convexity-shaped cylindrical nanowire, the evanescent modes can suppress the thermal conductance by 6 percent. It is also shown that the influence of the evanescent modes on the thermal conductance is strongly related to the attenuation length of the evanescent modes. A brief analysis of these results is given. - Highlights: • The evanescent modes play an important role in influencing thermal transport contributed by torsional phonons in cylindrical nanowires. • For the concavity-shaped cylindrical nanowire, the evanescent modes can enhance the thermal conductance by about 20 percent, while for the convexity-shaped cylindrical nanowire, they can suppress the thermal conductance by 6 percent.
Energy Technology Data Exchange (ETDEWEB)
Xie, Zhong-Xiang [SZU-NUS Collaborative Innovation Center for Optoelectronic Science Technology, International Collaborative Laboratory of 2D Materials for Optoelectronic Science & Technology, Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); Department of Mathematics and Physics, Hunan Institute of Technology, Hengyang 421002 (China); Zhang, Yong [Department of Mathematics and Physics, Hunan Institute of Technology, Hengyang 421002 (China); Zhang, Li-Fu, E-mail: zhanglifu68@hotmail.com [SZU-NUS Collaborative Innovation Center for Optoelectronic Science Technology, International Collaborative Laboratory of 2D Materials for Optoelectronic Science & Technology, Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); Fan, Dian-Yuan [SZU-NUS Collaborative Innovation Center for Optoelectronic Science Technology, International Collaborative Laboratory of 2D Materials for Optoelectronic Science & Technology, Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China)
2017-05-03
Thermal transport contributed by the torsional phonons in cylindrical nanowires is investigated by using the isotropic elastic continuum theory. The numerical calculations for both the concavity-shaped and convexity-shaped cylindrical structures are made to reveal the role of the evanescent modes. Results show that the evanescent modes play an important role in influencing the thermal transport in such structures. For the concavity-shaped cylindrical nanowire, the evanescent modes can enhance the thermal conductance by about 20 percent, while for the convexity-shaped cylindrical nanowire, the evanescent modes can suppress the thermal conductance by 6 percent. It is also shown that the influence of the evanescent modes on the thermal conductance is strongly related to the attenuation length of the evanescent modes. A brief analysis of these results is given. - Highlights: • The evanescent modes play an important role in influencing thermal transport contributed by torsional phonons in cylindrical nanowires. • For the concavity-shaped cylindrical nanowire, the evanescent modes can enhance the thermal conductance by about 20 percent, while for the convexity-shaped cylindrical nanowire, they can suppress the thermal conductance by 6 percent.
Czech Academy of Sciences Publication Activity Database
Lísal, Martin; Předota, Milan; Brennan, J.K.
2013-01-01
Roč. 39, č. 13 (2013), s. 1103-1120 ISSN 0892-7022 R&D Projects: GA ČR GA13-09914S Grant - others:GA ČR(CZ) GA13-08651S Institutional support: RVO:67985858 Keywords : molecular dynamics * reaction ensemble Monte Carlo * slit and cylindrical nanopores Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.119, year: 2013
Superconducting magnetic energy storage apparatus structural support system
Withers, Gregory J.; Meier, Stephen W.; Walter, Robert J.; Child, Michael D.; DeGraaf, Douglas W.
1992-01-01
A superconducting magnetic energy storage apparatus comprising a cylindrical superconducting coil; a cylindrical coil containment vessel enclosing the coil and adapted to hold a liquid, such as liquefied helium; and a cylindrical vacuum vessel enclosing the coil containment vessel and located in a restraining structure having inner and outer circumferential walls and a floor; the apparatus being provided with horizontal compression members between (1) the coil and the coil containment vessel and (2) between the coil containment vessel and the vacuum vessel, compression bearing members between the vacuum vessel and the restraining structure inner and outer walls, vertical support members (1) between the coil bottom and the coil containment vessel bottom and (2) between the coil containment vessel bottom and the vacuum vessel bottom, and external supports between the vacuum vessel bottom and the restraining structure floor, whereby the loads developed by thermal and magnetic energy changes in the apparatus can be accommodated and the structural integrity of the apparatus be maintained.
Directory of Open Access Journals (Sweden)
Mehdi Safari
2016-09-01
Full Text Available In this work, laser forming of cylindrical surfaces with arbitrary radius of curvature is investigated experimentally and numerically. For laser forming of cylindrical surfaces with arbitrary radius of curvature, a new and comprehensive method is proposed in this paper. This method contains simple linear irradiating lines and using an analytical method, required process parameters for laser forming of a cylindrical surface with a specific radius of curvature is proposed. In this method, laser output power, laser scanning speed and laser beam diameter are selected based on laser machine and process limitations. As in the laser forming of a cylindrical surface, parallel irradiating lines are needed; therefore key parameter for production of a cylindrical surface with a specific radius of curvature is the number of irradiating lines. Hence, in the proposed analytical method, the required number of irradiating lines for production of a cylindrical surface with a specific radius of curvature is suggested. Performance of the proposed method for production of cylindrical surface with a specific radius of curvature is verified with experimental tests. The results show that using proposed analytical method, cylindrical surfaces with any radius of curvature can be produced successfully.
Kiełczyński, Piotr; Pajewski, Wincenty; Szalewski, Marek
2003-03-01
In this paper, a new method for determining the rheological parameters of viscoelastic liquids is presented. To this end, we used the perturbation method applied to shear vibrations of cylindrical piezoceramic resonators. The resonator was viscoelastically loaded on the outer cylindrical surface. Due to this loading, the resonant frequency and quality factor of the resonator changed. According to the perturbation method, the change in the complex resonant frequency deltaomega = deltaomega(re) + jdeltaomega(im) is directly proportional to the specific acoustic impedance for cylindrical waves Zc of a viscoelastic liquid surrounding the resonator, i.e., deltaomega is approximately equal to jZc, where j = (-1)1/2. Hence, the measurement of the real and imaginary parts of the complex resonant frequency deltaomega determines the real part, Rc, and imaginary part, Xc, of the complex acoustic impedance for cylindrical waves Zc of an investigated liquid. Furthermore, the specific impedance ZL for plane waves was related to the specific impedance Zc for cylindrical waves. Using theoretical formulas established and the results of the experiments performed, the shear storage modulus mu and the viscosity eta for various liquids (e.g., epoxy resins) were determined. Moreover, the authors derived for cylindrical resonators a formula that relates the shift in resonant frequency to the viscosity of the liquid. This formula is analogous to the Kanazawa-Gordon formula that was derived for planar resonators and Newtonian liquids.
Dynamic plastic buckling of cylindrical and spherical shells
International Nuclear Information System (INIS)
Jones, N.; Okawa, D.M.
1975-01-01
A theoretical analysis is developed to predict the dynamic plastic buckling of a long, impulsively loaded cylindrical shell in order to examine various features of plastic buckling and to assess the importance of several approximations with previous authors have introduced in dynamic plastic buckling studies. The influence of a time-dependent circumferential membrane force, the sharpness of the peaks in the displacement and velocity amplification functions, the restrictions which are implicit when employing the Prandtl-Reuss equations in this class of problems, and the limitations due to elastic unloading are examined in some detail. A summary of all previously published theoretical investigations known to the authors is undertaken for the dynamic plastic behavior of cylindrical shells and rings which are made from rigid-plastic, rigid-visco-plastic, elastic-plastic and elastic-visco-plastic materials and subjected to initial axisymmetric impulsive velocity fields. The theoretical predictions of the dominant motions, critical mode numbers, and threshold impulses are compared and critically reviewed. An experimental investigation was also undertaken into the dynamic plastic buckling of circular rings subjected to uniformly distributed external impulsive velocities. It appears that no experiments have been reported previously on mild steel cylindrical shells with an axial length (L) less than four times the shell radius (R). The experimental values of the average final radial deflections, critical mode numbers and dimensions of the permanent wrinkles in the mild steel and some aliminium 6,061 T6 specimens are compared with all the previously published theoretical predictions and experimental results on cylindrical shells with various axial lengths. (orig./HP) [de
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Application of the cylindrically guided wave technique for bolt and pump shaft inspections
International Nuclear Information System (INIS)
Light, G.M.; Ruescher, E.H.; Bloom, E.A.; Joshi, N.R.; Tsai, Y.M.; Liu, S.N.
1993-01-01
Elastic wave propagation in a bounded medium significantly differs from that in an unbounded medium. The bounded medium in the form of a cylinder acts like a solid waveguide directing the wave with its geometry. A continuous or a pulsed wave interacts with cylindrical boundaries producing mode-converted signals in addition to the backwall echo. The signals are received at constant time intervals directly proportional to the diameter of a solid cylindrical object such as a bolt or an anchor stud. The Cylindrically Guided Wave Technique (CGWT) makes intelligent use of the mode-converted signals, or trailing pulses, to detect corrosion wastages and cracks in cylindrical objects. (orig.)
Cylindrically converging blast waves in air
Matsuo, H.; Nakamura, Y.
1981-07-01
Cylindrically converging shock waves are produced by utilizing the detonation of cylindrical explosive shells. The production and the propagation of shock waves are observed by framing and streak camera photographs, and the trajectory of shock propagations is determined by using an electrical ionization probing system. The effect of the quantity of explosives on the stability, or the axial symmetry, of shock fronts and on the strength of shocks produced is investigated. It has been shown that, for practical purposes, the approximation of shock trajectories by Guderley's formulas would be sufficiently acceptable in an unexpectedly wide region near the implosion center, and that the axial symmetry of the shock front is improved by increasing the quantity of explosives, and thus, strong shocks are produced by merely increasing the quantity of explosives. The reflected diverging shock seems to be very stable. Piezoelectric elements have also been used to detect reflected diverging waves.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan
2014-09-22
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan; Cha, Min; Chung, Suk-Ho
2014-01-01
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Forces between arrays of permanent magnets of basic geometric shapes
Czech Academy of Sciences Publication Activity Database
Vokoun, David; Beleggia, M.
2014-01-01
Roč. 350, JAN (2014), s. 174-178 ISSN 0304-8853 R&D Projects: GA ČR(CZ) GAP107/11/0391; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : permanent magnet * cylindrical magnet * attraction force * magnetostatic interaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.970, year: 2014 http://ac.els-cdn.com/S0304885313006732/1-s2.0-S0304885313006732-main.pdf?_tid=f6840b24-5115-11e3-9237-00000aab0f6b&acdnat=1384864232_323ac87712560a07
International Nuclear Information System (INIS)
Albertazzi, Armando Jr; Pont, Alex Dal
2005-01-01
This paper introduces a new design of a white light interferometer, suitable for measurement of cylindrical or quasi-cylindrical parts. A high precision 45 deg. conical mirror is used to direct collimated light radially, making it possible to measure in true cylindrical coordinates. The image of the measurand, distorted by the conical mirror, is projected in a high resolution digital camera. A mapping algorithm is used to reconstruct the cylindrical geometry from the distorted image. The rest of the interferometer is quite similar to a conventional white light interferometer: A flat reference mirror is scanned through the measurement range while an algorithm is searching for the maximum contrast position of the interference pattern. The performance evaluation of a configuration suitable for measurement of external cylindrical surfaces is also presented in this paper. A master cylinder was used as reference. Uncertainties of about 1.0 μm were found at the present stage of development
Support open access publishing
DEFF Research Database (Denmark)
Ekstrøm, Jeannette
2013-01-01
Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante tidsskriftsinformati......Projektet Support Open Access Publishing har til mål at få opdateret Sherpa/Romeo databasen (www.sherpa.ac.uk/romeo) med fagligt relevante, danske tidsskrifter. Projektet skal endvidere undersøge mulighederne for at få udviklet en database, hvor forskere på tværs af relevante...
Cylindrical Induction Melter Modicon Control System
International Nuclear Information System (INIS)
Weeks, G.E.
1998-04-01
In the last several years an extensive R ampersand D program has been underway to develop a vitrification system to stabilize Americium (Am) and Curium (Cm) inventories at SRS. This report documents the Modicon control system designed for the 3 inch Cylindrical Induction Melter (CIM)
A strong focussing cylindrical electrostatic quadrupole
International Nuclear Information System (INIS)
Sheng Yaochang
1986-01-01
The construction and performance of small cylindrical electrostatic quadrupole, which is installed in JM-400 pulse electrostatic accelerator, are described. This electrostatic quadrupole is not only used in neutron generator, but also suitable for ion injector as well as for low energy electron accelerator
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
The analytic nodal method in cylindrical geometry
International Nuclear Information System (INIS)
Prinsloo, Rian H.; Tomasevic, Djordje I.
2008-01-01
Nodal diffusion methods have been used extensively in nuclear reactor calculations, specifically for their performance advantage, but also for their superior accuracy. More specifically, the Analytic Nodal Method (ANM), utilising the transverse integration principle, has been applied to numerous reactor problems with much success. In this work, a nodal diffusion method is developed for cylindrical geometry. Application of this method to three-dimensional (3D) cylindrical geometry has never been satisfactorily addressed and we propose a solution which entails the use of conformal mapping. A set of 1D-equations with an adjusted, geometrically dependent, inhomogeneous source, is obtained. This work describes the development of the method and associated test code, as well as its application to realistic reactor problems. Numerical results are given for the PBMR-400 MW benchmark problem, as well as for a 'cylindrisized' version of the well-known 3D LWR IAEA benchmark. Results highlight the improved accuracy and performance over finite-difference core solutions and investigate the applicability of nodal methods to 3D PBMR type problems. Results indicate that cylindrical nodal methods definitely have a place within PBMR applications, yielding performance advantage factors of 10 and 20 for 2D and 3D calculations, respectively, and advantage factors of the order of 1000 in the case of the LWR problem
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Wellposedness of a cylindrical shell model
International Nuclear Information System (INIS)
McMillan, C.
1994-01-01
We consider a well-known model of a thin cylindrical shell with dissipative feedback controls on the boundary in the form of forces, shears, and moments. We show that the resulting closed loop feedback problem generates a s.c. semigroup of contractions in the energy space
Energy Technology Data Exchange (ETDEWEB)
Faugeras, P E [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Groupe de recherches sur la fusion controlee
1967-07-01
The problem of the scattering of plane electromagnetic waves from a non-uniform, cylindrically symmetrical plasma is solved analytically, by a self-consistent field method, for a wave with the electric field parallel to the cylinder axis. Numerical results for the diffracted field are plotted for interesting ranges of the parameters involved: diameter, density on the axis, radial profile of the density, and collision frequencies. The case where the incident field is cylindric (waves surfaces parallel to the cylinder axis) is examined - this permits to connect theoretical calculations and experimental diffraction patterns, and also to explain the diffraction effects observed in a classical microwave interferometry experiment. These results, and the possibility of measuring exactly the diffracted field (showed by experiments with dielectric and metallic rods) lead to a new plasma diagnostic method, based on the diffraction, which has no theoretical limitations and it usable when the classical free-space wave methods are not (plasma diameter lower than 10 wave lengths). The feasibility of this method is tested with a plasma at atmospheric pressure and a 2 mm incident wavelength. The plasma is obtained by the laminar flow of a plasma torch, with a working gas (He or Ar) seeded by potassium (density continuously variable between 10{sup 11} and 10{sup 15} e/cm{sup 3}. Some diffraction patterns by this plasma and for various incident waves, are also given and explained with theoretical calculations. (author) [French] On etudie la diffusion coherente d'une onde electromagnetique par un cylindre de plasma inhomogene par une methode de champ self-consistant, et pour une onde de vecteur electrique parallele a l'axe du cylindre. On a calcule le champ diffracte en faisant varier le diametre du cylindre, la densite sur l'axe, le profil de densite et les frequences de collisions, et on donne ici les principaux resultats. On examine ensuite le cas d'une onde incidente cylindrique
Implementation and Evaluation of WLAN 802.11ac for Residential Networks in NS-3
Directory of Open Access Journals (Sweden)
Andy Bubune Amewuda
2018-01-01
Full Text Available Wi-Fi has been an amazingly successful technology. Its success may be attributed to the fact that, despite the significant advances made in technology over the last decade, it has remained backward compatible. 802.11ac is the latest version of the wireless LAN (WLAN standard that is currently being adopted, and it promises to deliver very high throughput (VHT, operating at the 5 GHz band. In this paper, we report on an implementation of 802.11ac wireless LAN for residential scenario based on the 802.11ax task group scenario document. We evaluate the 802.11ac protocol performance under different operating conditions. Key features such as modulation coding set (MCS, frame aggregation, and multiple-input multiple-output (MIMO were investigated. We also evaluate the average throughput, delay, jitter, optimum range for goodput, and effect of station (STA density per access point (AP in a network. ns-3, an open source network simulator with features supporting 802.11ac, was used to perform the simulation. Results obtained indicate that very high data rates are achievable. The highest data rate, the best mean delay, and mean jitter are possible under combined features of 802.11ac (MIMO and A-MPDU.
Effect of Pretreatment with Sulfuric Acid on Catalytic Hydrocracking of Fe/AC Catalysts
Directory of Open Access Journals (Sweden)
Ruiyu Wang
2017-01-01
Full Text Available Activated carbon (AC was modified by H2SO4 and used as a support for catalyst. The Fe2S3/AC-T catalyst was prepared by deposition-precipitation method and used to catalyze hydrocracking of coal-related model compound, di(1-naphthylmethane (DNM. The properties of catalyst were studied by N2 adsorption-desorption, X-ray diffraction, and scanning electron microscopy. The result showed that ferric sulfate and acidic centers had synergetic effect on hydrocracking of DNM when using Fe2S3/AC-T as catalyst, the optimal loading of Fe is 9 wt.%. Hydroconversion of the extraction residue from Guizhou bituminous coal was also studied using Fe2S3/AC-T as the catalyst. The reaction was conducted in cyclohexane under 0.8 Mpa of initial hydrogen pressure at 310°C. The reaction mixture was extracted with petroleum ether and analyzed by GC/MS. Amounts of organic compounds which fall into the categories of homologues of benzene and naphthalene were detected. It suggested that the catalyst could effectively catalyze the cleavage of C-C-bridged bonds.
On the dynamics of cylindrical z-pinch
International Nuclear Information System (INIS)
Solov'ev, L.S.
1984-01-01
The stationary configurations of cylindrical plasma flow in the framework of two-liquid relativistic electromagnetic gas dynamics (REMG)) and nonlinear radial oscillations of the plasma cylinder with longitudinal current in the framework of classical monoliquid MGD are considered. It is shown that at sufficiently high conductivity Z-pinch is stable relative to one-dimensional radial perturbations and its motion represents respectively nonlinear radial oscillations. In case of a rather low conductivity or low particle concentration there is in cross section a stability also in relation to the development of sausage type instability. The performed investigations of cylindrical equilibrium and radial oscillations give a qualitative representation on plasma behaviour in Z-pinch at the initial stage of it compression and expansion as well as on motion in an average plane of the developing sausage type instability
A novel three-axis cylindrical hohlraum designed for inertial confinement fusion ignition
Kuang, Longyu; Li, Hang; Jing, Longfei; Lin, Zhiwei; Zhang, Lu; Li, Liling; Ding, Yongkun; Jiang, Shaoen; Liu, Jie; Zheng, Jian
2016-10-01
A novel ignition hohlraum for indirect-drive inertial confinement fusion is proposed, which is named three-axis cylindrical hohlraum (TACH). TACH is a kind of 6 laser entrance holes (LEHs) hohlraum, which is orthogonally jointed of three cylindrical hohlraums. Laser beams are injected through every entrance hole with the same incident angle of 55°. A view-factor simulation result shows that the time-varying drive asymmetry of TACH is less than 1.0% in the whole drive pulse period without any supplementary technology. Coupling efficiency of TACH is close to that of 6 LEHs spherical hohlraum with corresponding size. Its plasma-filling time is close to that of typical cylindrical ignition hohlraum. Its laser plasma interaction has as low backscattering as the outer cone of the cylindrical ignition hohlraum. Therefore, TACH combines most advantages of various hohlraums and has little predictable risk, providing an important competitive candidate for ignition hohlraum.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Cylindrical collapse and gravitational waves
Energy Technology Data Exchange (ETDEWEB)
Herrera, L [Escuela de FIsica, Faculdad de Ciencias, Universidad Central de Venezuela, Caracas, Venezuela (Venezuela); Santos, N O [Universite Pierre et Marie Curie, CNRS/FRE 2460 LERMA/ERGA, Tour 22-12, 4eme etage, BoIte 142, 4 place Jussieu, 75252 Paris Cedex 05 (France); Laboratorio Nacional de Computacao Cientifica, 25651-070 Petropolis RJ (Brazil); Centro Brasileiro de Pesquisas Fisicas, 22290-180 Rio de Janeiro RJ (Brazil)
2005-06-21
We study the matching conditions for a collapsing anisotropic cylindrical perfect fluid, and we show that its radial pressure is non-zero on the surface of the cylinder and proportional to the time-dependent part of the field produced by the collapsing fluid. This result resembles the one that arises for the radiation-though non-gravitational-in the spherically symmetric collapsing dissipative fluid, in the diffusion approximation.
Visualization of the flow in a cylindrical container with a rotating disk
Imahoko, Ryoki; Kurakata, Hiroki; Sakakibara, Jun
2017-11-01
We studied a behavior of the flow in a cylindrical container with a rotating disk. The apparatus consists of a fixed cylindrical container of the inner diameter of 140 mm and height H, and a coaxial rotating disc with a diameter of 140 mm connected with a cylindrical shaft driven by an electrical motor. The radial gap between rotating disk and side wall is very slight distance. The height H is variable up to 100 mm. The velocity distribution in the container was measured by means of particle image velocimetry (PIV). The results of this experiments will be discussed at the conference.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Shear stresses around circular cylindrical openings
Hoogenboom, P.C.J.; Van Weelden, C.; Blom, C.M.B.
2010-01-01
In this paper stress concentrations are studied around circular cylindrical openings or voids in a linear elastic continuum. The loading is such that a uniform shear stress occurs in the continuum, which is disturbed by the opening. The shear stress is in the direction of the centre axis of the
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Study on magnetic field mapping within cylindrical center volume of general magnet
Energy Technology Data Exchange (ETDEWEB)
Huang, Li; Lee, Sang Jin [Uiduk University, Gyeongju (Korea, Republic of)
2016-06-15
For the magnetic field analysis or design, it is important to know the behavior of the magnetic field in an interesting space. Magnetic field mapping becomes a useful tool for the study of magnetic field. In this paper, a numerical way for mapping the magnetic field within the cylindrical center volume of magnet is presented, based on the solution of the Laplace's equation in the cylindrical coordinate system. The expression of the magnetic field can be obtained by the magnetic flux density, which measured in the mapped volume. According to the form of the expression, the measurement points are arranged with the parallel cylindrical line (PCL) method. As example, the magnetic flux density generated by an electron cyclotron resonance ion source (ECRIS) magnet and a quadrupole magnet were mapped using the PCL method, respectively. The mapping results show the PCL arrangement method is feasible and convenience to map the magnetic field within a cylindrical center volume generated by the general magnet.
Cylindrical acoustic levitator/concentrator having non-circular cross-section
Kaduchak, Gregory; Sinha, Dipen N.
