WorldWideScience

Sample records for cyanobacteria arthrospira spirulina

  1. The effect of spirulina (Arthrospira platensis (Oscillatoriales: Cyanobacteria on the experimental breeding of Pseudosuccinea columella (Basommatophora: Lymnaeidae

    Directory of Open Access Journals (Sweden)

    Lucila Prepelitchi

    2015-06-01

    Full Text Available Snails of the family Lymnaeidae, as Pseudosuccinea columella, are the intermediate hosts of Fasciola hepatica, the causative agent of fasciolosis in human and livestock all over the world. A thorough knowledge of snail biology is essential for describing the transmission dynamics and for controlling this disease. Since food quality has had a significant effect on snail growth, fecundity and fertility, in this study we evaluated the use of spirulina (Arthrospira platensis as a food resource for the artificial breeding of P. columella, an invasive snail and the main intermediate host of F. hepatica in Northeastern Argentina. The main purpose was to measure the effect of spirulina on fitness parameters such as survival rate, growth rate, size at first reproduction, lifetime fecundity and viable offspring. A total of 20 676 newly-laid F2 eggs were used; half of them were fed with lettuce (treatment L and the other half with lettuce plus spirulina (treatment L+S. In comparison with P. columella snails fed only with lettuce, we found that P. columella fed with lettuce plus spirulina: 1 showed higher survival rates, 2 grew faster and showed higher growth increments, 3 attained sexual maturity earlier in time (L+S:60 days vs. L:120 days and at a smaller size (L+S:4.8mm vs. L:8.2mm, 4 had a longer reproductive period (L+S:150 days vs. L:90 days, 5 produced a higher number of eggs/snail (L+S:29.6 vs. L:13.3, and 6 showed a higher offspring hatching rate (L+S:70% vs. L:40%. The supplementation of P. columella diet with commercial spirulina enhances it fitness and improved the artificial breeding of this species. Spirulina may have a direct positive effect on P. columella development by consuming it, along with an indirect positive effect by improving the water quality. This rearing technique provided large number of reproducing adults and a continuous production of offspring, which are essential for developing future experimental studies in order to

  2. Biofunctionalized Nanofibers Using Arthrospira (Spirulina Biomass and Biopolymer

    Directory of Open Access Journals (Sweden)

    Michele Greque de Morais

    2015-01-01

    Full Text Available Electrospun nanofibers composed of polymers have been extensively researched because of their scientific and technical applications. Commercially available polyhydroxybutyrate (PHB and polyhydroxybutyrate-co-valerate (PHB-HV copolymers are good choices for such nanofibers. We used a highly integrated method, by adjusting the properties of the spinning solutions, where the cyanophyte Arthrospira (formally Spirulina was the single source for nanofiber biofunctionalization. We investigated nanofibers using PHB extracted from Spirulina and the bacteria Cupriavidus necator and compared the nanofibers to those made from commercially available PHB and PHB-HV. Our study assessed nanofiber formation and their selected thermal, mechanical, and optical properties. We found that nanofibers produced from Spirulina PHB and biofunctionalized with Spirulina biomass exhibited properties which were equal to or better than nanofibers made with commercially available PHB or PHB-HV. Our methodology is highly promising for nanofiber production and biofunctionalization and can be used in many industrial and life science applications.

  3. Health aspects of Spirulina (Arthrospira microalga food supplement

    Directory of Open Access Journals (Sweden)

    Sotiroudis Theodore G.

    2013-01-01

    Full Text Available Spirulina, now named Arthrospira, is a microscopic and filamentous cyanobacterium that has a long history of use as a safe food lacking toxicity. It is commercially produced in large outdoor ponds under controlled conditions. The aim of this review article is to summarize available recent information concerning human clinical potential and applications of Spirulina, as well as clinical data related to the safety and side effects of Spirulina. Potential health benefits of Spirulina are mainly due to its chemical composition, which includes proteins (the highest protein content of any natural food, 55%-70%, carbohydrates, essential amino acids, minerals (especially iron, essential fatty acids, vitamins, and pigments. In this respect, three major bioactive components of Spirulina, the protein phycocyanin (a biliprotein pigment, sulfated polysaccharides and gamma linolenic acid seem to play significant role in imparting improved human body functions. Furthermore, new experimental evidence supports the immunomodulation and antiviral effects of Spirulina supplementation. According to the Dietary Supplements Information Expert Committee of United States Pharmacopeial Convention the available clinical evidence does not indicate a serious risk to health or other public health concerns for Spirulina. However, a few cases of severe side-effects have been reported.