2003-11-11
A low-power, inexpensive acoustic apparatus for levitation and/or concentration of aerosols and small liquid/solid samples having particulates up to several millimeters in diameter in air or other fluids is described. It is constructed from a commercially available, hollow piezoelectric crystal which has been formed with a cylindrical cross-section to tune the resonance frequency of the breathing mode resonance of the crystal to that of the interior cavity of the cylinder. When the resonance frequency of the interior cylindrical cavity is matched to the breathing mode resonance of the cylindrical piezoelectric transducer, the acoustic efficiency for establishing a standing wave pattern in the cavity is high. By deforming the circular cross-section of the transducer, the acoustic force is concentrated along axial regions parallel to the axis of the transducer. The cylinder does not require accurate alignment of a resonant cavity. The concentrated regions of acoustic force cause particles in the fluid to concentrate within the regions of acoustic force for separation from the fluid.
Free and Forced Vibrations of Thick-Walled Anisotropic Cylindrical Shells
Marchuk, A. V.; Gnedash, S. V.; Levkovskii, S. A.
2017-03-01
Two approaches to studying the free and forced axisymmetric vibrations of cylindrical shell are proposed. They are based on the three-dimensional theory of elasticity and division of the original cylindrical shell with concentric cross-sectional circles into several coaxial cylindrical shells. One approach uses linear polynomials to approximate functions defined in plan and across the thickness. The other approach also uses linear polynomials to approximate functions defined in plan, but their variation with thickness is described by the analytical solution of a system of differential equations. Both approaches have approximation and arithmetic errors. When determining the natural frequencies by the semi-analytical finite-element method in combination with the divide and conqure method, it is convenient to find the initial frequencies by the finite-element method. The behavior of the shell during free and forced vibrations is analyzed in the case where the loading area is half the shell thickness
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Investigation on Surface Roughness in Cylindrical Grinding
Rudrapati, Ramesh; Bandyopadhyay, Asish; Pal, Pradip Kumar
2011-01-01
Cylindrical grinding is a complex machining process. And surface roughness is often a key factor in any machining process while considering the machine tool or machining performance. Further, surface roughness is one of the measures of the technological quality of the product and is a factor that greatly influences cost and quality. The present work is related to some aspects of surface finish in the context of traverse-cut cylindrical grinding. The parameters considered have been: infeed, longitudinal feed and work speed. Taguchi quality design is used to design the experiments and to identify the significantly import parameter(s) affecting the surface roughness. By utilization of Response Surface Methodology (RSM), second order differential equation has been developed and attempts have also been made for optimization of the process in the context of surface roughness by using C- programming.
Acoustic characteristics of sand sediment with circular cylindrical pores
International Nuclear Information System (INIS)
Roh, Heui-Seol; Lee, Kang-Il; Yoon, Suk-Wang
2004-01-01
The acoustic pressure transmission coefficient and the phase velocity are experimentally measured as functions of the frequency and the porosity in sand sediment slabs with circular cylindrical pores filled with water and air. They are also theoretically estimated with the modified Biot-Attenborough (MBA) model, which uses a separate treatment of the viscous and the thermal effects in a non-rigid porous medium with water- and air-filled cylindrical pores. In this study, the fast (first kind) wave and the slow (second kind) wave are not separated in the transmitted signals through a sediment slab without the circular cylindrical pores, but they are separated in the transmitted signals through a sediment slab with pores. Both the phase velocities and the transmission coefficients of the fast wave and the slow wave in the sediment slabs with water- and air-filled cylindrical pores are sensitive to the air and the water porosities. It is proposed that the fast and the slow waves have opposite behaviors for several acoustic characteristics. The generalized tortuosity factor and the dynamic shape factor are introduced from the acoustic characteristics of the fast wave. The experimental results show reasonable agreement with the theoretical results estimated with the MBA model. These results suggest the possibility of predicting the acoustic characteristics of a sediment as functions of arbitrary water and air porosities. This study may also be applicable to understanding acoustic wave propagations in a bubbly liquid sediment for underwater applications and in cancellous bone for the diagnosis of osteoporosis.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Plasma waves in an inhomogeneous cylindrical plasma
International Nuclear Information System (INIS)
Pesic, S.S.
1976-01-01
The complete dispersion equation governing small amplitude plasma waves propagating in an inhomogeneous cylindrical plasma confined by a helical magnetic field is solved numerically. The efficiency of the wave energy thermalization in the lower hybrid frequency range is studied
Penetration of sub-micron aerosol droplets in composite cylindrical filtration elements
International Nuclear Information System (INIS)
Geurts, Bernard J.; Pratte, Pascal; Stolz, Steffen; Stabbert, Regina; Poux, Valerie; Nordlund, Markus; Winkelmann, Christoph
2011-01-01
Advection-diffusion transport of aerosol droplets in composite cylindrical filtration elements is analyzed and compared to experimental data. The penetration, characterizing the fraction of droplets that passes through the pores of a filtration element, is quantified for a range of flow rates. The advection-diffusion transport in a laminar Poiseuille flow is treated numerically for slender pores using a finite difference approach in cylindrical coordinates. The algebraic dependence of the penetration on the Peclet number as predicted theoretically, is confirmed by experimental findings at a variety of aspect ratios of the cylindrical pores. The effective penetration associated with a composite filtration element consisting of a set of parallel cylindrical pores is derived. The overall penetration of heterogeneous composite filtration elements shows an algebraic dependence to the fourth power on the radii of the individual pores that are contained. This gives rise to strong variations in the overall penetration in cases with uneven distributions of pore sizes, highly favoring filtration by the larger pores. The overall penetration is computed for a number of basic geometries, providing a point of reference for filtration design and experimental verification.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Energy corrections in pulsed neutron measurements for cylindrical geometry
International Nuclear Information System (INIS)
Drozdowicz, K.; Woznicka, U.
1982-01-01
A solution of the thermal neutron diffusion equation for a two-region concentric cylindrical system, with a constant neutron flux in the inner medium assumed, is given. The velocity-averaged dynamic parameters for thermal neutrons are used in the method. The corrections due to the diffusion cooling are introduced into the dynamic material buckling and into the velocity distribution of the thermal neutron flux. Detailed relations obtained for a hydrogenous moderator are given. Results of the measurements of the thermal neutron macroscopic absorption cross-sections for the samples in the two-region cylindrical systems are presented. (author)
Spherical and cylindrical particle resonator as a cloak system
Minin, I. V.; Minin, O. V.; Eremeev, A. I.; Tseplyaev, I. S.
2018-05-01
The concept of dielectric spherical or cylindrical particle in resonant mode as a cloak system is offered. In fundamental modes (modes with the smallest volume correspond to |m| = l, and s = 1) the field is concentrated mostly in the equatorial plane and at the surface of the sphere. Thus under resonance modes, such perturbation due to cuboid particle inserted in the spherical or cylindrical particle has almost no effect on the field forming resonance regardless of the value of internal particle material (defect) as long as this material does not cover the region where resonance takes place.
Gravitational collapse of a cylindrical null shell in vacuum
Directory of Open Access Journals (Sweden)
S. Khakshournia
2008-03-01
Full Text Available Barrabès-Israel null shell formalism is used to study the gravitational collapse of a thin cylindrical null shell in vacuum. In general the lightlike matter shell whose history coincides with a null hypersurface is characterized by a surface energy density. In addition, a gravitational impulsive wave is present on this null hypersurface whose generators admit both the shear and expansion. In the case of imposing the cylindrical flatness the surface energy-momentum tensor of the matter shell on the null hypersurface vanishes and the null hyper- surface is just the history of the gravitational wave .
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Gauthier, Robert C.; Alzahrani, Mohammed A.; Jafari, Seyed Hamed
2014-10-01
It has recently been experimentally demonstrated that slot channel waveguides, configured in cylindrical space, can support high azimuthal order modes similar to whispering-gallery modes. This paper presents a mode solver based on Maxwell's vector wave equation for the electric field cast into an eigenvalue problem using a Fourier-Bessel basis function space. The modal frequencies and field profiles of the high azimuthal order slot-channel-whispering-gallery (SCWG) modes are computed for a set of nanometer spaced silicon rings supported by oxide. The computations show, that in addition to the traditionally observed, lowest order mode, the structure may support higher order SCWG modes. We complete the analysis by computing structures response as an ambient medium index of refraction sensor which achieves over 400 nm per RIU sensitivity.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Errors due to the cylindrical cell approximation in lattice calculations
Energy Technology Data Exchange (ETDEWEB)
Newmarch, D A [Reactor Development Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)
1960-06-15
It is shown that serious errors in fine structure calculations may arise through the use of the cylindrical cell approximation together with transport theory methods. The effect of this approximation is to overestimate the ratio of the flux in the moderator to the flux in the fuel. It is demonstrated that the use of the cylindrical cell approximation gives a flux in the moderator which is considerably higher than in the fuel, even when the cell dimensions in units of mean free path tend to zero; whereas, for the case of real cells (e.g. square or hexagonal), the flux ratio must tend to unity. It is also shown that, for cylindrical cells of any size, the ratio of the flux in the moderator to flux in the fuel tends to infinity as the total neutron cross section in the moderator tends to zero; whereas the ratio remains finite for real cells. (author)
A Novel Automated Method for Analyzing Cylindrical Computed Tomography Data
Roth, D. J.; Burke, E. R.; Rauser, R. W.; Martin, R. E.
2011-01-01
A novel software method is presented that is applicable for analyzing cylindrical and partially cylindrical objects inspected using computed tomography. This method involves unwrapping and re-slicing data so that the CT data from the cylindrical object can be viewed as a series of 2-D sheets in the vertical direction in addition to volume rendering and normal plane views provided by traditional CT software. The method is based on interior and exterior surface edge detection and under proper conditions, is FULLY AUTOMATED and requires no input from the user except the correct voxel dimension from the CT scan. The software is available from NASA in 32- and 64-bit versions that can be applied to gigabyte-sized data sets, processing data either in random access memory or primarily on the computer hard drive. Please inquire with the presenting author if further interested. This software differentiates itself in total from other possible re-slicing software solutions due to complete automation and advanced processing and analysis capabilities.
Electrostatic resonances and optical responses of cylindrical clusters
International Nuclear Information System (INIS)
Choy, C W; Xiao, J J; Yu, K W
2008-01-01
We developed a Green function formalism (GFF) for computing the electrostatic resonance in clusters of cylindrical particles. In the GFF, we take advantage of a surface integral equation to avoid matching the complicated boundary conditions on the surfaces of the particles. Numerical solutions of the eigenvalue equation yield a pole spectrum in the spectral representation. The pole spectrum can in turn be used to compute the optical response of these particles. For two cylindrical particles, the results are in excellent agreement with the exact results from the multiple image method and the normal mode expansion method. The results of this work can be extended to investigate the enhanced nonlinear optical responses of metal-dielectric composites, as well as optical switching in plasmonic waveguides.
Sealed rotary hearth furnace with central bearing support
Docherty, James P.; Johnson, Beverly E.; Beri, Joseph
1989-01-01
The furnace has a hearth which rotates inside a stationary closed chamber and is supported therein on vertical cylindrical conduit which extends through the furnace floor and is supported by a single center bearing. The charge is deposited through the furnace roof on the rim of the hearth as it rotates and is moved toward the center of the hearth by rabbles. Externally generated hot gases are introduced into the furnace chamber below the hearth and rise through perforations in the hearth and up through the charge. Exhaust gases are withdrawn through the furnace roof. Treated charge drops from a center outlet on the hearth into the vertical cylindrical conduit which extends downwardly through the furnace floor to which it is also sealed.
Cracking of anisotropic cylindrical polytropes
Energy Technology Data Exchange (ETDEWEB)
Mardan, S.A. [University of the Management and Technology, Department of Mathematics, Lahore (Pakistan); Azam, M. [University of Education, Division of Science and Technology, Lahore (Pakistan)
2017-06-15
We study the appearance of cracking in charged anisotropic cylindrical polytropes with generalized polytropic equation. We investigate the existence of cracking in two different kinds of polytropes existing in the literature through two different assumptions: (a) local density perturbation with conformally flat condition, and (b) perturbing polytropic index, charge and anisotropy parameters. We conclude that cracking appears in both kinds of polytropes for a specific range of density and model parameters. (orig.)
Method of dismantling cylindrical structure by cutting
International Nuclear Information System (INIS)
Harada, Minoru; Mitsuo, Kohei; Yokota, Isoya; Nakamura, Kenjiro.
1989-01-01
This invention concerns a method of cutting and removing cylindrical structures, for example, iron-reinforced concrete materials such as thermal shielding walls in BWR type power plants into block-like form. That is, in a method of cutting and removing the cylindrical structure from the side of the outer wall, the structural material is cut from above to below successively in the axial direction and the circumferential direction by means abrasive jet by remote operation and cut into blocks each of a predetermined size. The cut out blocks are successively taken out. Cutting of the material from above to below by remote operation and taking out of small blocks causes no hazards to human body. Upon practicing the present invention, it is preferred to use a processing device for slurry and exhaust gases for preventing scattering of activated dismantled pieces or powdery dusts. (K.M.)
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
A mathematical model of microalgae growth in cylindrical photobioreactor
Bakeri, Noorhadila Mohd; Jamaian, Siti Suhana
2017-08-01
Microalgae are unicellular organisms, which exist individually or in chains or groups but can be utilized in many applications. Researchers have done various efforts in order to increase the growth rate of microalgae. Microalgae have a potential as an effective tool for wastewater treatment, besides as a replacement for natural fuel such as coal and biodiesel. The growth of microalgae can be estimated by using Geider model, which this model is based on photosynthesis irradiance curve (PI-curve) and focused on flat panel photobioreactor. Therefore, in this study a mathematical model for microalgae growth in cylindrical photobioreactor is proposed based on the Geider model. The light irradiance is the crucial part that affects the growth rate of microalgae. The absorbed photon flux will be determined by calculating the average light irradiance in a cylindrical system illuminated by unidirectional parallel flux and considering the cylinder as a collection of differential parallelepipeds. Results from this study showed that the specific growth rate of microalgae increases until the constant level is achieved. Therefore, the proposed mathematical model can be used to estimate the rate of microalgae growth in cylindrical photobioreactor.
Resonant Excitation of a Truncated Metamaterial Cylindrical Shell by a Thin Wire Monopole
DEFF Research Database (Denmark)
Kim, Oleksiy S.; Erentok, Aycan; Breinbjerg, Olav
2009-01-01
A truncated metamaterial cylindrical shell excited by a thin wire monopole is investigated using the integral equation technique as well as the finite element method. Simulations reveal a strong field singularity at the edge of the truncated cylindrical shell, which critically affects the matching...
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Design of a cylindrical LED substrate without radiator
Tang, Fan; Guo, Zhenning
2017-12-01
To reduce the weight and production costs of light-emitting diode (LED) lamps, we applied the principle of the chimney effect to design a cylindrical LED substrate without a radiator. We built a 3D model by using Solidworks software and applied the flow simulation plug-in to conduct model simulation, thereby optimizing the heat source distribution and substrate thickness. The results indicate that the design achieved optimal cooling with a substrate with an upper extension length of 35 mm, a lower extension length of 8 mm, and a thickness of 1 mm. For a substrate of those dimensions, the highest LED chip temperature was 64.78 °C, the weight of the substrate was 35.09 g, and R jb = 7.00 K/W. If the substrate is powered at 8, 10, and 12 W, its temperature meets LED safety requirements. In physical tests, the highest temperature for a physical 8 W cylindrical LED substrate was 66 °C, which differed by only 1.22 °C from the simulation results, verifying the validity of the simulation. The designed cylindrical LED substrate can be used in high-power LED lamps that do not require radiators. This design is not only excellent for heat dissipation, but also for its low weight, low cost, and simplicity of manufacture.
Cylindrical polymer brushes with dendritic side chains by iterative anionic reactions
Zhang, Hefeng
2015-05-01
We report in this paper an easy method for the synthesis of cylindrical polymer brushes with dendritic side chains through anionic reaction. The synthesis is accomplished by iteratively grafting a living block copolymer, polyisoprene-. b-polystyrenyllithium (PI-. b-PSLi), to the main chain and subsequently to the branches in a divergent way. PI segment is short and serves as a precursor for multifunctional branching unit. The grafting reaction involves two successive steps: i) epoxidation of internal double bonds of PI segments, either in main chain or side chains; ii) ring-opening addition to the resulting epoxy group by the living PI-. b-PSLi. Repeating the two steps affords a series of cylindrical polymer brushes with up to 3rd generation and extremely high molecular weight. The branching multiplicity depends on the average number of oxirane groups per PI segment, usually ca. 8 in the present work. The high branching multiplicity leads to tremendous increase in molecular weights of the cylindrical products with generation growth. Several series of cylindrical polymer brushes with tunable aspect ratios are prepared using backbones and branches with controlled lengths. Shape anisotropy is investigated in dilute solution using light scattering technique. Worm-like single molecular morphology with large persistence length is observed on different substrates by atomic force microscopy.
Experiments on cylindrically converging blast waves in atmospheric air
Matsuo, Hideo; Nakamura, Yuichi
1980-06-01
Cylindrically converging blast waves have been produced in normal atmospheric conditions by the detonation of the explosives, pentaerythritoltetranitrate, (PETN), over cylindrical surfaces. The shocks generated in this way are so strong that the fronts propagating through the air become luminous of themselves. The production and the propagation of the shocks have been monitored with a framing camera and a streak camera, and the time-space relations of the shock propagations have been determined using an electrical ionization probing system. The results have shown that the trajectory of the shock fronts near the axis of the cylinder can be approximately represented by the Guderley's formula.
Metallurgical Evaluation of the Five-Inch Cylindrical Induction Melter
International Nuclear Information System (INIS)
Imrich, K.J.
2000-01-01
A metallurgical evaluation of the 5-inch cylindrical induction melter (CIM) vessel was performed by the Materials Technology Section to evaluate the metallurgical condition after operating for approximately 375 hours at 1400 to 1500 Degrees Celsius during a 2 year period. Results indicate that wall thinning and significant grain growth occurred in the lower portion of the conical section and the drain tube. No through-wall penetrations were found in the cylindrical and conical sections of the CIM vessel and only one leak site was identified in the drain tube. Failure of the drain tube was associated with a localized over heating and intercrystalline fracture
Dynamics of charged viscous dissipative cylindrical collapse with full causal approach
Energy Technology Data Exchange (ETDEWEB)
Shah, S.M.; Abbas, G. [The Islamia University of Bahawalpur, Department of Mathematics, Bahawalpur (Pakistan)
2017-11-15
The aim of this paper is to investigate the dynamical aspects of a charged viscous cylindrical source by using the Misner approach. To this end, we have considered the more general charged dissipative fluid enclosed by the cylindrical symmetric spacetime. The dissipative nature of the source is due to the presence of dissipative variables in the stress-energy tensor. The dynamical equations resulting from such charged cylindrical dissipative source have been coupled with the causal transport equations for heat flux, shear and bulk viscosity, in the context of the Israel-Steward theory. In this case, we have the considered Israel-Steward transportation equations without excluding the thermodynamics viscous/heat coupling coefficients. The results are compared with the previous works in which such coefficients were excluded and viscosity variables do not satisfy the casual transportation equations. (orig.)
International Nuclear Information System (INIS)
Zabow, G; Dodd, S J; Koretsky, A P; Moreland, J
2009-01-01
A new form of tunable magnetic resonance imaging agent based on precisely dimensioned cylindrical magnetic nanoshells is introduced. Using top-down prepatterned substrates, the nanoshells are fabricated by exploiting what is usually regarded as a detrimental processing side-effect, namely the redeposition of material back-sputtered during ion-milling. The well-resolved nuclear magnetic resonance peaks of the resulting nanostructures attest to the nanoscale fabrication control and the general feasibility of such sputter redeposition for fabrication of a variety of self-supporting, highly monodisperse nanoscale structures.
Power control of a wind farm with active stall wind turbines and AC grid connection
DEFF Research Database (Denmark)
Hansen, Anca Daniela; Sørensen, Poul; Iov, Florin
both the control on wind turbine level as well as the central control on the wind farm level. The ability of active stall wind farms with AC grid connection to regulate the power production to the reference power ordered by the operators is assessed and discussed by means of simulations.......This paper describes the design of a centralised wind farm controller for a wind farm made-up exclusively of active stall wind turbines with AC grid connection. The overall aim of such controller is to enable the wind farms to provide the best grid support. The designed wind farm control involves...
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Digital image processing: Cylindrical surface plane development of CAREM fuel pellets
International Nuclear Information System (INIS)
Caccavelli, J; Cativa Tolosa, S; Gommes, C
2012-01-01
As part of the development of fuel pellets (FPs) for nuclear reactor CAREM-25, is necessary to systematize the analysis of the mechanical integrity of the FPs that is now done manually by a human operator. Following specifications and standards of reference for this purpose, the FPs should be inspected visually for detecting material discontinuities in the FPs surfaces to minimize any deterioration, loss of material and excessive breakage during operation and load of fuel bars. The material discontinuities are classified into two defects: surface cracks and chips. For each of these surface defects exist acceptance criteria that determine if the fuel pellet (FP) as a whole is accepted or rejected. One criteria for surface cracks is that they do not exceed one third (1/3) of the circumferential surface of the FP. The FP has cylindrical shape, so some of these acceptance criteria make difficult to analyze the FP in a single photographic image. Depending on the axial rotation of the FP, the crack could not be entirely visualized on the picture frame. Even a single crack that appears in different parts of the FP rotated images may appear to be different cracks in the FP when it is actually one. For this reason it is necessary, for the automatic detection and measurement of surface defects, obtain the circumferential surface of the FP into a single image in order to decide the acceptance or reject of the FP. As the FP shape is cylindrical, it is possible to obtain the flat development of the cylindrical surface (surface unrolling) of the FPs into a single image combining the image set of the axial rotation of the FP. In this work, we expose the procedure to implement the flat development of the cylindrical surface (surface unrolling). Starting from a photographic image of the FP surface, which represents the projection of a cylinder in the plane, we obtain three-dimensional information of each point on the cylindrical surface of the FP (3D-mapping). Then, we can
Technical progress report, Contracts DE-AC02-81ER40014, 40015 and 40016
International Nuclear Information System (INIS)
1981-01-01
This Progress Report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1980 through July 31, 1981, under contracts between the University of Colorado and the United States Department of Energy. The shorter report period of nine months is due to a change to an earlier submission date this year for our proposal for support to begin February 1, 1982. Cyclotron operation, research, and development have been supported under contract DE-AC02-81ER40014. The AVF cyclotron has continued to provide reliable and versatile beams of protons, deuterons, 3 He and 4 He. A wide variety of research results in direct reactions, nuclear structure, and compound reaction mechanisms can be noted in this Progress Report, correlated in many cases to current problems in intermediate energy physics. Theoretical work on nuclear reactions, carried out under contract DE-AC02-81ER40015, has been well matched to our experimental programs in low and intermediate energy physics. One important result has been the recasting of the DWBA in an eikonal expansion suited to high energy reactions. Our efforts in intermediate energy physics, under contract DE-AC02-81ER40016, have emphasized pion scattering studies at LAMPF and TRIUMF and proton induced charge exchange reactions at IUCF. Data for an important test of hadronic charge symmetry have been completed at two energies, using elastic pion-deuteron scattering
Ion currents to cylindrical Langmuir probes for finite ion temperature values: Theory
International Nuclear Information System (INIS)
Ballesteros, J.; Palop, J.I.F.; Colomer, V.; Hernandez, M.A.
1995-01-01
As it is known, the experimental ion currents to a cylindrical Langmuir probe fit quite well to the radial motion theory, developed by Allen, Boyd and Reynolds (ABR Model) and generalized by Chen for the cylindrical probe case. In this paper, we are going to develop a generalization of the ABR theory, taking into account the influence of a finite ion temperature value
Evolution of transverse instability in a hollow cylindrical weakly-ionized plasma column
International Nuclear Information System (INIS)
Kuedyan, H.M.
1978-01-01
Having observed formation of plasma striations in an Electron Cyclotron Resonance Heating (ECRH) device, we have studied the conditions under which the hollow cylindrical plasma columns would develop into striations. We first present the observed conditions of the hollow cylindrical plasma which would develop into plasma striations, the measured characteristics of the transverse oscillations and a simple small signal model for a transverse instability in a weakly-ionized hollow cylindrical plasma. This linearized model, which assumes flowing cold ion fluid (T/sub i/ approximately < 0.1 eV) in warm electron fluid (T/sub e/ approximately 1 eV) and background neutrals, reveals a transverse flute-type electrostatic instability whose characteristics are in qualitative and quantitative agreement with the measured values of the oscillations in our experiment
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Fabrication technology for a series of cylindrical thin-wall cavity targets
Zheng Yong; Sun Zu Oke; Wang Ming Da; Zhou La; Zhou Zhi Yun
2002-01-01
Cylindrical thin-wall cavity targets have been fabricated to study the behavior of superthermal electrons and their effects on inertial confinement fusion (ICF). Self-supporting cavity targets having adjustable, uniform wall thickness, and low surface roughness were required. This required production of high-quality mandrels, coating them by sputtering or electroplating, developing techniques for measurement of wall thickness and other cavity parameters, improving the uniformity of rotation of the mandrels, and preventing damage to the targets during removal from the mandrels. Details of the fabrication process are presented. Experimental results from the use of these targets are presented. These results, in good agreement with simulations, indicate that the use of thin-wall cavity targets is an effective method for studying superthermal electrons in ICF.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
An investigation on cylindrical imploding turbulent mixing
International Nuclear Information System (INIS)
Liao Haidong; Yang Libin; Zhang Xilin; Ouyang Kai; Li Jun
2001-01-01
The interfacial instability experiments in cylindrically convergent geometry are performed by imploding jelly liner with high pressure gases; and instability growth were observed with high-speed framing camera. The relevant 2D numerical simulation programs were developed and their results are in good agreement with those of experiments
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Numerical determination of transmission probabilities in cylindrical geometry
International Nuclear Information System (INIS)
Queiroz Bogado Leite, S. de.
1989-11-01
Efficient methods for numerical calculation of transmission probabilities in cylindrical geometry are presented. Relative errors of the order of 10 -5 or smaller are obtained using analytical solutions and low order quadrature integration schemes. (author) [pt
Quasi-cylindrical wave contribution in experiments on extraordinary optical transmission.
van Beijnum, Frerik; Rétif, Chris; Smiet, Chris B; Liu, Haitao; Lalanne, Philippe; van Exter, Martin P
2012-12-20
A metal film perforated by a regular array of subwavelength holes shows unexpectedly large transmission at particular wavelengths, a phenomenon known as the extraordinary optical transmission (EOT) of metal hole arrays. EOT was first attributed to surface plasmon polaritons, stimulating a renewed interest in plasmonics and metallic surfaces with subwavelength features. Experiments soon revealed that the field diffracted at a hole or slit is not a surface plasmon polariton mode alone. Further theoretical analysis predicted that the extra contribution, from quasi-cylindrical waves, also affects EOT. Here we report the experimental demonstration of the relative importance of surface plasmon polaritons and quasi-cylindrical waves in EOT by considering hole arrays of different hole densities. From the measured transmission spectra, we determine microscopic scattering parameters which allow us to show that quasi-cylindrical waves affect EOT only for high densities, when the hole spacing is roughly one wavelength. Apart from providing a deeper understanding of EOT, the determination of microscopic scattering parameters from the measurement of macroscopic optical properties paves the way to novel design strategies.
Lai, Changliang; Wang, Junbiao; Liu, Chuang
2014-10-01
Six typical composite grid cylindrical shells are constructed by superimposing three basic types of ribs. Then buckling behavior and structural efficiency of these shells are analyzed under axial compression, pure bending, torsion and transverse bending by finite element (FE) models. The FE models are created by a parametrical FE modeling approach that defines FE models with original natural twisted geometry and orients cross-sections of beam elements exactly. And the approach is parameterized and coded by Patran Command Language (PCL). The demonstrations of FE modeling indicate the program enables efficient generation of FE models and facilitates parametric studies and design of grid shells. Using the program, the effects of helical angles on the buckling behavior of six typical grid cylindrical shells are determined. The results of these studies indicate that the triangle grid and rotated triangle grid cylindrical shell are more efficient than others under axial compression and pure bending, whereas under torsion and transverse bending, the hexagon grid cylindrical shell is most efficient. Additionally, buckling mode shapes are compared and provide an understanding of composite grid cylindrical shells that is useful in preliminary design of such structures.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Advantages of Square-Root Extended Kalman Filter for Sensorless Control of AC Drives
Czech Academy of Sciences Publication Activity Database
Šmídl, Václav; Peroutka, Z.
2012-01-01
Roč. 59, č. 11 (2012), s. 4189-4196 ISSN 0278-0046 Institutional research plan: CEZ:AV0Z10750506 Institutional support: RVO:67985556 Keywords : Kalman filters * Mathematical model * AC motors Subject RIV: BC - Control Systems Theory Impact factor: 5.165, year: 2012 http://library.utia.cas.cz/separaty/2012/AS/smidl-0436868.pdf
Design algorithm for generatrix profile of cylindrical crowned rollers
Directory of Open Access Journals (Sweden)
Creţu Spiridon
2017-01-01
Full Text Available The cross-section of roller profile controls the pressure distribution in the contact area and radically affects the roller bearings basic dynamic load rating and rating lives. Today the most used roller profiles are the logarithmic profile and cylindrical-crowned (ZB profile. The logarithmic profile has a continuous evolution with no discontinuities till the intersection with the end fillet while ZB profile has two more discontinuities at the intersections points between the crowning circle and straight line generatrix. Using a semianalytical method, a numerical study has been carried out to find the optimum ZB profile for rollers incorporated in cylindrical rollers bearings. The basic reference rating life (L10_r has been used as optimization criterion.
Improved nuclear reactor construction with bottom supported reactor vessel
International Nuclear Information System (INIS)
Sharbaugh, J.E.
1987-01-01
An improved liquid metal nuclear reactor construction has a reactor core and a generally cylindrical reactor vessel for holding liquid metal coolant and housing the core within the pool. A generally cylindrical concrete containment structure surrounds the reactor vessel and a central support pedestal is anchored to the containment structure base mat and supports the bottom wall of the reactor vessel and the reactor core. The periphery of the reactor vessel bore is supported by an annular structure which allows thermal expansion but not seismic motion of the vessel, and a bed of thermally insulating material uniformly supports the vessel base whilst allowing expansion thereof. A guard ring prevents lateral seismic motion of the upper end of the reactor vessel. The periphery of the core is supported by an annular structure supported by the vessel base and keyed to the vessel wall so as to be able to expand but not undergo seismic motion. A deck is supported on the containment structure above the reactor vessel open top by annular bellows, the deck carrying the reactor control rods such that heating of the reactor vessel results in upward expansion against the control rods. (author)
Consultation performance of general practitioners when supported by an asthma/COPDC-service
Directory of Open Access Journals (Sweden)
Annelies Lucas EM
2012-07-01
Full Text Available Abstract Background General practitioners (GPs can refer patients to an asthma/COPD service (AC-service for diagnostic assessment of spirometry and medical history and for asthma or COPD monitoring. The AC-service reports diagnostic results and additional information about disease burden (BORG-score for complaints, MRC-dyspnoea score, exacerbation rate, life style, medication and compliance, to the patient’s GP. This study explores how GPs use this additional information when discussing the patient’s disease burden and how this influences GPs’ information and education provision during consultations with asthma/COPD patients. Method Patients with (a suspicion of asthma or COPD were referred to an AC-service and consulted their GPs after they had received a report from the AC-service. Retrospectively patients answered questions about their GPs’ performance during these consultations. Performances were compared with performances of the same GPs during consultations without support of the AC-service (usual care, earlier that year. Results Of consultations not initiated by an AC-service check-up, 91% focussed on complaints, the initial reason for the consultation. In AC-service supported follow-up consultations, GPs explored disease burden when the (BORG-score for complaints was high - as reported by the AC-service - even when patients themselves thought it was irrelevant. GPs put significantly less effort in exploring disease burden when the Borg-score was low (BORG 3–4: 69%; BORG1-2: 51%, p = 0,01. GPs mostly ignored MRC-dyspnoea scores: attention to dyspnoea was 18% for MRC-score p = 0,63. GPs encouraged physical fitness in 13% of patients. Smoking behaviour was discussed with 66% of the actual smokers but only 14% remembered a stop smoking advice. Furthermore, pharmacotherapeutic management education in AC-service supported consultations did not differ from performance in usual care according to patient evaluations. Conclusion
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Ac superconducting articles and a method for their manufacture
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1975-01-01
A novel ac superconducting article is described comprising a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface. (auth)
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
International Nuclear Information System (INIS)
Han, Hui; Balcom, Bruce J
2011-01-01
Magnetic resonance imaging (MRI) measurements inside cylindrical metal structures have recently been proposed and form the basis for new high-pressure MRI studies. The critical problem for MRI inside cylindrical metal structures is significant eddy currents induced by the switched magnetic field gradients, which usually corrupt spatial and motion encoding without appropriate correction. In this work a so-called standard SPRITE (single point ramped imaging with T 1 enhancement) technique is applied for imaging inside cylindrical metal structures. We show that the standard SPRITE technique is fundamentally immune to large-scale eddy current effects and yields artifact-free high-quality images with no eddy current correction required. Standard SPRITE image acquisition avoids the complications involved in the measurement and compensation of eddy current effects for MRI with cylindrical metal structures. This work is a substantial advance toward the extension of MRI to new challenging systems, which are of practical importance
Simulation and Visualization of Flows Laden with Cylindrical Nanoparticles in a Mixing Layer
Directory of Open Access Journals (Sweden)
Wenqian Lin
2018-01-01
Full Text Available The motion of cylindrical particles in a mixing layer is studied using the pseudospectral method and discrete particle model. The effect of the Stokes number and particle aspect ratio on the mixing and orientation distribution of cylindrical particles is analyzed. The results show that the rollup of mixing layer drives the particles to the edge of the vortex by centrifugal force. The cylindrical particles with the small Stokes number almost follow fluid streamlines and are mixed thoroughly, while those with the large Stokes number, centrifugalized and accumulated at the edge of the vortex, are poorly mixed. The mixing degree of particles becomes worse as the particle aspect ratio increases. The cylindrical particles would change their orientation under two torques and rotate around their axis of revolution aligned to the vorticity direction when the shear rate is low, while aligning on the flow-gradient plane beyond a critical shear rate value. More particles are oriented with the flow direction, and this phenomenon becomes more obvious with the decrease of the Stokes number and particle aspect ratio.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
Circumferential buckling instability of a growing cylindrical tube
Moulton, D.E.; Goriely, A.
2011-01-01
A cylindrical elastic tube under uniform radial external pressure will buckle circumferentially to a non-circular cross-section at a critical pressure. The buckling represents an instability of the inner or outer edge of the tube. This is a common
A single-electron current in a cylindrical nanolayer
International Nuclear Information System (INIS)
Kazaryan, E.M.; Aghekyan, N.G.; Sarkisyan, H.A.
2012-01-01
The orbital current and the spin magnetic moment current of an electron in a cylindrical nanolayer are investigated. It is shown that under certain conditions, the main contribution to the total current is specified by the spin magnetic moment current
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Full-field peak pressure prediction of shock waves from underwater explosion of cylindrical charges
Liu, Lei; Guo, Rui; Gao, Ke; Zeng, Ming Chao
2017-01-01
Cylindrical charge is a main form in most application of explosives. By employing numerical calculation and an indirect mapping method, the relation between peak pressures from underwater explosion of cylindrical and spherical charges is investigated, and further a model to predict full-field peak
Jafari, Seyed Hamed; Gauthier, Robert C.
2015-02-01
Maxwell's wave equations can be solved using different techniques in order to extract optical properties of a variety of dielectric structures. For structures that contain an extended axis which serve for the reference for cylindrical symmetry, we have shown that an expansion of the fields and inverse of the relative dielectric profile using a simplified and complete set of basis functions of Fourier-Bessel terms provide access to an eigenvalue formulation from which the eigen-states can be computed. We review the steps used to convert Maxwell's equation into an eigenvalue formulation, and then proceed to discuss several applications of the technique. For cylindrically symmetric structures, the computational technique provides a significantly reduced matrix order to be populated. New target structure for the presentation consists of cylindrical space slot channel waveguide in which the channel extends in azimuthal (ϕ) direction. The channel is provided by considering the etching of external side walls of "Bragg fiber". The configuration is similar to a structure that can support whispering-gallery modes, except that the modes highest field locations are within the ambient medium of the channel. Optical properties of this structure can be best examined through ?? field component which is discontinuous by ratio of relative dielectric constants when passing air-Bragg interfaces. The ability to select Bragg dielectric properties and to introduce non-uniformities in Bragg plane spacing provides access to tuning slot channel waveguide properties and design several novel configurations.
Liu, Liyan; Zhang, Yu; Tan, Wei
2014-05-01
Phosphotungstic acid (HPW) supported on activated carbon (AC) was applied to catalyze deep oxidation desulfurization of fuel oil with the assist of ultrasound. The sulfur-conversion rate was evaluated by measuring the concentration of dibenzothiophene (DBT) in n-octane before and after the oxidation. Supporting HPW on AC has been verified to play a positive role in UAOD process by a series of contrast tests, where only HPW, AC or a mixture of free HPW and AC was used. The influences of catalyst dose, ultrasound power, reaction temperature, H2O2:oil volume ratio and the reuse of catalyst on the catalytic oxidation desulfurization kinetics were investigated. The DBT conversion rate of the reaction catalyzed by supported HPW under ultrasound irradiation was higher than the summation of the reactions with HPW only and AC only as catalyst. With the increase of loading amount of HPW on AC, ultrasound power, H2O2:oil volume ratio and reaction temperature, the catalytic oxidation reactivity of DBT would be enhanced. The optimum loading amount of HPW was 10%, exceed which DBT conversion would no longer increase obviously. DBT could be completely converted under the optimized conditions (volume ratio of H2O2 to model oil: 1:10, mass ratio of the supported HPW to model oil: 1.25%, temperature: 70°C) after 9 min of ultrasound irradiation. Copyright © 2013 Elsevier B.V. All rights reserved.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
International Nuclear Information System (INIS)
Lu Junqing; Yang Lin; Yoon, Jae Hong; Cho, Tong Yul; Tao Guoqing
2008-01-01
Severe asymmetry of the metal deposits on the trench sidewalls occurs near the wafer edge during low pressure ionized metal physical vapor deposition of Cu seed layer for microprocessor interconnects. To investigate this process and mitigate the asymmetry, an analytical view factor model based on the analogy between metal sputtering and diffuse thermal radiation was constructed to investigate deposition uniformity and symmetry for cylindrical target sputtering in low pressure (below 0.1 Pa) ionized Cu physical vapor deposition. The model predictions indicate that as the distance from the cylindrical target to wafer increases, the metal film thickness becomes more uniform across the wafer and the asymmetry of the metal deposits at the wafer edge increases significantly. These trends are similar to those for planar targets. To minimize the asymmetry, the height of the cylindrical target should be kept at a minimum. For cylindrical targets, the outward-facing sidewall of the trench could receive more direct Cu fluxes than the inward-facing one when the target to wafer distance is short. The predictions also indicate that increasing the diameter of the cylindrical target could significantly reduce the asymmetry in metal deposits at the wafer edge and make the film thickness more uniform across the wafer
Magnetic guns with cylindrical permanent magnets
Czech Academy of Sciences Publication Activity Database
Vokoun, David; Beleggia, M.; Heller, Luděk
2012-01-01
Roč. 324, č. 9 (2012), s. 1715-1719 ISSN 0304-8853 R&D Projects: GA ČR(CZ) GAP107/11/0391; GA AV ČR IAA100100920 Institutional research plan: CEZ:AV0Z10100520 Keywords : permanent magnet * cylindrical magnet * Earnshaw's theorem * magnetic gun * magnetostatic interaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.826, year: 2012 http://www.sciencedirect.com/science/article/pii/S0304885311008997
Linear antenna of an arbitrary orientation and position in cylindric screen
International Nuclear Information System (INIS)
Prijmenko, S.D.; Papkovich, V.G.; Khizhnyak, N.A.
1991-01-01
An equation of the linear antenna in cylindric screen is formulated. Using the averaging method a solution of this equation for the antenna of arbitrary orientation which does not contact the screen walls or contacts them in one or two ends is received. The obtained asymptotic expression for stream permits to describe in a single manner the case of resonance and non-resonance scattering. These results may be applied in design of UHF and accelerating installations using cylindric screens charged with linear vibrators. 9 refs. (author)
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Friction Compensation in the Upsetting of Cylindrical Test Specimens
DEFF Research Database (Denmark)
Christiansen, Peter; Martins, P. A. F.; Bay, Niels Oluf
2016-01-01
This manuscript presents a combined numerical andexperimental methodology for determining the stress-straincurve of metallic materials from the measurements of forceand displacement obtained in the axial compression of cylindrical test specimens with friction between the specimens and the platens....... The methodology is based on minimizing the errorbetween the average surface pressure obtained from the experimental measurements of the force and displacement and thatobtained from the slab method of analysis of metal plasticity.Three different friction models based on Coulomb friction, the constant friction...... model or combined friction models are utilized .Experimental results obtained from cylindrical and Rastegaev test specimens with different lubricants combined with the experimental determination of friction by means of ring compression tests allows compensating the effect of friction...
Fem Formulation of Heat Transfer in Cylindrical Porous Medium
Azeem; Khaleed, H. M. T.; Soudagar, Manzoor Elahi M.
2017-08-01
Heat transfer in porous medium can be derived from the fundamental laws of flow in porous region ass given by Henry Darcy. The fluid flow and energy transport inside the porous medium can be described with the help of momentum and energy equations. The heat transfer in cylindrical porous medium differs from its counterpart in radial and axial coordinates. The present work is focused to discuss the finite element formulation of heat transfer in cylindrical porous medium. The basic partial differential equations are derived using Darcy law which is the converted into a set of algebraic equations with the help of finite element method. The resulting equations are solved by matrix method for two solution variables involved in the coupled equations.
Performance of cylindrical-conical cyclones with different geometrical configurations
Directory of Open Access Journals (Sweden)
J.D.A.M. Santana
2001-09-01
Full Text Available The present work is a continuation of a study of the influence of geometric characteristics on the performance of reverse-flow cylindrical-conical cyclones. After studying the behavior of the pressure drop in previous work (Arnosti et al., 1998, here performance in terms of collection efficiency in the removal of particulate material is addressed. The independent variables considered in this study were inlet gas velocity (three velocities and the following dimensions of the cyclone: the cylindrical section (three heights and internal height of the gas exit duct (three heights. The tests were performed using an 3³ experimental design. Analysis of the results for overall efficiency was carried out using response surfaces and the statistical parameters were estimated from linear regression.
Energy Technology Data Exchange (ETDEWEB)
Chang Chun; Lian Fei [Key Laboratory of Pollution Process and Environmental Criteria, Ministry of Education, College of Environmental Science and Engineering, Nankai University, Tianjin 300071 (China); Key Laboratory of Urban Ecology Environmental Remediation and Pollution Control, College of Environmental Science and Engineering, Nankai University, Tianjin 300071 (China); Zhu Lingyan, E-mail: zhuly@nankai.edu.cn [Key Laboratory of Pollution Process and Environmental Criteria, Ministry of Education, College of Environmental Science and Engineering, Nankai University, Tianjin 300071 (China); Key Laboratory of Urban Ecology Environmental Remediation and Pollution Control, College of Environmental Science and Engineering, Nankai University, Tianjin 300071 (China)
2011-10-15
Cu amended zero valent iron bimetallic nanoparticles were synthesized by doping Cu on the surface of iron. They were incorporated with granular activated carbon (AC) to prepare supported particles (AC-Fe{sup 0}-Cu), which were used to remove {gamma}-HCH. Cu on the surface of iron enhanced the dechlorination activity of Fe{sup 0}. The dechlorination rate constant (k{sub obs}) increased with the Cu loading on the surface of iron and the maximum was achieved with 6.073% Cu. AC as a support was effective for increasing the dispersion of the nanoparticles and avoiding the agglomeration of the metallic nanoparticles. The simultaneous adsorption of {gamma}-HCH on AC accelerated the degradation rate of {gamma}-HCH by the bimetals. After reaction for 165 min, around 99% of {gamma}-HCH was removed by the solids of AC-Fe{sup 0}-Cu. In addition, AC could adsorb the degradation products. The degradation of {gamma}-HCH was mainly through dehydrochlorination and dichloroelmination based on the intermediate products detected by GC/MS. - Highlights: > Deposition of Cu on the surface of Fe enhances its dechlorination efficiency toward {gamma}-HCH. > Incorporation of the bimetallic nanoparticles with activated carbon (AC) reduces their agglomeration. > AC support increases the contact of {gamma}-HCH with the nanoparticles and enhances the degradation efficiency. > The AC support adsorbs {gamma}-HCH and its degradation products, reducing their ecological risks in water. - Impregnation of Cu amended iron on AC enhances the removal efficiency of {gamma}-HCH and reduces the concentrations of its intermediates in aqueous solution.
Flow-induced vibrations of circular cylindrical structures
International Nuclear Information System (INIS)
Chen, S.
1977-06-01
The problems of flow-induced vibrations of circular cylindrical structures are reviewed. First, the general method of analysis and classification of structural responses are presented. Then, the presentation is broken up along the lines with stationary fluid, parallel flow, and cross flow. Finally, design considerations and future research needs are pointed out. 234 references
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Magnetic forces between arrays of cylindrical permanent magnets
DEFF Research Database (Denmark)
Vokoun, D.; Tomassetti, G.; Beleggia, Marco
2011-01-01
procedures. Here, we introduce analytical expressions for calculating the attraction force between two arrays of cylindrical permanent magnets and compare the predictions with experimental data obtained from force measurements with NdFeB magnets. We show that the difference between predicted and measured...
International Nuclear Information System (INIS)
Goncalves, Glenio Aguiar
2003-01-01
In this work, we are reported analytical solutions for the transport equation for neutral particles in cylindrical and cartesian geometry. For the cylindrical geometry, it is applied the Hankel transform of order zero in the S N approximation of the one-dimensional cylindrical transport equation, assuming azimuthal symmetry and isotropic scattering. This procedure is coined HTSN method. The anisotropic problem is handled using the decomposition method, generating a recursive approach, which the HTSN solution is used as initial condition. For cartesian geometry, the one and two dimensional transport equation is derived in the angular variable as many time as the degree of the anisotropic scattering. This procedure leads to set of integro-differential plus one differential equation that can be really solved by the variable separation method. Following this procedure, it was possible to come out with the Case solution for the one-dimensional problem. Numerical simulations are reported for the cylindrical transport problem both isotropic and anisotropic case of quadratic degree. (author)
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
The magnetic properties of the hollow cylindrical ideal remanence magnet
DEFF Research Database (Denmark)
Bjørk, Rasmus
2016-01-01
We consider the magnetic properties of the hollow cylindrical ideal remanence magnet. This magnet is the cylindrical permanent magnet that generates a uniform field in the cylinder bore, using the least amount of magnetic energy to do so. The remanence distribution of this magnet is derived...... and the generated field is compared to that of a Halbach cylinder of equal dimensions. The ideal remanence magnet is shown in most cases to generate a significantly lower field than the equivalent Halbach cylinder, although the field is generated with higher efficiency. The most efficient Halbach cylinder is shown...... to generate a field exactly twice as large as the equivalent ideal remanence magnet....
Analytic descriptions of cylindrical electromagnetic waves in a nonlinear medium
Xiong, Hao; Si, Liu-Gang; Yang, Xiaoxue; Wu, Ying
2015-01-01
A simple but highly efficient approach for dealing with the problem of cylindrical electromagnetic waves propagation in a nonlinear medium is proposed based on an exact solution proposed recently. We derive an analytical explicit formula, which exhibiting rich interesting nonlinear effects, to describe the propagation of any amount of cylindrical electromagnetic waves in a nonlinear medium. The results obtained by using the present method are accurately concordant with the results of using traditional coupled-wave equations. As an example of application, we discuss how a third wave affects the sum- and difference-frequency generation of two waves propagation in the nonlinear medium. PMID:26073066
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
A cylindrical furnace for absorption spectral studies
Indian Academy of Sciences (India)
A cylindrical furnace with three heating zones, capable of providing a temperature of 1100°C, has been fabricated to enable recording of absorption spectra of high temperature species. The temperature of the furnace can be controlled to ± 1°C of the set temperature. The salient feature of this furnace is that the material ...
International Nuclear Information System (INIS)
Fu, Guangshi; He, Yong; Zhang, Yanwei; Zhu, Yanqun; Wang, Zhihua; Cen, Kefa
2016-01-01
Highlights: • The relation between Ni content and Ni particle dispersion were disclosed. • The effect of Ni content on the catalytic activity of Ni/AC catalyst was revealed. • The optimal content of Ni for Ni/AC catalysts in HI decomposition was found. - Abstract: This work reports the Ni content effect on the Ni/AC catalytic performance in the HI decomposition reaction of the sulfur–iodine (SI) thermochemical cycle for hydrogen production and the Ni/AC catalyst durability in a long-term test. Accordingly, five catalysts with the Ni content ranging from 5% to 15% were prepared by an incipient-wetness impregnation method. The activity of all catalysts was examined under the temperature range of 573–773 K. The catalytic performance evaluation suggests that Ni content plays a significant role in the Ni dispersion, Ni particle size, and eventually the catalytic activity in HI decomposition. 12% is the optimal Ni content for Ni/AC catalysts in HI decomposition which is balanced between poor dispersion of Ni particles and increasing active center. The results of 24 h durability test, which incorporated with BET and TEM investigations of the 12%Ni/AC catalyst before and after the reaction, indicate that establishing a better Ni particle dispersion pattern and improving the stability of Ni particles on the support should be considered in the future.
Performance of a Permanent-Magnet Cylindrical Hall-Effect Thruster
Polzin, K. A.; Sooby, E. S.; Kimberlin, A. C.; Raites, Y.; Merino, E.; Fisch, N. J.
2009-01-01
The performance of a low-power cylindrical Hall thruster, which more readily lends itself to miniaturization and low-power operation than a conventional (annular) Hall thruster, was measured using a planar plasma probe and a thrust stand. The field in the cylindrical thruster was produced using permanent magnets, promising a power reduction over previous cylindrical thruster iterations that employed electromagnets to generate the required magnetic field topology. Two sets of ring-shaped permanent magnets are used, and two different field configurations can be produced by reorienting the poles of one magnet relative to the other. A plasma probe measuring ion flux in the plume is used to estimate the current utilization for the two magnetic topologies. The measurements indicate that electron transport is impeded much more effectively in one configuration, implying higher thrust efficiency. Thruster performance measurements on this configuration were obtained over a power range of 70-350 W and with the cathode orifice located at three different axial positions relative to the thruster exit plane. The thrust levels over this power range were 1.25-6.5 mN, with anode efficiencies and specific impulses spanning 4-21% and 400-1950 s, respectively. The anode efficiency of the permanent-magnet thruster compares favorable with the efficiency of the electromagnet thruster when the power consumed by the electromagnets is taken into account.
Chain-based communication in cylindrical underwater wireless sensor networks.
Javaid, Nadeem; Jafri, Mohsin Raza; Khan, Zahoor Ali; Alrajeh, Nabil; Imran, Muhammad; Vasilakos, Athanasios
2015-02-04
Appropriate network design is very significant for Underwater Wireless Sensor Networks (UWSNs). Application-oriented UWSNs are planned to achieve certain objectives. Therefore, there is always a demand for efficient data routing schemes, which can fulfill certain requirements of application-oriented UWSNs. These networks can be of any shape, i.e., rectangular, cylindrical or square. In this paper, we propose chain-based routing schemes for application-oriented cylindrical networks and also formulate mathematical models to find a global optimum path for data transmission. In the first scheme, we devise four interconnected chains of sensor nodes to perform data communication. In the second scheme, we propose routing scheme in which two chains of sensor nodes are interconnected, whereas in third scheme single-chain based routing is done in cylindrical networks. After finding local optimum paths in separate chains, we find global optimum paths through their interconnection. Moreover, we develop a computational model for the analysis of end-to-end delay. We compare the performance of the above three proposed schemes with that of Power Efficient Gathering System in Sensor Information Systems (PEGASIS) and Congestion adjusted PEGASIS (C-PEGASIS). Simulation results show that our proposed 4-chain based scheme performs better than the other selected schemes in terms of network lifetime, end-to-end delay, path loss, transmission loss, and packet sending rate.
Chain-Based Communication in Cylindrical Underwater Wireless Sensor Networks
Directory of Open Access Journals (Sweden)
Nadeem Javaid
2015-02-01
Full Text Available Appropriate network design is very significant for Underwater Wireless Sensor Networks (UWSNs. Application-oriented UWSNs are planned to achieve certain objectives. Therefore, there is always a demand for efficient data routing schemes, which can fulfill certain requirements of application-oriented UWSNs. These networks can be of any shape, i.e., rectangular, cylindrical or square. In this paper, we propose chain-based routing schemes for application-oriented cylindrical networks and also formulate mathematical models to find a global optimum path for data transmission. In the first scheme, we devise four interconnected chains of sensor nodes to perform data communication. In the second scheme, we propose routing scheme in which two chains of sensor nodes are interconnected, whereas in third scheme single-chain based routing is done in cylindrical networks. After finding local optimum paths in separate chains, we find global optimum paths through their interconnection. Moreover, we develop a computational model for the analysis of end-to-end delay. We compare the performance of the above three proposed schemes with that of Power Efficient Gathering System in Sensor Information Systems (PEGASIS and Congestion adjusted PEGASIS (C-PEGASIS. Simulation results show that our proposed 4-chain based scheme performs better than the other selected schemes in terms of network lifetime, end-to-end delay, path loss, transmission loss, and packet sending rate.
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Directory of Open Access Journals (Sweden)
Vanessa eKrause
2016-01-01
Full Text Available The primary motor cortex (M1 contributes to the acquisition and early consolidation of a motor sequence. Although the relevance of M1 excitability for motor learning has been supported, the significance of M1 oscillations remains an open issue. This study aims at investigating to what extent retrieval of a newly learned motor sequence can be differentially affected by motor-cortical transcranial alternating (tACS and direct current stimulation (tDCS. Alpha (10 Hz, beta (20 Hz or sham tACS was applied in 36 right-handers. Anodal or cathodal tDCS was applied in 30 right-handers. Participants learned an eight-digit serial reaction time task (SRTT; sequential vs. random with the right hand. Stimulation was applied to the left M1 after SRTT acquisition at rest for ten minutes. Reaction times were analyzed at baseline, end of acquisition, retrieval immediately after stimulation and reacquisition after eight further sequence repetitions.Reaction times during retrieval were significantly faster following 20 Hz tACS as compared to 10 Hz and sham tACS indicating a facilitation of early consolidation. TDCS yielded faster reaction times, too, independent of polarity. No significant differences between 20 Hz tACS and tDCS effects on retrieval were found suggesting that 20 Hz effects might be associated with altered motor-cortical excitability. Based on the behavioural modulation yielded by tACS and tDCS one might speculate that altered motor-cortical beta oscillations support early motor consolidation possibly associated with neuroplastic reorganization.
Low AC Loss in a 3 kA HTS Cable of the Dutch Project
Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex
Requirements for a 6 km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1 W/m per phase at rated current of 3 kArms, frequency of 50 Hz and temperature of 77 K. In this paper we discuss a strategy towards this ambitious goal, a concept design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate pitch angles for two-layer cable conductor of relatively large diameter, by minimizing the gaps between the HTS tapes, and by using narrow HTS tapes that conform well to the roundness of the underlying former. AC loss of 0.12 W/m at 3 kArms was measured at a frequency of 60 Hz and at a temperature of 77 K.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Frequency response analysis of cylindrical shells conveying fluid using finite element method
International Nuclear Information System (INIS)
Seo, Young Soo; Jeong, Weui Bong; Yoo, Wan Suk; Jeong, Ho Kyeong
2005-01-01
A finite element vibration analysis of thin-walled cylindrical shells conveying fluid with uniform velocity is presented. The dynamic behavior of thin-walled shell is based on the Sanders' theory and the fluid in cylindrical shell is considered as inviscid and incompressible so that it satisfies the Laplace's equation. A beam-like shell element is used to reduce the number of degree-of-freedom by restricting to the circumferential modes of cylindrical shell. An estimation of frequency response function of the pipe considering of the coupled effects of the internal fluid is presented. A dynamic coupling condition of the interface between the fluid and the structure is used. The effective thickness of fluid according to circumferential modes is also discussed. The influence of fluid velocity on the frequency response function is illustrated and discussed. The results by this method are compared with published results and those by commercial tools
Dynamic characteristics of a perforated cylindrical shell for flow distribution in SMART
Energy Technology Data Exchange (ETDEWEB)
Lim, Seungho; Choi, Youngin; Ha, Kyungrok [Department of Mechanical Engineering, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 120-749 (Korea, Republic of); Park, Kyoung-Su, E-mail: pks6348@yonsei.ac.kr [Department of Mechanical Engineering, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 120-749 (Korea, Republic of); Park, No-Cheol; Park, Young-Pil [Department of Mechanical Engineering, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 120-749 (Korea, Republic of); Jeong, Kyeong-Hoon; Park, Jin-Seok [Korea Atomic Energy Research Institute, 1045 Daedeokdaero, Yuseong, Daejeon 305-303 (Korea, Republic of)
2011-10-15
Highlights: > A 1/12 scaled-down flow skirt is manufactured and a modal test is performed. > A finite element model predicts the added mass effect of the perforated cylindrical shell. > Modal characteristics are extracted by considering the fluid-structure interaction. - Abstract: The System-integrated Modular Advanced ReacTor (SMART) is a small nuclear reactor under development in Korea. It is equipped with a perforated cylindrical shell, which is called a flow skirt, in the lower plenum of the reactor for uniform flow distribution and to prevent inflow of debris into the core. This perforated cylindrical shell can be excited by external forces such as seismic or pump pulsation loads. The dynamic characteristics of the perforated cylindrical shell must be identified for further dynamic analysis. This research explores the modal analysis of the scaled-down flow skirt model submerged in coolant water. For the numerical simulation, finite element analysis is carried out to extract modal characteristics of the structure considering the fluid-structure interaction and we introduce the NAVMI factor for similarity analysis. In the finite element model, the whole shape of the perforated cylindrical shell is simulated instead of using the effective material properties. In addition, a 1/12 scaled-down flow skirt is manufactured, and an experiment is designed using an exciter and waterproof accelerometers for the modal test. Due to excellent agreement between the modal test results and the finite element analysis results such as natural frequencies and mode shapes, the finite element model is validated and can be used to predict the dynamic characteristics of the real flow skirt. Moreover, the natural frequency of the real flow skirt can be calculated from the NAVMI factor and is in good agreement with the FEM result.
The transmission probability method in one-dimensional cylindrical geometry
International Nuclear Information System (INIS)
Rubin, I.E.
1983-01-01
The collision probability method widely used in solving the problems of neutron transpopt in a reactor cell is reliable for simple cells with small number of zones. The increase of the number of zones and also taking into account the anisotropy of scattering greatly increase the scope of calculations. In order to reduce the time of calculation the transmission probability method is suggested to be used for flux calculation in one-dimensional cylindrical geometry taking into account the scattering anisotropy. The efficiency of the suggested method is verified using the one-group calculations for cylindrical cells. The use of the transmission probability method allows to present completely angular and spatial dependences is neutrons distributions without the increase in the scope of calculations. The method is especially effective in solving the multi-group problems
Energy Technology Data Exchange (ETDEWEB)
Wu, Shao-Hua; Sun, Jian-Jun; Zhang, De-Feng; Lin, Zhi-Bin; Nie, Fa-Hui; Qiu, He-Yuan; Chen, Guo-Nan [Key Laboratory of Analysis and Detection Technology for Food Safety, Ministry of Education, College of Chemistry and Chemical Engineering, Fuzhou University, 523 Gong Ye Road, Fuzhou 350002 (China)
2008-09-20
A single-sided heated graphite cylindrical electrode (ss-HGCE) was designed. Compared to previous alternative current (AC) heating, much simpler and cheaper direct current (DC) heating supplier was adopted for the first time to perform adsorptive accumulation of rutin at ss-HGCE at elevated electrode temperature. This offers great promise for low cost, miniaturization and high compatibility with portability. The square wave voltammetry (SWV) stripping peak current was enhanced with increasing the electrode temperature only during preconcentration step. This enhancement was contributed to the forced thermal convection induced by heating the electrode rather than the bulk solution, which is able to improve mass transfer and facilitate adsorption hence enhance stripping response. A detection limit of 1.0 x 10{sup -9} M (S/N = 3) could be obtained at an electrode temperature of 48 C during 5 min accumulation, one magnitude lower than that at 28 C (room temperature). This is the lowest value at carbon-based electrodes for rutin determination as we know. Such novel method was also successfully used to determine rutin in pharmaceutical tablets. (author)
Research on soundproof properties of cylindrical shells of generalized phononic crystals
Liu, Ru; Shu, Haisheng; Wang, Xingguo
2017-04-01
Based on the previous studies, the concept of generalized phononic crystals (GPCs) is further introduced into the cylindrical shell structures in this paper. And a type of cylindrical shells of generalized phononic crystals (CS-GPCs) is constructed, the structural field and acoustic-structural coupled field of the composite cylindrical shells are examined respectively. For the structural field, the transfer matrix method of mechanical state vector is adopted to build the transfer matrix of radial waves propagating from inside to outside. For the acoustic-structural coupled field, the expressions of the acoustic transmission/reflection coefficients and the sound insulation of acoustic waves with the excitation of center line sound source are set up. And the acoustic transmission coefficient and the frequency response of sound insulation in this mode were numerical calculated. Furthermore, the theoretical analysis results are verified by using the method of combining the numerical calculation and finite element simulation. Finally, the effects of inner and outer fluid parameters on the transmission/reflection coefficients of CS-GPCs are analyzed in detail.
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Cylindrical Field Effect Transistor: A Full Volume Inversion Device
Fahad, Hossain M.
2010-01-01
inversion in the body. However, these devices are still limited by lithographic and processing challenges making them unsuitable for commercial production. This thesis explores a unique device structure called the CFET (Cylindrical Field Effect Transistors
Improving the performance parameters of metal cylindrical grid shell ...
African Journals Online (AJOL)
Improving the performance parameters of metal cylindrical grid shell structures. ... Finite element models are designed taking into account minimization of production and ... The force factors and deformation parameters of the basic circuits of a ...
Rothe's method for parabolic equations on non-cylindrical domains
Czech Academy of Sciences Publication Activity Database
Dasht, J.; Engström, J.; Kufner, Alois; Persson, L.E.
2006-01-01
Roč. 1, č. 1 (2006), s. 59-80 ISSN 0973-2306 Institutional research plan: CEZ:AV0Z10190503 Keywords : parabolic equations * non-cylindrical domains * Rothe's method * time-discretization Subject RIV: BA - General Mathematics
Nonlinear Dynamic Buckling of Damaged Composite Cylindrical Shells
Institute of Scientific and Technical Information of China (English)
WANG Tian-lin; TANG Wen-yong; ZHANG Sheng-kun
2007-01-01
Based on the first order shear deformation theory(FSDT), the nonlinear dynamic equations involving transverse shear deformation and initial geometric imperfections were obtained by Hamilton's philosophy. Geometric deformation of the composite cylindrical shell was treated as the initial geometric imperfection in the dynamic equations, which were solved by the semi-analytical method in this paper. Stiffness reduction was employed for the damaged sub-layer, and the equivalent stiffness matrix was obtained for the delaminated area. By circumferential Fourier series expansions for shell displacements and loads and by using Galerkin technique, the nonlinear partial differential equations were transformed to ordinary differential equations which were finally solved by the finite difference method. The buckling was judged from shell responses by B-R criteria, and critical loads were then determined. The effect of the initial geometric deformation on the dynamic response and buckling of composite cylindrical shell was also discussed, as well as the effects of concomitant delamination and sub-layer matrix damages.
Response of cylindrical steel shell under seismic loading
International Nuclear Information System (INIS)
Tariq, M.; Amin, K.M.
2003-01-01
The seismic response of a cylindrical shell is simulated using the finite element method, and by spectral analysis. For this purpose the fundamental frequency of the cylinder is first calculated and compared with a published result. The mode shapes are also calculated which are later used for spectral analysis. The boundary nodes of the shell are displaced periodically according to a predetermined function of time by employing the acceleration time history of the El Centro earthquake to simulate the seismic loading. However, to conduct spectral analysis, the displacements are first transformed from the time domain to frequency domain using the Fast Fourier transformation. This spectral data is then used to obtain the actual displacement in the first mode under the given seismic loading. The techniques employed here can be used for cylindrical shell structures like rotor of a gas centrifuge, besides other structures that are subjected to seismic loading, besides in other time dependent loading conditions, for example rocket motor vibrations. (author)
Stresses at the intersection of two cylindrical shells
International Nuclear Information System (INIS)
Xue, M.D.; Chen, W.; Hwang, K.C.
1995-01-01
The stress analysis based on the theory of a thin shell is carried out for two normally intersecting cylindrical shells with a large diameter ratio. Instead of the Donnell shallow shell equation, the modified Morley equation, which is applicable to ρ 0 (R/T) 1/2 XXXX1, is used for the analysis of the shell with cut-out. The solution in terms of displacement function for the nozzle with a non-planar end is based on the Love equation. The boundary forces and displacements at the intersection are all transformed from Gaussian coordinates (α,β) on the shell, or Gaussian coordinates (ζ,θ) on the nozzle into three-dimensional cylindrical coordinates (ρ,θ,z). Their expressions on the intersecting curve are periodic functions of θ and expanded in Fourier series. Every harmonics of Fourier coefficients of boundary forces and displacements are obtained by numerical quadrature.The results obtained are in agreement with those from the finite element method and experiments for d/D≤0.8. ((orig.))
Cylindrization of a PWR core for neutronic calculations
International Nuclear Information System (INIS)
Santos, Rubens Souza dos
2005-01-01
In this work we propose a core cylindrization, starting from a PWR core configuration, through the use of an algorithm that becomes the process automated in the program, independent of the discretization. This approach overcomes the problem stemmed from the use of the neutron transport theory on the core boundary, in addition with the singularities associated with the presence of corners on the outer fuel element core of, existents in the light water reactors (LWR). The algorithm was implemented in a computational program used to identification of the control rod drop accident in a typical PWR core. The results showed that the algorithm presented consistent results comparing with an production code, for a problem with uniform properties. In our conclusions, we suggest, for future works, for analyzing the effect on mesh sizes for the Cylindrical geometry, and to compare the transport theory calculations versus diffusion theory, for the boundary conditions with corners, for typical PWR cores. (author)
A theoretical study of cylindrical ultrasound transducers for intracavitary hyperthermia
International Nuclear Information System (INIS)
Lin, W.-L.; Fan, W.-C.; Yen, J.-Y.; Chen, Y.-Y.; Shieh, M.-J.
2000-01-01
Purpose: The purpose of this paper was to examine the heating patterns and penetration depth when a cylindrical ultrasound transducer is employed for intracavitary hyperthermia treatments. Methods and Materials: The present study employs a simulation program based on a simplified power deposition model for infinitely long cylindrical ultrasound transducers. The ultrasound power in the tissue is assumed to be exponentially attenuated according to the penetration depth of the ultrasound beam, and a uniform attenuation for the entire treatment region is also assumed. The distribution of specific absorption rate (SAR) ratio (the ratio of SAR for a point within the tissue to that for a specific point on the cavity surface) is used to determine the heating pattern for a set of given parameters. The parameters considered are the ultrasound attenuation in the tissue, the cavity size, and the transducer eccentricity. Results: Simulation results show that the ultrasound attenuation in the tissue, the cavity size, and the transducer eccentricity are the most influential parameters for the distribution of SAR ratio. A low frequency transducer located in a large cavity can produce a much better penetration. The cavity size is the major parameter affecting the penetration depth for a small cavity size, such as interstitial hyperthermia. The heating pattern can also be dramatically changed by the transducer eccentricity and radiating sector. In addition, for a finite length of cylindrical transducer, lower SAR ratio appears in the regions near the applicator's edges. Conclusion: The distribution of SAR ratio indicates the relationship between the treatable region and the parameters if an appropriate threshold of SAR ratio is taken. The findings of the present study comprehend whether or not a tumor is treatable, as well as select the optimal driving frequency, the appropriate cavity size, and the eccentricity of a cylindrical transducer for a specific treatment
Khalifa, H. E.; Deck, C. P.; Gutierrez, O.; Jacobsen, G. M.; Back, C. A.
2015-02-01
The use of silicon carbide (SiC) composites as structural materials in nuclear applications necessitates the development of a viable joining method. One critical application for nuclear-grade joining is the sealing of fuel within a cylindrical cladding. This paper demonstrates cylindrical joint feasibility using a low activation nuclear-grade joint material comprised entirely of β-SiC. While many papers have considered joining material, this paper takes into consideration the joint geometry and component form factor, as well as the material performance. Work focused specifically on characterizing the strength and permeability performance of joints between cylindrical SiC-SiC composites and monolithic SiC endplugs. The effects of environment and neutron irradiation were not evaluated in this study. Joint test specimens of different geometries were evaluated in their as-fabricated state, as well as after being subjected to thermal cycling and partial mechanical loading. A butted scarf geometry supplied the best combination of high strength and low permeability. A leak rate performance of 2 × 10-9 mbar l s-1 was maintained after thermal cycling and partial mechanical loading and sustained applied force of 3.4 kN, or an apparent strength of 77 MPa. This work shows that a cylindrical SiC-SiC composite tube sealed with a butted scarf endplug provides out-of-pile strength and permeability performance that meets light water reactor design requirements.
Multi-Group Reductions of LTE Air Plasma Radiative Transfer in Cylindrical Geometries
Scoggins, James; Magin, Thierry Edouard Bertran; Wray, Alan; Mansour, Nagi N.
2013-01-01
Air plasma radiation in Local Thermodynamic Equilibrium (LTE) within cylindrical geometries is studied with an application towards modeling the radiative transfer inside arc-constrictors, a central component of constricted-arc arc jets. A detailed database of spectral absorption coefficients for LTE air is formulated using the NEQAIR code developed at NASA Ames Research Center. The database stores calculated absorption coefficients for 1,051,755 wavelengths between 0.04 µm and 200 µm over a wide temperature (500K to 15 000K) and pressure (0.1 atm to 10.0 atm) range. The multi-group method for spectral reduction is studied by generating a range of reductions including pure binning and banding reductions from the detailed absorption coefficient database. The accuracy of each reduction is compared to line-by-line calculations for cylindrical temperature profiles resembling typical profiles found in arc-constrictors. It is found that a reduction of only 1000 groups is sufficient to accurately model the LTE air radiation over a large temperature and pressure range. In addition to the reduction comparison, the cylindrical-slab formulation is compared with the finite-volume method for the numerical integration of the radiative flux inside cylinders with varying length. It is determined that cylindrical-slabs can be used to accurately model most arc-constrictors due to their high length to radius ratios.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
International Nuclear Information System (INIS)
Lu, Y Charles; Kurapati, Siva N V R K; Yang Fuqian
2008-01-01
The cylindrical indentation is analysed, using the finite element method, for determining the plastic properties of elastic-plastic materials and the effect of strain hardening. The results are compared with those obtained from spherical indentation, the commonly used technique for measuring plastic properties of materials in small volumes. The analysis shows that the deformation under a cylindrical indenter quickly reaches a fully plastic state and that the size (diameter) of the plastic zone remains constant during further indentation. The indentation load is proportional to the indentation depth at large indentation depth, from which the indentation pressure P m at the onset of yielding can be readily extrapolated. The analysis of cylindrical indentation suggests that it does not need parameters such as impression radius (a) and contact stiffness (S) for determining the plastic behaviour of materials. Thus, the cylindrical indentation can suppress the uncertainties in measuring material properties
Coulomb Green's function and image potential near a cylindrical diffuse interface
Xue, Changfeng; Huang, Qiongwei; Deng, Shaozhong
2015-12-01
In a preceding paper [Comput. Phys. Commun. 184 (1): 51-59, 2013], we revisited the problem of calculating Coulomb Green's function and image potential near a planar diffuse interface within which the dielectric permittivity of the inhomogeneous medium changes continuously along one Cartesian direction in a transition layer between two dissimilar dielectric materials. In the present paper, we consider a cylindrical diffuse interface within which the dielectric permittivity changes continuously along the radial direction instead. First we propose a specific cylindrical diffuse interface model, termed the quasi-harmonic diffuse interface model, that can admit analytical solution for the Green's function in terms of the modified Bessel functions. Then and more importantly we develop a robust numerical method for building Green's functions for any cylindrical diffuse interface models. The main idea of the numerical method is, after dividing a diffuse interface into multiple sublayers, to approximate the dielectric permittivity profile in each one of the sublayers by one of the quasi-harmonic functional form rather than simply by a constant value as one would normally do. Next we describe how to efficiently compute well-behaved ratios, products, and logarithmic derivatives of the modified Bessel functions so as to avoid direct evaluations of individual modified Bessel functions in our formulations. Finally we conduct numerical experiments to show the effectiveness of the quasi-harmonic diffuse interface model in overcoming the divergence of the image potential, to validate the numerical method in terms of its accuracy and convergence, and to demonstrate its capability for computing Green's functions for any cylindrical diffuse interface models.
Fluid free surface effect on the vibration analysis of cylindrical shells
International Nuclear Information System (INIS)
Lakis, A.A.; Brusuc, G.; Toorani, M.
2007-01-01
The present study is to investigate the effect of free surface motion of the fluid on the dynamic behavior of the thin-walled cylindrical shells. This paper outlines a semi-analytical approach to dynamic analysis of the fluid-filled horizontal cylindrical shell taking into account the free surface motion effect. The aim of the method is to provide a general approach that can be used for both analysis and synthesis of fluid structure interaction problems in the horizontal cylindrical shells where the dynamic interaction of a flexible structure and incompressible and inviscid flow is in focus. The approach is very general and allows for dynamic analysis of both uniform and non-uniform cylindrical shell considering the fluid forces including the sloshing effect exerted on the structure. The hybrid method developed in this work is on the basis of a combination of the classical finite element approach and the thin shell theory to determine the specific displacement functions. Mass and stiffness matrices of the shell are determined by precise analytical integration. A potential function is considered to develop the dynamic pressure due to the fluid. The kinetic and potential energies are evaluated for a range of fluid height to find the influence of the fluid on the dynamic responses of the structure. The influence of the physical and geometrical parameters on the fluid-structure system has been considered in the numerical solutions. When these results are compared with corresponding results available in the literature, both theory and experiment, very good agreement is obtained. (authors)
International Nuclear Information System (INIS)
Yang, Xiao-Jun; Srivastava, H.M.; He, Ji-Huan; Baleanu, Dumitru
2013-01-01
In this Letter, we propose to use the Cantor-type cylindrical-coordinate method in order to investigate a family of local fractional differential operators on Cantor sets. Some testing examples are given to illustrate the capability of the proposed method for the heat-conduction equation on a Cantor set and the damped wave equation in fractal strings. It is seen to be a powerful tool to convert differential equations on Cantor sets from Cantorian-coordinate systems to Cantor-type cylindrical-coordinate systems.
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Dynamic shear-bending buckling experiments of cylindrical shells
International Nuclear Information System (INIS)
Hagiwara, Y.; Akiyama, H.
1995-01-01
Dynamic experimental studies of the plastic shear/bending buckling of cylindrical shells were performed. They clarified the inelastic response reduction and the seismic margin of FBR reactor vessels. The test results were incorporated into the draft of the seismic buckling design guidelines of FBR. (author). 15 refs., 3 figs
Directory of Open Access Journals (Sweden)
Andrzej Rusek
2008-01-01
Full Text Available The mathematical model of cylindrical linear induction motor (C-LIM fed via frequency converter is presented in the paper. The model was developed in order to analyze numerically the transient states. Problems concerning dynamics of ac-machines especially linear induction motor are presented in [1 – 7]. Development of C-LIM mathematical model is based on circuit method and analogy to rotary induction motor. The analogy between both: (a stator and rotor windings of rotary induction motor and (b winding of primary part of C-LIM (inductor and closed current circuits in external secondary part of C-LIM (race is taken into consideration. The equations of C-LIM mathematical model are presented as matrix together with equations expressing each vector separately. A computational analysis of selected transient states of C-LIM fed via frequency converter is presented in the paper. Two typical examples of C-LIM operation are considered for the analysis: (a starting the motor at various static loads and various synchronous velocities and (b reverse of the motor at the same operation conditions. Results of simulation are presented as transient responses including transient electromagnetic force, transient linear velocity and transient phase current.
Overflow Characteristic of Cylindrical Shape Crest Weirs Over Horizontal Bed
Directory of Open Access Journals (Sweden)
Emad4 AbdulGabbar
2013-05-01
Full Text Available The most common types of weirs are the broad-crested weir, the sharp-crested weir, the circular crested weir and the ogee crested weir. Advantages of the cylindrical weir shape include the stable overflow pattern, the ease to pass floating debris, the simplicity of design compared to ogee crest design and the associated lower costs. In present study, it was investigated the overflow characteristics of circular weirs in laboratory for various cylinder radii of three sizes (11.4, 9.0, 6.3 cm, and the models fixed on the channel bed vertically to the direction of flow. The result shows that the increase in the ratio of head to weir radius ratio (Hw/R value causes an increase in discharge coefficient (Cd value for the same height of weir. It was observed that the cylinder size (i.e. radius of cylindrical weir (R has an effect on the (Cd. The flow magnification factor (qw/qs increases with an increase in (Hw/R value and values of (qw/qs were always higher than one for all values of (Hw/R, this means that weirs of cylindrical shape performed better than those of sharp crest for any value of weir radius tested in this study.
TUNNEL POINT CLOUD FILTERING METHOD BASED ON ELLIPTIC CYLINDRICAL MODEL
Directory of Open Access Journals (Sweden)
N. Zhu
2016-06-01
Full Text Available The large number of bolts and screws that attached to the subway shield ring plates, along with the great amount of accessories of metal stents and electrical equipments mounted on the tunnel walls, make the laser point cloud data include lots of non-tunnel section points (hereinafter referred to as non-points, therefore affecting the accuracy for modeling and deformation monitoring. This paper proposed a filtering method for the point cloud based on the elliptic cylindrical model. The original laser point cloud data was firstly projected onto a horizontal plane, and a searching algorithm was given to extract the edging points of both sides, which were used further to fit the tunnel central axis. Along the axis the point cloud was segmented regionally, and then fitted as smooth elliptic cylindrical surface by means of iteration. This processing enabled the automatic filtering of those inner wall non-points. Experiments of two groups showed coincident results, that the elliptic cylindrical model based method could effectively filter out the non-points, and meet the accuracy requirements for subway deformation monitoring. The method provides a new mode for the periodic monitoring of tunnel sections all-around deformation in subways routine operation and maintenance.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Feng, Huicheng; Wong, Teck Neng; Che, Zhizhao
2016-08-01
Induced charge electrophoresis of a conducting cylinder suspended in a nonconducting cylindrical pore is theoretically analyzed and a micromotor is proposed that utilizes the cylinder rotation. The cylinder velocities are analytically obtained in the Dirichlet and the Neumann boundary conditions of the electric field on the cylindrical pore. The results show that the cylinder not only translates but also rotates when it is eccentric with respect to the cylindrical pore. The influences of a number of parameters on the cylinder velocities are characterized in detail. The cylinder trajectories show that the cylinder approaches and becomes stationary at certain positions within the cylindrical pore. The proposed micromotor is capable of working under a heavy load with a high rotational velocity when the eccentricity is large and the applied electric field is strong.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
Pulling cylindrical particles using a soft-nonparaxial tractor beam
DEFF Research Database (Denmark)
Novitsky, Andrey; Ding, Weiqiang; Wang, Maoyan
2017-01-01
In order to pull objects towards the light source a single tractor beam inevitably needs to be strongly nonparaxial. This stringent requirement makes such a tractor beam somewhat hypothetical. Here we reveal that the cylindrical shape of dielectric particles can effectively mitigate the nonparaxi......In order to pull objects towards the light source a single tractor beam inevitably needs to be strongly nonparaxial. This stringent requirement makes such a tractor beam somewhat hypothetical. Here we reveal that the cylindrical shape of dielectric particles can effectively mitigate...... the nonparaxiality requirements, reducing the incidence angle of the partial plane waves of the light beam down to 45 degrees and even to 30 degrees for respectively dipole and dipole-quadrupole objects. The optical pulling force attributed to the interaction of magnetic dipole and magnetic quadrupole moments...... and sorting of targeted particles....
Theory of precipitation effects on dead cylindrical fuels
Michael A. Fosberg
1972-01-01
Numerical and analytical solutions of the Fickian diffusion equation were used to determine the effects of precipitation on dead cylindrical forest fuels. The analytical solution provided a physical framework. The numerical solutions were then used to refine the analytical solution through a similarity argument. The theoretical solutions predicted realistic rates of...
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Shaping of parabolic cylindrical membrane reflectors for the Dart Precision Test Bed
Morgan, R.; Agnes, Gregory S.; Dragovan, M.; Barber, D.; Marcin, M.; White, C.; Dooley, J.; Hatheway, A.
2004-01-01
The DART is a new telescope architecture consisting of a single aperture formed from two cylindrical parabolic reflectors. The system is ideally suited to using tensioned membranes for the reflective surfaces, owing to the zero Gaussian curvature of a cylindrical parabola. In this paper, we present experimental measurements for shaping the membranes by using curved boundary elements to achieve coarse shaping, and a pair of precision rails shaped by moments and forces at the ends, and lightly pushed into the surface, to provide fine shape control.
Exact relativistic cylindrical solution of disordered radiation
International Nuclear Information System (INIS)
Fonseca Teixeira, A.F. da; Wolk, I.; Som, M.M.
1976-05-01
A source free disordered distribution of electromagnetic radiation is considered in Einstein' theory, and a time independent exact solution with cylindrical symmetry is obtained. The gravitation and pressure effects of the radiation alone are sufficient to give the distribution an equilibrium. A finite maximum concentration is found on the axis of symmetry, and decreases monotonically to zero outwards. Timelike and null geodesics are discussed
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Directory of Open Access Journals (Sweden)
Mazen Alshaaer
2017-03-01
Full Text Available Three-dimensionally ordered macroporous biomaterials containing hydroxyapatite were synthesized using natural luffa cylindrical fibres (with diameter of 100–400 µm as templates. The preliminary evaluation of this novel method for production of porous bioceramics showed promising potential applications in bone tissue engineering. The produced bioceramics were subjected to microstructural, physical, mechanical, and in vitro characterisation. Mercury intrusion porosimetry, supported by SEM analysis, showed the presence of bimodal porosity (smaller pores with diameters of 10 to 30 µm and cylindrical macropores with diameters from 100 to 400 µm and 60% of the interconnected porosity. These porous calcium phosphate ceramics proved to be bioactive and exhibited mechanical properties comparable to those of natural spongy bones with compressive strength up to 3 MPa and elastic modulus in compression around 0.05 GPa. In vitro characterization of the porous ceramics showed cells attaching to the apatite crystals that make up the scaffold matrix. Cell adhesion resulted in elongated and highly stretched cells within the macropores with focal adhesion points on the scaffolds. Moreover, the cells adhered to the calcium phosphate cement (CPC and developed cytoplasmic extensions as shown by SEM imagery. Their proliferation in the scaffolds in culture demonstrates that the scaffold architecture is suitable for Mesenchymal stem cells seeding and growth.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Directory of Open Access Journals (Sweden)
Zhenwei Mo
2016-01-01
Full Text Available We use the continuity equation and the Reynolds averaged Navier-Stokes equations to study the flow-pattern characteristics around a turbine runner for the small-opening cylindrical valve of a hydraulic turbine. For closure, we adopt the renormalization-group k-ε two-equation turbulence model and use the computational fluid dynamics (CFD software FLUENT to numerically simulate the three-dimensional unsteady turbulent flow through the entire passage of the hydraulic turbine. The results show that a low-pressure zone develops around the runner blades when the cylindrical valve is closed in a small opening; cavitation occurs at the blades, and a vortex appears at the outlet of the runner. As the cylindrical valve is gradually closed, the flow velocity over the runner area increases, and the pressure gradient becomes more significant as the discharge decreases. In addition, the fluid flow velocity is relatively high between the lower end of the cylindrical valve and the base, so that a high-velocity jet is easily induced. The calculation and analysis provide a theoretical basis for improving the performance of cylindrical-valve operating systems.
Secondary extinction in cylindrical and spherical crystals for X-ray and neutron diffraction
International Nuclear Information System (INIS)
Hu Huachen; Li Zhaohuan; Yang Bin; Shen Caiwan
2001-01-01
The distribution of the reflection power ratio for a neutron or x-ray diffracted from a cylindrical crystal immersed in an homogenous incident beam is obtained by the numerical solution of the transfer equations for the first time. The profile well reflects all the physical properties of the absorption and extinction behaviour in the crystals. A systematic investigation of the secondary extinction for cylindrical and spherical crystals was carried out based on these results
PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS
Directory of Open Access Journals (Sweden)
O. V. VASYLENKO
2018-05-01
controller that meets the criteria of adequacy, reliability and economy, synthesized on the basis of a new approach in modeling objects at the macro level in accordance with the theory of automatic control. Macromodels based in capabilities of behavioral modeling in the program of computer-aided design in Electronics (ECAD. As part of the compensation system studying, the new controller model has been developed, that turns pulse-width modulated signal into amplitude-modulated signal by a certain algorithm. This approach (obtaining a quasi-PWM signal made it possible to significantly simplify the control unit model, and the model of ACS at whole. Practical value. PWM macromodels expands the mathematical support of ECAD, reduces the probability of the appearance of algorithmic failures and accelerates the modeling of ACS in ECAD. Approach, which used during its synthesis, allows us to build similar models for other software (CAS, CAE.
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Cylindrical prominences and the magnetic influence of the photospheric boundary
International Nuclear Information System (INIS)
Lerche, I.; Chicago Univ., IL; Low, B.C.
1980-01-01
We construct exact, non-linear, solutions for an horizontal, cylindrical, current-carrying, prominence supported against solar gravity by the action of a Lorentz force. The solutions incorporate the photosphere boundary condition, proposed by van Tend and Kuperus (1978), and analyzed by them for line filaments. Our solutions have finite radius for the prominence material and, as well as satisfying the equations of magnetostatic equilibrium, they allow for the continuity of gas pressure, and of the normal and tangential components of magnetic field across the circular prominence boundary. We show that an infinity of solutions is possible and we illustrate the basic behavior by investigation of a special case. We also give a prescription for constructing equilibrium fields for any horizontal prominence with arbitrary cross-section and with an arbitrary external magnetic field. The prescription is ideally suited for numerical codes and we suggest that both the equilibrium of such shapes can easily be accomplished numerically together with their evolutionary history. (orig.)
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
International Nuclear Information System (INIS)
Mutzl, J.
1978-01-01
This burst protection device controls forces to be expected in an accident by resolving them into axial (vertical) and radial (horizontal) components, which are taken by a large number of elements stressed in tension. The steam raising unit is surrounded by a containment, but remains easily accessible. The containment consists of a steel jacket, lid and floor. Several cylindrical sections above one another form the steel jacket, which surrounds the steam raising unit with an intermediate insulating layer of concrete. The insulating concrete cylinder is of several times the thickness of the steel jacket, and also consists of cylindrical sections. An outer supporting ring for the lid and floor of the containment have outside diameters which project beyond the jacket. Prestressed circumferential vertical tension ropes between the supporting ring and floor take any additional tensional forces. The lid is domed with downward curvature towards the upper boiler dome. Internal bursting forces produce compressive stresses in the lid, which thus pass along its outside diameter into the surrounding ring. The lid, which is devided along one diameter, makes dismantling and access to the boiler easy even with a central steam pipe going upwards. The floor of the burst protection is also the floor of the steam raising unit. It is of several times the thickness of the tube floor, which, with its spacing above the floor forms the usual inlet and outlet space for the reactor cooling water. The main coolant pump installed there is driven by an external motor through a floor penetration. (HP) [de
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Modeling dose-rate on/over the surface of cylindrical radio-models using Monte Carlo methods
International Nuclear Information System (INIS)
Xiao Xuefu; Ma Guoxue; Wen Fuping; Wang Zhongqi; Wang Chaohui; Zhang Jiyun; Huang Qingbo; Zhang Jiaqiu; Wang Xinxing; Wang Jun
2004-01-01
Objective: To determine the dose-rates on/over the surface of 10 cylindrical radio-models, which belong to the Metrology Station of Radio-Geological Survey of CNNC. Methods: The dose-rates on/over the surface of 10 cylindrical radio-models were modeled using the famous Monte Carlo code-MCNP. The dose-rates on/over the surface of 10 cylindrical radio-models were measured by a high gas pressurized ionization chamber dose-rate meter, respectively. The values of dose-rate modeled using MCNP code were compared with those obtained by authors in the present experimental measurement, and with those obtained by other workers previously. Some factors causing the discrepancy between the data obtained by authors using MCNP code and the data obtained using other methods are discussed in this paper. Results: The data of dose-rates on/over the surface of 10 cylindrical radio-models, obtained using MCNP code, were in good agreement with those obtained by other workers using the theoretical method. They were within the discrepancy of ±5% in general, and the maximum discrepancy was less than 10%. Conclusions: As if each factor needed for the Monte Carlo code is correct, the dose-rates on/over the surface of cylindrical radio-models modeled using the Monte Carlo code are correct with an uncertainty of 3%
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Positive column of the discharge in a cylindrical shell
International Nuclear Information System (INIS)
Uehara, M.; Maciel, H.S.
1991-01-01
A Schottky type theoretical model is presented for the positive column of a discharge on a cylindric shell contained gas, with the discharge current flowing in the longitudinal direction. Some analytical results and the conclusion are presented. (L.C.J.A.). 5 refs
Cylindrical Taylor states conserving total absolute magnetic helicity
Low, B. C.; Fang, F.
2014-09-01
The Taylor state of a three-dimensional (3D) magnetic field in an upright cylindrical domain V is derived from first principles as an extremum of the total magnetic energy subject to a conserved, total absolute helicity Habs. This new helicity [Low, Phys. Plasmas 18, 052901 (2011)] is distinct from the well known classical total helicity and relative total helicity in common use to describe wholly-contained and anchored fields, respectively. A given field B, tangential along the cylindrical side of V, may be represented as a unique linear superposition of two flux systems, an axially extended system along V and a strictly transverse system carrying information on field-circulation. This specialized Chandrasekhar-Kendall representation defines Habs and permits a neat formulation of the boundary-value problem (BVP) for the Taylor state as a constant-α force-free field, treating 3D wholly-contained and anchored fields on the same conceptual basis. In this formulation, the governing equation is a scalar integro-partial differential equation (PDE). A family of series solutions for an anchored field is presented as an illustration of this class of BVPs. Past treatments of the constant-α field in 3D cylindrical geometry are based on a scalar Helmholtz PDE as the governing equation, with issues of inconsistency in the published field solutions discussed over time in the journal literature. The constant-α force-free equation reduces to a scalar Helmholtz PDE only as special cases of the 3D integro-PDE derived here. In contrast, the constant-α force-free equation and the scalar Helmholtz PDE are absolutely equivalent in the spherical domain as discussed in Appendix. This theoretical study is motivated by the investigation of the Sun's corona but the results are also relevant to laboratory plasmas.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Static Solutions of Einstein's Equations with Cylindrical Symmetry
Trendafilova, C. S.; Fulling, S. A.
2011-01-01
In analogy with the standard derivation of the Schwarzschild solution, we find all static, cylindrically symmetric solutions of the Einstein field equations for vacuum. These include not only the well-known cone solution, which is locally flat, but others in which the metric coefficients are powers of the radial coordinate and the spacetime is…
Microinstabilities in a radially contracting inhomogeneous cylindrical plasma slab
International Nuclear Information System (INIS)
Deutsch, R.; Kaeppeler, H.J.
1980-07-01
In order to study the development of microinstabilities in a collapsing cylindrical plasma sheath, corresponding to the situations in a z-pinch or a plasma focus, the dispersion relation for electromagnetic perturbations is derived with the aid of a newly established slab-model for an inhomogeneous, radially contracting plasma. In contrast to previously used slab-models, the orientation of the electric field is in direction of the cylinder axis and the azimuthal magnetic field is induced by the current flowing through the cylindrical plasma slab. The Vlasov equation is used together with the Krook collision term in order to include the influence of collisions. The results of this theory presented in this report will be used to calculate the growth of drift instabilities in the compression phase of a plasma focus, and shall serve as a basis for further development of a more general dispersion relation including runaway-effects. (orig.)
Enhanced Performance of Cylindrical Hall Thrusters
International Nuclear Information System (INIS)
Raitses, Y.; Smirnov, A.; Fisch, N.J.
2007-01-01
The cylindrical thruster differs significantly in its underlying physical mechanisms from the conventional annular Hall thruster. It features high ionization efficiency, quiet operation, ion acceleration in a large volume-to-surface ratio channel, and performance comparable with the state-of-the-art conventional Hall thrusters. Very significant plume narrowing, accompanied by the increase of the energetic ion fraction and improvement of ion focusing, led to 50-60% increase of the thruster anode efficiency. These improvements were achieved by overrunning the discharge current in the magnetized thruster plasma
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Escape and transmission probabilities in cylindrical geometry
International Nuclear Information System (INIS)
Bjerke, M.A.
1980-01-01
An improved technique for the generation of escape and transmission probabilities in cylindrical geometry was applied to the existing resonance cross section processing code ROLAIDS. The algorithm of Hwang and Toppel, [ANL-FRA-TM-118] (with modifications) was employed. The probabilities generated were found to be as accurate as those given by the method previously applied in ROLAIDS, while requiring much less computer core storage and CPU time
Transmission of infrared radiation through cylindrical waveguides
International Nuclear Information System (INIS)
Nucara, A.; Dore, P.; Calvani, P.; Cannavo', D.; Marcelli, A.
1998-01-01
Measurement of the transmittance of infrared radiation (v -1 ) through cylindrical waveguides are presented and discussed. The experimental results are compared with numerical simulations, obtained through conventional ray tracing programs. Finally, it' estimated the transmittance of a waveguide in the case of an infrared synchrotron radiation source. Are applied the results to the case of the DAΦNE collider, where a synchrotron radiation beamline for the far infrared is under construction
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Absorption factor for cylindrical samples
International Nuclear Information System (INIS)
Sears, V.F.
1984-01-01
The absorption factor for the scattering of X-rays or neutrons in cylindrical samples is calculated by numerical integration for the case in which the absorption coefficients of the incident and scattered beams are not equal. An extensive table of values having an absolute accuracy of 10 -4 is given in a companion report [Sears (1983). Atomic Energy of Canada Limited, Report No. AECL-8176]. In the present paper an asymptotic expression is derived for the absorption factor which can be used with an error of less than 10 -3 for most cases of interest in both neutron inelastic scattering and neutron diffraction in crystals. (Auth.)
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Propagation of the initial value perturbation in a cylindrical lined duct carrying a gas flow
Directory of Open Access Journals (Sweden)
Agneta M. BALINT
2013-03-01
Full Text Available For the homogeneous Euler equation linearized around a non-slipping mean flow andboundary conditions corresponding to the mass-spring-damper impedance, smooth initial dataperturbations with compact support are considered. The propagation of this type of initial dataperturbations in a straight cylindrical lined duct is investigated. Such kind of investigations is missingin the existing literature. The mathematical tools are the Fourier transform with respect to the axialspatial variable and the Laplace transform with respect to the time variable. The functionalframework and sufficient conditions are researched that the so problem be well-posed in the sense ofHadamard and the Briggs-Bers stability criteria can be applied.
Kim, Heung Soo; Sohn, Jung Woo; Jeon, Juncheol; Choi, Seung-Bok
2013-02-06
In this work, active vibration control of an underwater cylindrical shell structure was investigated, to suppress structural vibration and structure-borne noise in water. Finite element modeling of the submerged cylindrical shell structure was developed, and experimentally evaluated. Modal reduction was conducted to obtain the reduced system equation for the active feedback control algorithm. Three Macro Fiber Composites (MFCs) were used as actuators and sensors. One MFC was used as an exciter. The optimum control algorithm was designed based on the reduced system equations. The active control performance was then evaluated using the lab scale underwater cylindrical shell structure. Structural vibration and structure-borne noise of the underwater cylindrical shell structure were reduced significantly by activating the optimal controller associated with the MFC actuators. The results provide that active vibration control of the underwater structure is a useful means to reduce structure-borne noise in water.
Directory of Open Access Journals (Sweden)
Seung-Bok Choi
2013-02-01
Full Text Available In this work, active vibration control of an underwater cylindrical shell structure was investigated, to suppress structural vibration and structure-borne noise in water. Finite element modeling of the submerged cylindrical shell structure was developed, and experimentally evaluated. Modal reduction was conducted to obtain the reduced system equation for the active feedback control algorithm. Three Macro Fiber Composites (MFCs were used as actuators and sensors. One MFC was used as an exciter. The optimum control algorithm was designed based on the reduced system equations. The active control performance was then evaluated using the lab scale underwater cylindrical shell structure. Structural vibration and structure-borne noise of the underwater cylindrical shell structure were reduced significantly by activating the optimal controller associated with the MFC actuators. The results provide that active vibration control of the underwater structure is a useful means to reduce structure-borne noise in water.
Linke, Stephan J; Richard, Gisbert; Katz, Toam
2011-09-29
To analyze the prevalence and associations of anisometropia with spherical ametropia, astigmatism, age, and sex in a refractive surgery population. Medical records of 27,070 eyes of 13,535 refractive surgery candidates were reviewed. Anisometropia, defined as the absolute difference in mean spherical equivalent powers between right and left eyes, was analyzed for subjective (A(subj)) and cycloplegic refraction (A(cycl)). Correlations between anisometropia (>1 diopter) and spherical ametropia, cylindrical power, age, and sex, were analyzed using χ² and nonparametric Kruskal-Wallis or Mann-Whitney tests and binomial logistic regression analyses. Power vector analysis was applied for further analysis of cylindrical power. Prevalence of A(subj) was 18.5% and of A(cycl) was 19.3%. In hyperopes, logistic regression analysis revealed that only spherical refractive error (odds ratio [OR], 0.72) and age (OR, 0.97) were independently associated with anisometropia. A(subj) decreased with increasing spherical ametropia and advancing age. Cylindrical power and sex did not significantly affect A(subj). In myopes all explanatory variables (spherical power OR, 0.93; cylindrical power OR, 0.75; age OR, 1.02; sex OR, 0.8) were independently associated with anisometropia. Cylindrical power was most strongly associated with anisometropia. Advancing age and increasing spherical/cylindrical power correlated positively with increasing anisometropia in myopic subjects. Female sex was more closely associated with anisometropia. This large-scale retrospective analysis confirmed an independent association between anisometropia and both spherical ametropia and age in refractive surgery candidates. Notably, an inverse relationship between these parameters in hyperopes was observed. Cylindrical power and female sex were independently associated with anisometropia in myopes.
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Fermionic vacuum polarization by a cylindrical boundary in the cosmic string spacetime
International Nuclear Information System (INIS)
Bezerra de Mello, E. R.; Bezerra, V. B.; Saharian, A. A.; Tarloyan, A. S.
2008-01-01
The vacuum expectation values of the energy-momentum tensor and the fermionic condensate are analyzed for a massive spinor field obeying the MIT bag boundary condition on a cylindrical shell in the cosmic string spacetime. Both regions inside and outside the shell are considered. By applying to the corresponding mode sums a variant of the generalized Abel-Plana formula, we explicitly extract the parts in the expectation values corresponding to the cosmic string geometry without boundaries. In this way the renormalization procedure is reduced to that for the boundary-free cosmic string spacetime. The parts induced by the cylindrical shell are presented in terms of integrals rapidly convergent for points away from the boundary. The behavior of the vacuum densities is investigated in various asymptotic regions of the parameters. In the limit of large values of the planar angle deficit, the boundary-induced expectation values are exponentially suppressed. As a special case, we discuss the fermionic vacuum densities for the cylindrical shell on the background of the Minkowski spacetime.
A calculation model for primary intensity distributions from cylindrically symmetric x-ray lenses
International Nuclear Information System (INIS)
Hristov, Dimitre; Maltz, Jonathan
2008-01-01
A calculation model for the quantitative prediction of primary intensity fluence distributions obtained by the Bragg diffraction focusing of kilovoltage radiation by cylindrical x-ray lenses is presented. The mathematical formalism describes primary intensity distributions from cylindrically-symmetric x-ray lenses, with a planar isotropic radiation source located in a plane perpendicular to the lens axis. The presence of attenuating medium inserted between the lens and the lens focus is accounted for by energy-dependent attenuation. The influence of radiation scattered within the media is ignored. Intensity patterns are modeled under the assumption that photons that are not interacting with the lens are blocked out at any point of interest. The main characteristics of the proposed calculation procedure are that (i) the application of vector formalism allows universal treatment of all cylindrical lenses without the need of explicit geometric constructs; (ii) intensity distributions resulting from x-ray diffraction are described by a 3D generalization of the mosaic spread concept; (iii) the calculation model can be immediately coupled to x-ray diffraction simulation packages such as XOP and Shadow. Numerical simulations based on this model are to facilitate the design of focused orthovoltage treatment (FOT) systems employing cylindrical x-ray lenses, by providing insight about the influence of the x-ray source and lens parameters on quantities of dosimetric interest to radiation therapy
Coupled dilaton and electromagnetic field in cylindrically symmetric ...
Indian Academy of Sciences (India)
An exact solution is obtained for coupled dilaton and electromagnetic field in a cylindrically symmetric spacetime where an axial magnetic field as well as a radial electric field both are present. Depending on the choice of the arbitrary constants our solution reduces either to dilatonic gravity with pure electric field or to that ...
Simulation of cylindrical Pierce diodes with radial flow
International Nuclear Information System (INIS)
Alves, M.V.; Gnavi, G.; Gratton, F.T.; Buenos Aires Univ.
1996-01-01
In this paper we study the electron instability and the non linear behaviour of cylindrical Pierce's diodes by particle simulation. We ignore here the ion contribution (ions are fixed at a 1/r density and given a very large mass) to give perspicuity to the electron dynamics, and to facilitate comparison with existing theory. (author). 8 refs., 10 figs
Measurement of cylindrical particles with phase Doppler anemometry.
Mignon, H; Gréhan, G; Gouesbet, G; Xu, T H; Tropea, C
1996-09-01
Light scattering from cylindrical particles has been described with geometric optics. The feasibility of determining the particle diameter with a planar phase Doppler anemometer has been examined by simulations and experiments. In particular, the influence of particle orientation on measurability and measurement accuracy has been investigated. Some recommendations for realizing a practical-measurement instrument have been presented.
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Multimode interaction in axially excited cylindrical shells
Directory of Open Access Journals (Sweden)
Silva F. M. A.
2014-01-01
Full Text Available Cylindrical shells exhibit a dense frequency spectrum, especially near the lowest frequency range. In addition, due to the circumferential symmetry, frequencies occur in pairs. So, in the vicinity of the lowest natural frequencies, several equal or nearly equal frequencies may occur, leading to a complex dynamic behavior. So, the aim of the present work is to investigate the dynamic behavior and stability of cylindrical shells under axial forcing with multiple equal or nearly equal natural frequencies. The shell is modelled using the Donnell nonlinear shallow shell theory and the discretized equations of motion are obtained by applying the Galerkin method. For this, a modal solution that takes into account the modal interaction among the relevant modes and the influence of their companion modes (modes with rotational symmetry, which satisfies the boundary and continuity conditions of the shell, is derived. Special attention is given to the 1:1:1:1 internal resonance (four interacting modes. Solving numerically the governing equations of motion and using several tools of nonlinear dynamics, a detailed parametric analysis is conducted to clarify the influence of the internal resonances on the bifurcations, stability boundaries, nonlinear vibration modes and basins of attraction of the structure.
Numerical Study on the Tensile Behavior of 3D Four Directional Cylindrical Braided Composite Shafts
Zhao, Guoqi; Wang, Jiayi; Hao, Wenfeng; Liu, Yinghua; Luo, Ying
2017-10-01
The tensile behavior of 3D four directional cylindrical braided composite shafts was analyzed with the numerical method. The unit cell models for the 3D four directional cylindrical braided composite shafts with various braiding angles were constructed with ABAQUS. Hashin's failure criterion was used to analyze the tensile strength and the damage evolution of the unit cells. The influence of the braiding angle on the tensile behavior of the 3D four directional cylindrical braided composite shafts was analyzed. The numerical results showed that the tensile strength along the braiding direction increased as the braiding angle decreased. These results should play an integral role in the design of braiding composites shafts.
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
A study of aerosol deposition by thermophoresis in cylindrical ducts
International Nuclear Information System (INIS)
Montassier, N.
1990-01-01
The scope of the study was aerosol deposition in cylindrical ducts, and the deposition due to thermophoresis particularly. The theoretical knowledge on this force and the basis of fluid mechanics are first recalled. An experimental study of thermophoretic deposition of particles in laminar flow was carried out in the particular case of uniform particle concentration and gas temperature at the inlet of the cooled tube. When the gas temperature was equilibrated with the wall temperature and thermophoretic particle deposition along the walls had ceased, the deposition efficiency approached a limit. Our experimental results showed that this limiting efficiency was independent on flow. Finally, for the laminar flow regime, a set of simple equations was developed in order to forecast the thermophoretic deposition of particles of any size along a cylindrical tube [fr
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
Optimized programming algorithm for cylindrical and directional deep brain stimulation electrodes.
Anderson, Daria Nesterovich; Osting, Braxton; Vorwerk, Johannes; Dorval, Alan D; Butson, Christopher R
2018-04-01
Deep brain stimulation (DBS) is a growing treatment option for movement and psychiatric disorders. As DBS technology moves toward directional leads with increased numbers of smaller electrode contacts, trial-and-error methods of manual DBS programming are becoming too time-consuming for clinical feasibility. We propose an algorithm to automate DBS programming in near real-time for a wide range of DBS lead designs. Magnetic resonance imaging and diffusion tensor imaging are used to build finite element models that include anisotropic conductivity. The algorithm maximizes activation of target tissue and utilizes the Hessian matrix of the electric potential to approximate activation of neurons in all directions. We demonstrate our algorithm's ability in an example programming case that targets the subthalamic nucleus (STN) for the treatment of Parkinson's disease for three lead designs: the Medtronic 3389 (four cylindrical contacts), the direct STNAcute (two cylindrical contacts, six directional contacts), and the Medtronic-Sapiens lead (40 directional contacts). The optimization algorithm returns patient-specific contact configurations in near real-time-less than 10 s for even the most complex leads. When the lead was placed centrally in the target STN, the directional leads were able to activate over 50% of the region, whereas the Medtronic 3389 could activate only 40%. When the lead was placed 2 mm lateral to the target, the directional leads performed as well as they did in the central position, but the Medtronic 3389 activated only 2.9% of the STN. This DBS programming algorithm can be applied to cylindrical electrodes as well as novel directional leads that are too complex with modern technology to be manually programmed. This algorithm may reduce clinical programming time and encourage the use of directional leads, since they activate a larger volume of the target area than cylindrical electrodes in central and off-target lead placements.
Cylindrical implosion to measure the radiative properties of high density and temperature plasmas
International Nuclear Information System (INIS)
Xu Yan; Rose, S.J.
2000-01-01
Cylindrical implosion is of great interest because of its excellent diagnostic access. The authors present one-dimensional numerical simulations to explore the plasma conditions that may be achieved. Combined with the numerical data, the development of Rayleigh-Taylor instabilities and Richtmyer-Meshkov instabilities in those targets are estimated. The authors found that it is possible to achieve a high density and temperature plasma with a relatively low temperature and density gradient using a cylindrical implosion directly-driven by a high-power laser
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
Two-point method uncertainty during control and measurement of cylindrical element diameters
Glukhov, V. I.; Shalay, V. V.; Radev, H.
2018-04-01
The topic of the article is devoted to the urgent problem of the reliability of technical products geometric specifications measurements. The purpose of the article is to improve the quality of parts linear sizes control by the two-point measurement method. The article task is to investigate methodical extended uncertainties in measuring cylindrical element linear sizes. The investigation method is a geometric modeling of the element surfaces shape and location deviations in a rectangular coordinate system. The studies were carried out for elements of various service use, taking into account their informativeness, corresponding to the kinematic pairs classes in theoretical mechanics and the number of constrained degrees of freedom in the datum element function. Cylindrical elements with informativity of 4, 2, 1 and θ (zero) were investigated. The uncertainties estimation of in two-point measurements was made by comparing the results of of linear dimensions measurements with the functional diameters maximum and minimum of the element material. Methodical uncertainty is formed when cylindrical elements with maximum informativeness have shape deviations of the cut and the curvature types. Methodical uncertainty is formed by measuring the element average size for all types of shape deviations. The two-point measurement method cannot take into account the location deviations of a dimensional element, so its use for elements with informativeness less than the maximum creates unacceptable methodical uncertainties in measurements of the maximum, minimum and medium linear dimensions. Similar methodical uncertainties also exist in the arbitration control of the linear dimensions of the cylindrical elements by limiting two-point gauges.
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Analysis of Hall Probe Precise Positioning with Cylindrical Permanent Magnet
International Nuclear Information System (INIS)
Belicev, P.; Vorozhtsov, A.S.; Vorozhtsov, S.B.
2007-01-01
Precise positioning of a Hall probe for cyclotron magnetic field mapping, using cylindrical permanent magnets, was analyzed. The necessary permanent magnet parameters in order to achieve ±20 μm position precision, were determined. (author)
Cylindrical ionization chamber with compressed krypton
International Nuclear Information System (INIS)
Kuz'minov, V.V.; Novikov, V.M.; Pomanskii, A.A.; Pritychenko, B.V.; Viyar, J.; Garcia, E.; Morales, A.; Morales, J.; Nunes-Lagos, R.; Puimedon, J.; Saens, K.; Salinas, A.; Sarsa, M.
1993-01-01
A cylindrical ionization chamber with a grid is used to search for double positron decay and atomic electron conversion to a positron in 78 Kr. Krypton is the working gas material of the chamber. The spectrometric characteristics of the chamber filled with krypton and xenon are presented. The energy resolution is 2.1% for an energy of 1.84 MeV (the source of γ-quanta is 88 Y) when the chamber is filled with a mixture of Kr+0.2% H 2 under a pressure of 25 atm
Fast, inexpensive, diffraction limited cylindrical microlenses
International Nuclear Information System (INIS)
Synder, J.J.; Reichert, P.
1991-01-01
We have developed a technique for fabricating fast, well corrected cylindrical microlenses. With this technique we have made a number of different microlenses with dimensions and focal lengths in the range of few hundred μm, and diffraction limited numerical apertures as high as 0.9. The microlenses are specifically designed for applications where they can increase the radiance or otherwise enhance the optical characteristics of laser diode light. The fabrication method we use is very versatile, and the microlenses produced this way would be very inexpensive in production quantities. 6 refs., 4 figs
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
A winning strategy for 3 x n Cylindrical Hex
DEFF Research Database (Denmark)
Huneke, S. C.; Hayward, R.; Toft, Bjarne
2014-01-01
For Cylindrical Hex on a board with circumference 3, we give a winning strategy for the end-to-end player. This is the first known winning strategy for odd circumference at least 3, answering a question of David Gale. (C) 2014 Elsevier B.V. All rights reserved....
Nonlinear finite element formulation for analyzing shape memory alloy cylindrical panels
International Nuclear Information System (INIS)
Mirzaeifar, R; Shakeri, M; Sadighi, M
2009-01-01
In this paper, a general incremental displacement based finite element formulation capable of modeling material nonlinearities based on first-order shear deformation theory (FSDT) is developed for cylindrical shape memory alloy (SMA) shells. The Boyd–Lagoudas phenomenological model with polynomial hardening in conjunction with 3D incremental convex cutting plane explicit algorithm is implemented for preparing the SMA constitutive model in the finite element formulation. Several numerical examples are presented for demonstrating the performance of the proposed formulation in stress, deflection and phase transformation analysis of pseudoelastic behavior of shape memory cylindrical panels with various boundary conditions. Also, it is shown that the presented formulation can be implemented for studying plates and beams with rectangular cross section
Energy Technology Data Exchange (ETDEWEB)
Li, Xing; Tang, Yao; Song, Junhua; Yang, Wei; Wang, Mingshan; Zhu, Chengzhou; Zhao, Wengao; Zheng, Jianming; Lin, Yuehe
2018-04-30
A self-supporting and flexible activated carbon/carbon nanotube/reduced graphene oxide (AC/CNT/RGO) film has been rationally designed for constructing high- performance supercapacitor. The AC/CNT/RGO film is prepared by anchoring the AC particles with a 3D and porous framework built by hierarchically weaving the 1 D CNT and 2D RGO using their intrinsic van der Waals force. The CNT network is beneficial for improving the electronic conductivity of the electrode, while the AC particles could effectively suppress the aggregation of RGO and CNT due to their blocking effect. The synergistic effects among the AC, CNT and RGO validate the AC/CNT/RGO as a promising electrode for supercapacitor, exhibiting greatly enhanced electrochemical performances in comparison with the pure RGO film, pure CNT film and AC electrode. The AC/CNT/RGO electrode delivers a high specific capacitance of 101 F g-1 at the current density of 0.2 A g-1, offering a maximum energy density of 30.0 W h kg-1 in organic electrolyte at the cut-off voltage range of 0.001~3.0 V. The findings of this work open a new avenue for the design of self-supporting electrodes for the development of flexible and light weight energy storage supercapacitor.
Su, Jinghong; Chen, Xiaodong; Hu, Guoqing
2018-03-01
Inertial migration has emerged as an efficient tool for manipulating both biological and engineered particles that commonly exist with non-spherical shapes in microfluidic devices. There have been numerous studies on the inertial migration of spherical particles, whereas the non-spherical particles are still largely unexplored. Here, we conduct three-dimensional direct numerical simulations to study the inertial migration of rigid cylindrical particles in rectangular microchannels with different width/height ratios under the channel Reynolds numbers (Re) varying from 50 to 400. Cylindrical particles with different length/diameter ratios and blockage ratios are also concerned. Distributions of surface force with the change of rotation angle show that surface stresses acting on the particle end near the wall are the major contributors to the particle rotation. We obtain lift forces experienced by cylindrical particles at different lateral positions on cross sections of two types of microchannels at various Re. It is found that there are always four stable equilibrium positions on the cross section of a square channel, while the stable positions are two or four in a rectangular channel, depending on Re. By comparing the equilibrium positions of cylindrical particles and spherical particles, we demonstrate that the equivalent diameter of cylindrical particles monotonously increases with Re. Our work indicates the influence of a non-spherical shape on the inertial migration and can be useful for the precise manipulation of non-spherical particles.
Seismic behavior of a low-rise horizontal cylindrical tank
Fiore, Alessandra; Rago, Carlo; Vanzi, Ivo; Greco, Rita; Briseghella, Bruno
2018-05-01
Cylindrical storage tanks are widely used for various types of liquids, including hazardous contents, thus requiring suitable and careful design for seismic actions. The study herein presented deals with the dynamic analysis of a ground-based horizontal cylindrical tank containing butane and with its safety verification. The analyses are based on a detailed finite element (FE) model; a simplified one-degree-of-freedom idealization is also set up and used for verification of the FE results. Particular attention is paid to sloshing and asynchronous seismic input effects. Sloshing effects are investigated according to the current literature state of the art. An efficient methodology based on an "impulsive-convective" decomposition of the container-fluid motion is adopted for the calculation of the seismic force. The effects of asynchronous ground motion are studied by suitable pseudo-static analyses. Comparison between seismic action effects, obtained with and without consideration of sloshing and asynchronous seismic input, shows a rather important influence of these conditions on the final results.
Rayleigh-Taylor instability of cylindrical jets with radial motion
International Nuclear Information System (INIS)
Chen, X.M.; Schrock, V.E.; Peterson, P.F.
1997-01-01
Rayleigh-Taylor instability of an interface between fluids with different densities subjected to acceleration normal to itself has interested researchers for almost a century. The classic analyses of a flat interface by Rayleigh and Taylor have shown that this type of instability depends on the direction of acceleration and the density differences of the two fluids. Plesset later analyzed the stability of a spherically symmetric flows (and a spherical interface) and concluded that the instability also depends on the velocity of the interface as well as the direction and magnitude of radial acceleration. The instability induced by radial motion in cylindrical systems seems to have been neglected by previous researchers. This paper analyzes the Rayleigh-Taylor type of instability for a cylindrical surface with radial motions. The results of the analysis show that, like the spherical case, the radial velocity also plays an important role. As an application, the example of a liquid jet surface in an Inertial Confinement Fusion (ICF) reactor design is analyzed. (orig.)
Numerical solutions to critical problem of reflected cylindrical reactor
International Nuclear Information System (INIS)
Horie, Junnosuke
1977-01-01
The multi-region critical problem can be transformed into an eigenvalue problem in the classical sense by using the method of Kuscer and Corngold and of Wing. This transformation is applied to derive a variational formulation for a reflected reactor. An approximate critical value of the multiplying factor is determined by maximizing the Rayleigh quotient for radially and totally reflected cylindrical reactors. It is shown that this approximate critical value is an upper bound of the true critical value. From the facts that the operator is self-adjoint and the eigenfunction is positive, an expression is derived for the upper and lower bounds of the true eigenvalue, by making use of the approximate distribution. The difference of the upper and lower bounds is an uncertainty of the presumption of the true critical value. It is found that we can compute the bounds to any required precision. The narrow bounds are calculated for two radially and one totally reflected cylindrical reactors. (auth.)
Design of AC-DC Grid Connected Converter using Multi-Objective Optimization
Directory of Open Access Journals (Sweden)
Piasecki Szymon
2014-05-01
Full Text Available Power electronic circuits, in particular AC-DC converters are complex systems, many different parameters and objectives have to be taken into account during the design process. Implementation of Multi-Objective Optimization (MOO seems to be attractive idea, which used as designer supporting tool gives possibility for better analysis of the designed system. This paper presents a short introduction to the MOO applied in the field of power electronics. Short introduction to the subject is given in section I. Then, optimization process and its elements are briefly described in section II. Design procedure with proposed optimization parameters and performance indices for AC-DC Grid Connected Converter (GCC interfacing distributed systems is introduced in section III. Some preliminary optimization results, achieved on the basis of analytical and simulation study, are shown at each stage of designing process. Described optimization parameters and performance indices are part of developed global optimization method dedicated for ACDC GCC introduced in section IV. Described optimization method is under development and only short introduction and basic assumptions are presented. In section V laboratory prototype of high efficient and compact 14 kVA AC-DC converter is introduced. The converter is elaborated based on performed designing and optimization procedure with the use of silicon carbide (SiC power semiconductors. Finally, the paper is summarized and concluded in section VI. In presented work theoretical research are conducted in parallel with laboratory prototyping e.g. all theoretical ideas are verified in laboratory using modern DSP microcontrollers and prototypes of the ACDC GCC.
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
Analysis of Experimental Research on Cyclones with Cylindrical and Spiral Shells
Directory of Open Access Journals (Sweden)
Aleksandras Chlebnikovas
2012-12-01
Full Text Available The conducted investigation is aimed at providing information on air flow parameters in the cylindrical and spiral shell (devices are designed for separating solid particles from air flow having tangent flow inlet. Experimental research has employed multi-cyclones created by the Department of Environmental Protection at Vilnius Gediminas Technical University. The study is focused on investigating and comparing the distribution of the dynamic pressure of the airflow in six-channel cyclones inside the structures of devices. The paper establishes and estimates the efficiency of air cleaning changing air phase parameters using different particulate matters. The efficiency of the cyclone has been defined applying the weighted method based on LAND 28-98/M-08 methodology. The article presents the results of experimental research on the air cleaning efficiency of cylindrical and spiral shells using 20 µm glass and clay particulate matter under the initial concentration that may vary from 500 mg/m3 to 15 g/m3 using semi-rings with windows at different positions. The obtained results has shown that the maximum efficiency of the cylindrical shell increases up to 87,3 % while the initial concentration of glass makes 15 g/m3.Article in Lithuanian
A linear magnetic motor and generator
Studer, P. A.
1980-01-01
In linear magnetic motor and generator suitable for remote and hostile environments, magnetic forces drive reciprocating shaft along its axis. Actuator shaft is located in center of cylindrical body and may be supported by either contacting or noncontacting bearings. When device operates as bidirectional motor, drive coil selectively adds and subtracts magnetic flux to and from flux paths, producing forces that drive actuator along axis. When actuator is driven by external reciprocating engine, device becomes ac generator.
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Directory of Open Access Journals (Sweden)
Wenyi Huo
2016-01-01
Full Text Available The octahedral spherical hohlraums have natural superiority in maintaining high radiation symmetry during the entire capsule implosion process in indirect drive inertial confinement fusion. While, in contrast to the cylindrical hohlraums, the narrow space between the laser beams and the spherical hohlraum wall is usually commented. In this Letter, we address this crucial issue and report our experimental work conducted on the SGIII-prototype laser facility which unambiguously demonstrates that a simple design of cylindrical laser entrance hole (LEH can dramatically improve the laser propagation inside the spherical hohlraums. In addition, the laser beam deflection in the hohlraum is observed for the first time in the experiments. Our 2-dimensional simulation results also verify qualitatively the advantages of the spherical hohlraums with cylindrical LEHs. Our results imply the prospect of adopting the cylindrical LEHs in future spherical ignition hohlraum design.
Replacing the IRAF/PyRAF Code-base at STScI: The Advanced Camera for Surveys (ACS)
Lucas, Ray A.; Desjardins, Tyler D.; STScI ACS (Advanced Camera for Surveys) Team
2018-06-01
IRAF/PyRAF are no longer viable on the latest hardware often used by HST observers, therefore STScI no longer actively supports IRAF or PyRAF for most purposes. STScI instrument teams are in the process of converting all of our data processing and analysis code from IRAF/PyRAF to Python, including our calibration reference file pipelines and data reduction software. This is exemplified by our latest ACS Data Handbook, version 9.0, which was recently published in February 2018. Examples of IRAF and PyRAF commands have now been replaced by code blocks in Python, with references linked to documentation on how to download and install the latest Python software via Conda and AstroConda. With the temporary exception of the ACS slitless spectroscopy tool aXe, all ACS-related software is now independent of IRAF/PyRAF. A concerted effort has been made across STScI divisions to help the astronomical community transition from IRAF/PyRAF to Python, with tools such as Python Jupyter notebooks being made to give users workable examples. In addition to our code changes, the new ACS data handbook discusses the latest developments in charge transfer efficiency (CTE) correction, bias de-striping, and updates to the creation and format of calibration reference files among other topics.
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Rotating solitary wave at the wall of a cylindrical container
Amaouche, Mustapha; Ait Abderrahmane, Hamid; Vatistas, Georgios H.
2013-01-01
This paper deals with the theoretical modeling of a rotating solitary surface wave that was observed during water drainage from a cylindrical reservoir, when shallow water conditions were reached. It represents an improvement of our previous study
International Nuclear Information System (INIS)
Gadalla, M.A.
1992-01-01
This paper presents an overview analyses of the thermal instability or thermal viability of infinite cylindrical structures with non-linear and non-uniform internal heat generation. The structure may be subjected to different and combined boundary conditions. An analytical solution is obtained for the generalized problem in spite of the non-linearity and the non-homogeneity of the source term. Four case studies with different boundary conditions are presented. The analyses show that the critical parameter for thermal stability may be though of as an altitude of surface below which the cylindrical structure will be thermally stable and performance worthy. The results also show that the bounds of thermal stability of a cylindrical structure system (solid or hollow) is eminently determined by the boundary conditions to which the system is subjected and can significantly alter the life-span of the structure
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
Magnetoresistance of cylindrical nanowires with artificial pinning site
Vidal, Enrique Vilanova; Mohammed, H.; Ivanov, I.; Kosel, Jü rgen
2015-01-01
New concepts of magnetic memory devices are exploiting the movement of data bits by current induced domain wall motion. This concept has been widely explored with rectangular nanowires (NWs) or stripes both theoretically and experimentally [1]. In the case of cylindrical NWs not much progress has been made on the experimental side, despite its promising advantages like the absence of Walker breakdown [2].
Magnetoresistance of cylindrical nanowires with artificial pinning site
Vidal, Enrique Vilanova
2015-05-01
New concepts of magnetic memory devices are exploiting the movement of data bits by current induced domain wall motion. This concept has been widely explored with rectangular nanowires (NWs) or stripes both theoretically and experimentally [1]. In the case of cylindrical NWs not much progress has been made on the experimental side, despite its promising advantages like the absence of Walker breakdown [2].
Thermal modeling of cylindrical lithium ion battery during discharge cycle
International Nuclear Information System (INIS)
Jeon, Dong Hyup; Baek, Seung Man
2011-01-01
Highlights: → Transient and thermo-electric finite element analysis (FEA) of cylindrical lithium ion (Li-ion) battery was presented. → This model provides the thermal behavior of Li-ion battery during discharge cycle. → A LiCoO 2 /C battery at various discharge rates was investigated. → The contribution of heat source due to joule heating was significant at a high discharge rate. → The contribution of heat source due to entropy change was dominant at a low discharge rate. - Abstract: Transient and thermo-electric finite element analysis (FEA) of cylindrical lithium ion (Li-ion) battery was presented. The simplified model by adopting a cylindrical coordinate was employed. This model provides the thermal behavior of Li-ion battery during discharge cycle. The mathematical model solves conservation of energy considering heat generations due to both joule heating and entropy change. A LiCoO 2 /C battery at various discharge rates was investigated. The temperature profile from simulation had similar tendency with experiment. The temperature profile was decomposed with contributions of each heat sources and was presented at several discharge rates. It was found that the contribution of heat source due to joule heating was significant at a high discharge rate, whereas that due to entropy change was dominant at a low discharge rate. Also the effect of cooling condition and the LiNiCoMnO 2 /C battery were analyzed for the purpose of temperature reduction.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
DEFF Research Database (Denmark)
Hansen, Kristoffer Arnsfelt; Miltersen, Peter Bro; Vinay, V
2006-01-01
We consider the computational power of constant width polynomial size cylindrical circuits and nondeterministic branching programs. We show that every function computed by a Pi2 o MOD o AC0 circuit can also be computed by a constant width polynomial size cylindrical nondeterministic branching pro...
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Gamma ray absorption of cylindrical fissile material with dual shields
International Nuclear Information System (INIS)
Wu Chenyan; Cheng Yiying; Huang Yongyi; Lu Fuquan; Yang Fujia
2005-01-01
This work analyzed the gamma ray attenuation effect from the self-absorption and shield attenuation perspectively. An exact mathematical equation was given for the geometric factor of the cylindrical fissile material with dual shields. In addition, several approximation approaches suitable for real situation were discussed, especially in the radial and axial directions of the cylinders, since the G-factors have simple forms. Then the space distribution patterns of the G-factor were analyzed based on numerical result and effective ways to solved the geometric information of the cylindrical fissile material, the radii and the heights, were deduced. This method was checked and verified by numerical calculation. Because of the efficiency of the method, it is ideal for application in real situations, such as nuclear safeguards, which demands speed of detection and accuracy of geometric analysis. (authors)
Dynamics of cylindrical domain walls in smectic C liquid crystals
International Nuclear Information System (INIS)
Stewart, I W; Wigham, E J
2009-01-01
An analysis of the dynamics of cylindrical domain walls in planar aligned samples of smectic C liquid crystals is presented. A circular magnetic field, induced by an electric current, drives a time-dependent reorientation of the corresponding radially dependent director field. Nonlinear approximations to the relevant nonlinear dynamic equation, derived from smectic continuum theory, are solved in a comoving coordinated frame: exact solutions are found for a π-wall and numerical solutions are calculated for π/2-walls. Each calculation begins with an assumed initial state for the director that is a prescribed cylindrical domain wall. Such an initial wall will proceed to expand or contract as its central core propagates radially inwards or outwards, depending on the boundary conditions for the director, the elastic constants, the magnitude of the field and the sign of the magnetic anisotropy of the liquid crystal
Millimeter Wave Imaging System Using Monopole Antenna with Cylindrical Reflector and Silicon Lens
Mizuno, Maya; Fukunaga, Kaori; Suzuki, Masaki; Saito, Shingo; Fujii, Katsumi; Hosako, Iwao; Yamanaka, Yukio
2011-04-01
We built a reflection imaging system that uses a monopole antenna with a cylindrical reflector and silicon semi-spherical lens for millimeter waves to identify detachments of alabaster from support material such as wood and stone, which can be subject to painting deterioration. Based on the electric field property near the monopole antenna in the system and the lens effect, the system was able to clearly image a test sample made of 2-mm width aluminium tape, which was placed within a range of approximately 10 mm from the lens. In practical imaging testing using a detachment model, which consists of alabaster and wood plating, the result also showed the possibility of observing slight detachment of the alabaster from the wood more easily than an imaging with large numerical aperture.
The large cylindrical drift chamber of TASSO
International Nuclear Information System (INIS)
Boerner, H.; Fischer, H.M.; Hartmann, H.; Loehr, B.; Wollstadt, M.; Fohrmann, R.; Schmueser, P.; Cassel, D.G.; Koetz, U.; Kowalski, H.
1980-03-01
We have built and operated a large cylindrical drift chamber for the TASSO experiment at the DESY storage ring, PETRA. The chamber has a length of 3.5 m, a diameter of 2.5 m, and a total of 2340 drift cells. The cells are arranged in 15 concentric layers such that tracks can be reconstructed in three dimensions. A spatial resolution of 220 μm has been achieved for tracks of normal incidence on the drift cells. (orig.)
Linear simulations of the cylindrical Richtmyer-Meshkov instability in magnetohydrodynamics
Bakhsh, Abeer; Gao, Song; Samtaney, Ravi; Wheatley, V.
2016-01-01
fusion and suppression by means of a magnetic field, we investigate the RMI via linear MHD simulations in cylindrical geometry. The physical setup is that of a Chisnell-type converging shock interacting with a density interface with either axial
Energy Technology Data Exchange (ETDEWEB)
Bedington, Robert, E-mail: r.bedington@nus.edu.sg; Kataria, Dhiren; Smith, Alan
2015-09-01
The CATS (Cylindrical And Tiny Spectrometer) electrostatic optics geometry features multiple nested cylindrical analysers to simultaneously measure multiple energies of electron and multiple energies of ion in a configuration that is targeted at miniaturisation and MEMS fabrication. In the prototyped model, two configurations of cylindrical analyser were used, featuring terminating side-plates that caused particle trajectories to either converge (C type) or diverge (D type) in the axial direction. Simulations show how these different electrode configurations affect the particle focussing and instrument parameters; C-type providing greater throughputs but D-type providing higher resolving powers. The simulations were additionally used to investigate unexpected plate spacing variations in the as-built model, revealing that the k-factors are most sensitive to the width of the inter-electrode spacing at its narrowest point. - Highlights: • A new nested cylindrical miniaturised electrostatic analyser geometry is described. • “Converging” (C) and “diverging” (D) type channel properties are investigated. • C channels are shown to have greater throughputs and D greater resolving powers. • Plate factors are shown to be sensitive to the minimum in inter-electrode spacing.
Worwood, Daniel; Kellner, Quirin; Wojtala, Malgorzata; Widanage, W. D.; McGlen, Ryan; Greenwood, David; Marco, James
2017-04-01
Conventional cooling approaches that target either a singular tab or outer surface of common format cylindrical lithium-ion battery cells suffer from a high cell thermal resistance. Under an aggressive duty cycle, this resistance can result in the formation of large in-cell temperature gradients and high hot spot temperatures, which are known to accelerate ageing and further reduce performance. In this paper, a novel approach to internal thermal management of cylindrical battery cells to lower the thermal resistance for heat transport through the inside of the cell is investigated. The effectiveness of the proposed method is analysed for two common cylindrical formats when subject to highly aggressive electrical loading conditions representative of a high performance electric vehicle (EV) and hybrid electric vehicle (HEV). A mathematical model that captures the dominant thermal properties of the cylindrical cell is created and validated using experimental data. Results from the extensive simulation study indicate that the internal cooling strategy can reduce the cell thermal resistance by up to 67.8 ± 1.4% relative to single tab cooling, and can emulate the performance of a more complex pack-level double tab cooling approach whilst targeting cooling at a single tab.
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
Development of a cylindrical gas-fired furnace for reycling ...
African Journals Online (AJOL)
This study presents the development of a cylindrical gas-fired furnace, which could be used for recycling aluminum in small-scale foundries in Nigeria. The crucible, combustion chamber, suspension shaft and bearings were appropriately sized. The furnace chamber was 410 mm high and 510 mm diameter and had a ...
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Sensitivity study of buckling strength for cylindrical shells
Energy Technology Data Exchange (ETDEWEB)
Kato, Hideo; Sasaki, Toru [Institute of Nuclear Safety System Inc., Mihama, Fukui (Japan)
2001-09-01
Aiming at making clear buckling behavior of cylindrical shells under earthquake loadings, we investigated procedure of recent elastic-plastic buckling analysis by finite element method (FEM). Thereby it is confirmed that the buckling strength becomes as well as that of a shell with a cross section of a perfect cylinder, if we apply the first buckling eigenvector to imperfection mode and assume the maximum imperfection amplitude to be 1% of the wall thickness. And then, by carrying out sensitivity study of buckling with geometrical parameters, such as length (L), radius (R), wall thickness (t), and load parameter, such as pressure, we obtained several characteristics about buckling strength and buckling mode for cylindrical shells. From the geometrical parameter analysis, it is seen that bending buckling occurs for small R/t (thick wall) and elastic buckling occurs for 2{<=}L/R{<=}4 and R/t{>=}400. And from the load parameter analysis, it is shown that hoop stress caused by the inner pressure increases shear buckling strength but decreases bending buckling strength, and hoop stress by hydrostatic pressure changes buckling mode and generates local deformation. (author)
Guo, Wenjie; Li, Tianyun; Zhu, Xiang; Miao, Yuyue
2018-05-01
The sound-structure coupling problem of a cylindrical shell submerged in a quarter water domain is studied. A semi-analytical method based on the double wave reflection method and the Graf's addition theorem is proposed to solve the vibration and acoustic radiation of an infinite cylindrical shell excited by an axially uniform harmonic line force, in which the acoustic boundary conditions consist of a free surface and a vertical rigid surface. The influences of the complex acoustic boundary conditions on the vibration and acoustic radiation of the cylindrical shell are discussed. It is found that the complex acoustic boundary has crucial influence on the vibration of the cylindrical shell when the cylindrical shell approaches the boundary, and the influence tends to vanish when the distances between the cylindrical shell and the boundaries exceed certain values. However, the influence of the complex acoustic boundary on the far-field sound pressure of the cylindrical shell cannot be ignored. The far-field acoustic directivity of the cylindrical shell varies with the distances between the cylindrical shell and the boundaries, besides the driving frequency. The work provides more understanding on the vibration and acoustic radiation behaviors of cylindrical shells with complex acoustic boundary conditions.
Directory of Open Access Journals (Sweden)
Gao Guo-Ping
2016-01-01
Full Text Available In this article, we investigate the local fractional 3-D compressible Navier-Stokes equation via local fractional derivative. We use the Cantor-type cylindrical co-ordinate method to transfer 3-D compressible Navier-Stokes equation from the Cantorian co-ordinate system to the Cantor-type cylindrical co-ordinate system.
Drug-eluting stents and bare metal stents in patients with NSTE-ACS
DEFF Research Database (Denmark)
Pedersen, Sune Haahr; Pfisterer, Matthias; Kaiser, Christoph
2014-01-01
the randomised BASKET-PROVE trial (sirolimus-eluting stent vs. everolimus-eluting stent vs. bare metal stent in large-vessel stenting). The primary endpoint was the combined two-year rate of cardiovascular death or non-fatal myocardial infarction (MI). Secondary endpoints were each component of the primary...... implantation in large vessels was associated with a reduction in both TVR and the combined endpoint consisting of cardiovascular death/MI. Thus, DES use improves both efficacy and safety. These findings support the use of DES in NSTE-ACS patients....
Performance Analysis of Functionally Graded Coatings in Contact with Cylindrical Rollers
Directory of Open Access Journals (Sweden)
Reza Jahedi
2015-01-01
Full Text Available This work presents finite element analysis (FEA and results for rolling contact of a cylindrical roller on an elastic substrate coated by functionally graded material (FGM. The rolling process and the graded coating material property and layers arrangement are modeled using finite element codes which lead to a new methodology. This novel methodology provides a trend in determining surface contact stresses, deformations, contact zones, and energy dissipation through the contact area. Effects of stiffness ratio, friction, and exponentially variation of material property on the contact stresses and deformations are studied. Some of the results are verified with analytical solutions. The study results may be beneficial in graded coated cylindrical components analysis against rolling contact failure and wear.
Modeling of cylindrical surrounding gate MOSFETs including the fringing field effects
International Nuclear Information System (INIS)
Gupta, Santosh K.; Baishya, Srimanta
2013-01-01
A physically based analytical model for surface potential and threshold voltage including the fringing gate capacitances in cylindrical surround gate (CSG) MOSFETs has been developed. Based on this a subthreshold drain current model has also been derived. This model first computes the charge induced in the drain/source region due to the fringing capacitances and considers an effective charge distribution in the cylindrically extended source/drain region for the development of a simple and compact model. The fringing gate capacitances taken into account are outer fringe capacitance, inner fringe capacitance, overlap capacitance, and sidewall capacitance. The model has been verified with the data extracted from 3D TCAD simulations of CSG MOSFETs and was found to be working satisfactorily. (semiconductor devices)
Institute of Scientific and Technical Information of China (English)
PENG Fan; FU YiMing; CHEN YaoJun
2008-01-01
The effect of matrix cracking on the bifurcation creep buckling of viscoelastic laminated circular cylindrical shells is investigated. The viscoelastic behavior of laminas is modeled by Schapery's integral constitutive equation with growing ma-trix cracks. The values of damage variables are correlated to non-dimensional density of matrix cracks relying on the formulas from meso-mechanics approach, and the evolution equation predicting the growth rate of density of matrix cracks is assumed to follow a power type relation with transverse tensile stress. The gov-erning equations for pre-buckling creep deformation and bifurcation buckling of laminated circular cylindrical shells under axial compression are obtained on the basis of the Donnell type shallow shell theory and Karman-Donnell geometrically nonlinear relationship. Corresponding solution strategy is constructed by inte-grating finite-difference technique, trigonometric series expansion method and Taylor's numerical recursive scheme for convolution integration. The bifurcation creep buckling of symmetrically laminated glass-epoxy circular cylindrical shells with matrix creep cracking coupled are examined for various geometrical parame-ters and parameters of damage evolution as well as boundary conditions. The nu-merical results show that matrix creep cracking remarkably shortens the critic time of bifurcation buckling and reduces the durable critic loads, and its effects become weak and finally vanish with the increase of the ratio of radius to thickness in the case of short laminated circular cylindrical shells, also the influence of the matrix creep cracking is mainly dependent on the boundary conditions at two ends for moderately long circular cylindrical shells.
Institute of Scientific and Technical Information of China (English)
2008-01-01
The effect of matrix cracking on the bifurcation creep buckling of viscoelastic laminated circular cylindrical shells is investigated.The viscoelastic behavior of laminas is modeled by Schapery’s integral constitutive equation with growing matrix cracks.The values of damage variables are correlated to non-dimensional density of matrix cracks relying on the formulas from mesomechanics approach,and the evolution equation predicting the growth rate of density of matrix cracks is assumed to follow a power type relation with transverse tensile stress.The governing equations for prebuckling creep deformation and bifurcation buckling of laminated circular cylindrical shells under axial compression are obtained on the basis of the Donnell type shallow shell theory and Kármán-Donnell geometrically nonlinear relationship.Corresponding solution strategy is constructed by integrating finite-difference technique,trigonometric series expansion method and Taylor’s numerical recursive scheme for convolution integration.The bifurcation creep buckling of symmetrically laminated glass-epoxy circular cylindrical shells with matrix creep cracking coupled are examined for various geometrical parameters and parameters of damage evolution as well as boundary conditions.The numerical results show that matrix creep cracking remarkably shortens the critic time of bifurcation buckling and reduces the durable critic loads,and its effects become weak and finally vanish with the increase of the ratio of radius to thickness in the case of short laminated circular cylindrical shells,also the influence of the matrix creep cracking is mainly dependent on the boundary conditions at two ends for moderately long circular cylindrical shells.
ELECTROMAGNETIC FIELDS IN CYLINDRICAL INDUCTION INDUCTOR SYSTEM WITH MASSIVE SHIELD
Directory of Open Access Journals (Sweden)
D. Piskun
2010-12-01
Full Text Available The processes in a cylindrical induction inductor system with a massive additional non-magnetic shield and a thin ferromagnetic sheet blank are considered and the formula for induced currents and the strength of excited fields have been obtained.
Response of an electrostatic probe for a right cylindrical spacer
DEFF Research Database (Denmark)
Rerup, T; Crichton, George C; McAllister, Iain Wilson
1994-01-01
During the last decade many experimental studies of surface charge phenomena have been undertaken employing right cylindrical spacers. Measurement of the surface charge was performed using small electrostatic field probes to scan across the dielectric surface. Charges are electrostatically induced...
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
Chaotic Dynamics of Cage Behavior in a High-Speed Cylindrical Roller Bearing
Directory of Open Access Journals (Sweden)
Long Chen
2016-01-01
Full Text Available This paper presents a mathematical model to investigate the nonlinear dynamic behavior of cage in high-speed cylindrical bearing. Variations of cage behavior due to varying cage eccentricity and cage guidance gap are observed. Hydrodynamic behavior in cage contacts is taken into consideration for a more realistic calculation of acting forces owing to high working speed. Analysis of real-time cage dynamic behavior on radial plane is carried out using chaos theory based on the theoretical and mathematical model established in the paper. The analytical results of this paper provide a solid foundation for designing and manufacturing of high-speed cylindrical roller bearing.
M.Janardhan; Dr.A.Gopala Krishna
2011-01-01
Cylindrical grinding is one of the important metal cutting processes used extensively in the finishing operations. Metal removal rate and surface finish are the important out put responses in the production with respect to quantity and quality respectively. The Experiments are conducted on CNC cylindrical grinding machine with L9 Orthogonal array with input machining variables as work speed, feed rate and depth of cut. Empirical models are developed using design of experiments and response su...
Thermal convection in a co-rotating cylindrical annulus
Kang, Changwoo; Meyer, Antoine; Mutabazi, Innocent
2017-11-01
We investigate thermal convection in a fluid of thermal expansion coefficient α, kinematic viscosity ν, thermal diffusivity κ in a cylindrical annulus of inner radius a and outer radius bwith a solid body rotation of angular frequency Ω and an inward heating with a temperature difference ΔT. The control parameters are η = a/b, Pr = ν / κ and the Rayleigh number Ra = αΔ T gd3 / νκ where the centrifugal gravity gc =Ω2 (a +b)/2. We adopt the generalized Boussinesq approximation. Linear stability analysis shows that for infinite annulus, the threshold Rac decreases with η and tends to the value Rac = 1708 when η -> 1 and that critical modes are columnar vortices. Direct numerical simulations using periodic boundary conditions in the axial direction, show that the columnar vortices appear via a supercritical bifurcation. Higher modes of columnar vortices have been determined using the frequency spectra and the Nusselt number for Pr =1 and η = 0.5 : drifting vortices, vacillation modes and chaotic modes have been identified from Ra =1700 to Ra =107 The contribution of the centrifugal buoyancy to the variation of the kinetic energy in the flow is analysed. This work was supported by the project BIOENGINE (CPER-FEDER, Normandie) and CNES.
Support media can steer methanogenesis in the presence of phenol through biotic and abiotic effects.
Poirier, Simon; Déjean, Sébastien; Chapleur, Olivier
2018-09-01
A wide variety of inhibitors can induce anaerobic digester disruption. To avoid performance losses, support media can be used to mitigate inhibitions. However, distinguishing the physico-chemical from the biological mechanisms of such strategies remains delicate. In this framework, the impact of 10 g/L of different types of zeolites and activated carbons (AC) on microbial community dynamics during anaerobic digestion of biowaste in the presence of 1.3 g/L of phenol was evaluated with 16 S rRNA gene sequencing. In the presence of AC, methanogenesis inhibition was rapidly removed due to a decrease of phenol concentration. This abiotic effect related to the physico-chemical properties of AC led to increased final CH4 and CO2 productions by 29-31% compared to digesters incubated without support. Interestingly, although zeolite did not adsorb phenol, final CH4 and CO2 production reached comparable levels as with AC. Nevertheless, compared to digesters incubated without support, methanogenesis lag phase duration was less reduced in the presence of zeolites (5 ± 1 days) than in the presence of activated carbons (12 ± 2 days). Both types of support induced biotic effects. AC and zeolite both allowed the preservation of the major representative archaeal genus of the non-inhibited ecosystem, Methanosarcina. By contrast, they distinctly shaped bacterial populations. OTUs belonging to class W5 became dominant at the expense of OTUs assigned to orders Clostridiales, Bacteroidales and Anaerolinales in the presence of AC. Zeolite enhanced the implantation of OTUs assigned to bacterial phylum Cloacimonetes. This study highlighted that supports can induce biotic and abiotic effects within digesters inhibited with phenol, showing potentialities to enhance anaerobic digestion stability under disrupting conditions. Copyright © 2018 Elsevier Ltd. All rights reserved.
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
An approximate solution for spherical and cylindrical piston problem
Indian Academy of Sciences (India)
the growth and decay of shock strengths for spherical and cylindrical pistons starting from a non-zero ... conditions at an appropriate level, a new theory of shock dynamics (NTSD) has been proposed (Ravindran and ..... sive, its packing density etc. which are not included in our mathematical formulation, it may explain the ...
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Energy Technology Data Exchange (ETDEWEB)
Cho, Seung Hyun; Park, Jae Ha; Kwon, Hyu Sang; Ahn, Bong Young; Lee, Seung Seok [Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of)
2009-10-15
Cylindrical structures such as pipes and shafts are widely used in various industrial facilities. Recently, researches on magnetostrictive transduction of torsional waves have been actively reported for the nondestructive evaluation of those cylindrical structures. However, the existing magnetostrictive patch transducer has somewhat inconvenient and time. Consuming process like patch bonding to a structure since it should employ a magnetostrictive patch having strong magnetostriction. To overcome these limitations of the existing transducer, in this work, we develop a novel modular magnetostrictive transducer to generate and measure torsional waves to inspect a cylindrical structure. The proposed transducer can be applied as viscous liquid coupling with shear couplant or dry coupling without coupling media instead of patch bonding to a structure. We describe a detailed structure of the modular transducer and conduct some experiments to verify its performance
International Nuclear Information System (INIS)
Cho, Seung Hyun; Park, Jae Ha; Kwon, Hyu Sang; Ahn, Bong Young; Lee, Seung Seok
2009-01-01
Cylindrical structures such as pipes and shafts are widely used in various industrial facilities. Recently, researches on magnetostrictive transduction of torsional waves have been actively reported for the nondestructive evaluation of those cylindrical structures. However, the existing magnetostrictive patch transducer has somewhat inconvenient and time. Consuming process like patch bonding to a structure since it should employ a magnetostrictive patch having strong magnetostriction. To overcome these limitations of the existing transducer, in this work, we develop a novel modular magnetostrictive transducer to generate and measure torsional waves to inspect a cylindrical structure. The proposed transducer can be applied as viscous liquid coupling with shear couplant or dry coupling without coupling media instead of patch bonding to a structure. We describe a detailed structure of the modular transducer and conduct some experiments to verify its performance
Energy Technology Data Exchange (ETDEWEB)
Setare, M.R. [Department of Science, Campus of Bijar, University of Kurdistan,Bijar (Iran, Islamic Republic of); Sepehri, A. [Faculty of Physics, Shahid Bahonar University,P.O. Box 76175, Kerman (Iran, Islamic Republic of)
2015-03-16
In this paper, we consider the stability of cylindrical wormholes during evolution of universe from inflation to late time acceleration epochs. We show that there are two types of cylindrical wormholes. The first type is produced at the corresponding point where k black F-strings are transited to BIon configuration. This wormhole transfers energy from extra dimensions into our universe, causes inflation, loses it’s energy and vanishes. The second type of cylindrical wormhole is created by a tachyonic potential and causes a new phase of acceleration. We show that wormhole parameters grow faster than the scale factor in this era, overtake it at ripping time and lead to the destruction of universe at big rip singularity.
Directory of Open Access Journals (Sweden)
Xiaochao Jin
Full Text Available The cavity expansion theory is most widely used to predict the depth of penetration of concrete targets. The main purpose of this work is to clarify the differences between the spherical and cylindrical cavity expansion models and their scope of application in predicting the penetration depths of concrete targets. The factors that influence the dynamic cavity expansion process of concrete materials were first examined. Based on numerical results, the relationship between expansion pressure and velocity was established. Then the parameters in the Forrestal's formula were fitted to have a convenient and effective prediction of the penetration depth. Results showed that both the spherical and cylindrical cavity expansion models can accurately predict the depth of penetration when the initial velocity is lower than 800 m/s. However, the prediction accuracy decreases with the increasing of the initial velocity and diameters of the projectiles. Based on our results, it can be concluded that when the initial velocity is higher than the critical velocity, the cylindrical cavity expansion model performs better than the spherical cavity expansion model in predicting the penetration depth, while when the initial velocity is lower than the critical velocity the conclusion is quite the contrary. This work provides a basic principle for selecting the spherical or cylindrical cavity expansion model to predict the penetration depth of concrete targets.
Experimental transient natural convection heat transfer from a vertical cylindrical tank
International Nuclear Information System (INIS)
Fernandez-Seara, Jose; Uhia, Francisco J.; Alberto Dopazo, J.
2011-01-01
In this paper heat transfer experimental data is presented and compared to general correlations proposed in the literature for transient laminar free convection from a vertical cylindrical tank. The experimental data has been obtained from heating and cooling experiments carried out with a cylindrical full-scale hot water storage tank working under real operating conditions. The experimental device and the data acquisition system are described. The calculation procedures established to obtain the experimental values of the heat transfer coefficients, as well as the data reduction process, are detailed. The local convection and radiation heat transfer coefficients are obtained from different heating power conditions for local Rayleigh numbers within the range of 1x10 5 -3x10 8 . The great quantity of available experimental data allows a detailed analysis with a reliable empirical base. The experimental local convection heat transfer coefficients are correlated and compared to correlations proposed in open literature for engineering calculations. - Highlights: → Experimental data of transient local convection heat transfer coefficients from a cylindrical tank for heating and cooling processes is obtained. → The transient behaviour of the convection coefficients is dependent on temperature difference evolutions between the surface and the air. → The Nu.Ra -1/4 ratio decreases proportionally in (T s -T ∞ ) -0.9 . → A new correlation based on the semi-infinite region theory for laminar transient free convection is proposed.
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
Electron Cross-field Transport in a Miniaturized Cylindrical Hall Thruster
International Nuclear Information System (INIS)
Smirnov Artem; Raitses Yevgeny; Fisch Nathaniel J
2005-01-01
Conventional annular Hall thrusters become inefficient when scaled to low power. Cylindrical Hall thrusters, which have lower surface-to-volume ratio, are more promising for scaling down. They presently exhibit performance comparable with conventional annular Hall thrusters. The present paper gives a review of the experimental and numerical investigations of electron crossfield transport in the 2.6 cm miniaturized cylindrical Hall thruster (100 W power level). We show that, in order to explain the discharge current observed for the typical operating conditions, the electron anomalous collision frequency ν b has to be on the order of the Bohm value, ν B ∼ ω c /16. The contribution of electron-wall collisions to cross-field transport is found to be insignificant. The optimal regimes of thruster operation at low background pressure (below 10 -5 Torr) in the vacuum tank appear to be different from those at higher pressure (∼ 10 -4 Torr)
Self-consistent equilibrium in a cylindrical, dissipative reverse field pinch
International Nuclear Information System (INIS)
Guo, S.C.; Paccagnella, R.
1994-01-01
One of the authors (C.L.S.) recently proposed a dissipative model to self-consistently solve the equilibrium problem in a free-boundary plasma column under cylindrical symmetry. In the present paper, on one hand the problem is strongly specialized to circular symmetry and to Ohm's and Fourier's laws without off-diagonal contributions; on the other hand, it is generalized by adding a dynamo effective electric field E d in Ohm's law, based on the standard turbulent model. This seems appropriate enough to study RFP equilibria, since it is well known that a stationary and cylindrically symmetric RFP is incompatible with a classical Ohm's law. Reasonably, only numerical solutions are expected to be accessible in general; but the further simplified problem with scalar and constant electric resistivity and constant dynamo coefficient α (E d =αB) can be solved analytically by elementary means. (author) 4 refs., 2 figs
Recent advances in the modeling of plasmas with the Particle-In-Cell methods
Vay, Jean-Luc; Lehe, Remi; Vincenti, Henri; Godfrey, Brendan; Lee, Patrick; Haber, Irv
2015-11-01
The Particle-In-Cell (PIC) approach is the method of choice for self-consistent simulations of plasmas from first principles. The fundamentals of the PIC method were established decades ago but improvements or variations are continuously being proposed. We report on several recent advances in PIC related algorithms, including: (a) detailed analysis of the numerical Cherenkov instability and its remediation, (b) analytic pseudo-spectral electromagnetic solvers in Cartesian and cylindrical (with azimuthal modes decomposition) geometries, (c) arbitrary-order finite-difference and generalized pseudo-spectral Maxwell solvers, (d) novel analysis of Maxwell's solvers' stencil variation and truncation, in application to domain decomposition strategies and implementation of Perfectly Matched Layers in high-order and pseudo-spectral solvers. Work supported by US-DOE Contracts DE-AC02-05CH11231 and the US-DOE SciDAC program ComPASS. Used resources of NERSC, supported by US-DOE Contract DE-AC02-05CH11231.
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
The stresses and displacements in cylindrical shells subject to arbitrary temperature distribution
International Nuclear Information System (INIS)
Tabakman, H.D.; Lin, Y.J.
1977-01-01
The paper begins with a statement of a reciprocal theorem in thermoelasticity based on a generalization of Betti's Reciprocal Theorem. This is followed by application to the solution of a simply supported thin walled cylindrical shell subject to arbitrary three-dimensional temperature distribution T(x,y,z). The usefulness of the theorem resides in the fact that existing solutions in elasticity may be used to obtain solutions of thermoelastic problems. This characteristic is of great importance, particularly when the temperature distribution is arbitrary, as is often the case in practise, and cannot be expressed in functional form; thus rendering solution of the thermoelastic equations very difficult. With solutions of a wide range of problems in elasticity in existence, application of the thermoelastic theorem is the key to solution of a broad class of problems in thermoelasticity, problems that cannot be solved by the classic process. (Auth.)
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
Directory of Open Access Journals (Sweden)
Frederico Martins Alves da Silva
2015-01-01
Full Text Available This work investigates the influence of Young’s modulus, shells thickness, and geometrical imperfection uncertainties on the parametric instability loads of simply supported axially excited cylindrical shells. The Donnell nonlinear shallow shell theory is used for the displacement field of the cylindrical shell and the parameters under investigation are considered as uncertain parameters with a known probability density function in the equilibrium equation. The uncertainties are discretized as Hermite-Chaos polynomials together with the Galerkin stochastic procedure that discretizes the stochastic equation in a set of deterministic equations of motion. Then, a general expression for the transversal displacement is obtained by a perturbation procedure which identifies all nonlinear modes that couple with the linear modes. So, a particular solution is selected which ensures the convergence of the response up to very large deflections. Applying the standard Galerkin method, a discrete system in time domain that considers the uncertainties is obtained and solved by fourth-order Runge-Kutta method. Several numerical strategies are used to study the nonlinear behavior of the shell considering the uncertainties in the parameters. Special attention is given to the influence of the uncertainties on the parametric instability and time response, showing that the Hermite-Chaos polynomial is a good numerical tool.
Superconducting vortex dynamics in cylindrical Nb micro- and nanotubes
Energy Technology Data Exchange (ETDEWEB)
Fomin, Vladimir M. [Institute for Integrative Nanosciences, IFW-Dresden, D-01069 Dresden (Germany); Rezaev, Roman O. [Institute for Integrative Nanosciences, IFW-Dresden, D-01069 Dresden (Germany); Laboratory of Mathematical Physics, Tomsk Polytechnic University, 634050 Tomsk (Russian Federation); Schmidt, Oliver G. [Institute for Integrative Nanosciences, IFW-Dresden, D-01069 Dresden (Germany); Material Systems for Nanoelectronics, Chemnitz University of Technology, D-09107 Chemnitz (Germany)
2012-07-01
Advancements in fabrication of rolled-up micro- and nanotubes including superconductor layers (e.g., InGaAs/GaAs/Nb) open new ways for investigation of the vortex matter in superconductors with curved geometries. Geometry determines the dynamics of vortices in the presence of transport currents in open superconductor micro- and nanotubes subject to a magnetic field orthogonal to the axis. Vortices nucleate periodically at one edge of the tube, subsequently move along the tube under the action of the Lorentz force and denucleate at the opposite edge of the tube. Characteristic times of nonequilibrium vortex dynamics in an open tube are efficiently controlled by the tube radius. The magnetic field, at which the vortices begin to nucleate at the edge of the structure, is increased several times by rolling up a planar film in a tube. This effect is caused not only by a spatial dependence of the magnetic field component normal to the cylindrical surface, but also by correlations between the states of the superconducting order parameter in the opposite areas of the cylindrical surface.
Nonlinear Vibration and Mode Shapes of FG Cylindrical Shells
Directory of Open Access Journals (Sweden)
Saeed Mahmoudkhani
Full Text Available Abstract The nonlinear vibration and normal mode shapes of FG cylindrical shells are investigated using an efficient analytical method. The equations of motion of the shell are based on the Donnell’s non-linear shallow-shell, and the material is assumed to be gradually changed across the thickness according to the simple power law. The solution is provided by first discretizing the equations of motion using the multi-mode Galerkin’s method. The nonlinear normal mode of the system is then extracted using the invariant manifold approach and employed to decouple the discretized equations. The homotopy analysis method is finally used to determine the nonlinear frequency. Numerical results are presented for the backbone curves of FG cylindrical shells, nonlinear mode shapes and also the nonlinear invariant modal surfaces. The volume fraction index and the geometric properties of the shell are found to be effective on the type of nonlinear behavior and also the nonlinear mode shapes of the shell. The circumferential half-wave numbers of the nonlinear mode shapes are found to change with time especially in a thinner cylinder.
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Energy Technology Data Exchange (ETDEWEB)
Sinjeri, Lj; Kulisic, P [Elektra - Zagreb, Zagreb (Yugoslavia)
1990-07-01
Low radioactive sources were used for experimental determination of optimal dimensions for cylindrical source using coaxial Ge(Li) detector. Then, calculational procedure is used to find optimal dimensions of cylindrical source. The results from calculational procedure confirm with experimental results. In such way the verification of calculational procedure is done and it can be used for determination of optimal geometry for low radioactive cylindrical sources. (author)
Hai, Feng; Zhang, Qian-Cheng; Wang, Zhi-Wei; Jian, Li
2011-04-01
Using SiO2, activated carbon (AC) and Al2O3 as supports, the supported photocatalysts Ni-V-O/SiO2, Ni-V-O/AC and Ni-V-O/Al2O3 were prepared by impregnation method, and their spectralsignatures were investigated. The carbonylation of methanol with CO2 under UV irradiation was used as a probe reaction to compare the photocatalytic performance of the prepared catalysts. Integrated with the testing results of carbonylation, the effects of different supports on selectivity for the carbonylation products of methyl formate (MF) and dimethyl carbonate (DMC) were discussed by pyridine-IR and UV-Vis techniques. XRD results showed that the particles of nickel and vanadium supported on SiO2 had the highest degree of dispersion. Results of pyridine-IR indicated that all catalysts retained Lewis acid sites. The acid strength was different from catalyst samples with different supports but with the same active components. The acid strengths could be arranged as follows: Ni-V-O/SiO2 > Ni-V-O/Al2 O3 > Ni-V-O/AC. Different acid strengths exhibited different influence on the selectivity of products MF and DMC of carbonylation. The surface acid strengths of catalysts were the major factor influencing the selectivity of carbonylation products.
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry
Aragonite coating solutions (ACS) based on artificial seawater
Energy Technology Data Exchange (ETDEWEB)
Tas, A. Cuneyt, E-mail: c_tas@hotmail.com
2015-03-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.