  4. Biological Effects of Spirulina (Arthrospira Biopolymers and Biomass in the Development of Nanostructured Scaffolds

    Directory of Open Access Journals (Sweden)

    Michele Greque de Morais

    2014-01-01

    Full Text Available Spirulina is produced from pure cultures of the photosynthetic prokaryotic cyanobacteria Arthrospira. For many years research centers throughout the world have studied its application in various scientific fields, especially in foods and medicine. The biomass produced from Spirulina cultivation contains a variety of biocompounds, including biopeptides, biopolymers, carbohydrates, essential fatty acids, minerals, oligoelements, and sterols. Some of these compounds are bioactive and have anti-inflammatory, antibacterial, antioxidant, and antifungal properties. These compounds can be used in tissue engineering, the interdisciplinary field that combines techniques from cell science, engineering, and materials science and which has grown in importance over the past few decades. Spirulina biomass can be used to produce polyhydroxyalkanoates (PHAs, biopolymers that can substitute synthetic polymers in the construction of engineered extracellular matrices (scaffolds for use in tissue cultures or bioactive molecule construction. This review describes the development of nanostructured scaffolds based on biopolymers extracted from microalgae and biomass from Spirulina production. These scaffolds have the potential to encourage cell growth while reducing the risk of organ or tissue rejection.

  5. Arthrospira (Spirulina) platensis supplementation affects folliculogenesis, progesterone and ghrelin levels in fattening pre-pubertal gilts

    NARCIS (Netherlands)

    Abadjieva, Desislava; Nedeva, Radka; Marchev, Yordan; Jordanova, Gergana; Chervenkov, Mihail; Dineva, Julieta; Shimkus, Almantas; Shimkiene, Aldona; Teerds, Katja; Kistanova, Elena

    2018-01-01

    The aim of the present investigation was to study the effect of Arthrospira (Spirulina) platensis supplemented diet on follicular development and related endocrine parameters, such as estradiol and progesterone levels as well as ghrelin levels in pre-pubertal gilts. Twenty-one 60-day-old Danube

  6. Antioxidant Effect of Spirulina (Arthrospira) maxima on Chronic Inflammation Induced by Freund's Complete Adjuvant in Rats.

    Science.gov (United States)

    Gutiérrez-Rebolledo, Gabriel Alfonso; Galar-Martínez, Marcela; García-Rodríguez, Rosa Virginia; Chamorro-Cevallos, Germán A; Hernández-Reyes, Ana Gabriela; Martínez-Galero, Elizdath

    2015-08-01

    One of the major mechanisms in the pathogenesis of chronic inflammation is the excessive production of reactive oxygen and reactive nitrogen species, and therefore, oxidative stress. Spirulina (Arthrospira) maxima has marked antioxidant activity in vivo and in vitro, as well as anti-inflammatory activity in certain experimental models, the latter activity being mediated probably by the antioxidant activity of this cyanobacterium. In the present study, chronic inflammation was induced through injection of Freund's complete adjuvant (CFA) in rats treated daily with Spirulina (Arthrospira) maxima for 2 weeks beginning on day 14. Joint diameter, body temperature, and motor capacity were assessed each week. On days 0 and 28, total and differential leukocyte counts and serum oxidative damage were determined, the latter by assessing lipid peroxidation and protein carbonyl content. At the end of the study, oxidative damage to joints was likewise evaluated. Results show that S. maxima favors increased mobility, as well as body temperature regulation, and a number of circulating leukocytes, lymphocytes, and monocytes in specimens with CFA-induced chronic inflammation and also protects against oxidative damage in joint tissue as well as serum. In conclusion, the protection afforded by S. maxima against development of chronic inflammation is due to its antioxidant activity.

  7. Proteomic analysis and qRT-PCR verification of temperature response to Arthrospira (Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Wang Huili

    Full Text Available Arthrospira (Spirulina platensis (ASP is a representative filamentous, non-N2-fixing cyanobacterium that has great potential to enhance the food supply and possesses several valuable physiological features. ASP tolerates high and low temperatures along with highly alkaline and salty environments, and can strongly resist oxidation and irradiation. Based on genomic sequencing of ASP, we compared the protein expression profiles of this organism under different temperature conditions (15°C, 35°Cand 45°C using 2-DE and peptide mass fingerprinting techniques. A total of 122 proteins having a significant differential expression response to temperature were retrieved. Of the positively expressed proteins, the homologies of 116 ASP proteins were found in Arthrospira (81 proteins in Arthrospira platensis str. Paraca and 35 in Arthrospira maxima CS-328. The other 6 proteins have high homology with other microorganisms. We classified the 122 differentially expressed positive proteins into 14 functions using the COG database, and characterized their respective KEGG metabolism pathways. The results demonstrated that these differentially expressed proteins are mainly involved in post-translational modification (protein turnover, chaperones, energy metabolism (photosynthesis, respiratory electron transport, translation (ribosomal structure and biogenesis and carbohydrate transport and metabolism. Others proteins were related to amino acid transport and metabolism, cell envelope biogenesis, coenzyme metabolism and signal transduction mechanisms. Results implied that these proteins can perform predictable roles in rendering ASP resistance against low and high temperatures. Subsequently, we determined the transcription level of 38 genes in vivo in response to temperature and identified them by qRT-PCR. We found that the 26 differentially expressed proteins, representing 68.4% of the total target genes, maintained consistency between transcription and

  8. Effect of lead on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez- Villagran, D.; Torres-Munoz, J. A.; Rios-Leal, E.; Aguilar-Lopez, R.; Dominguez-Bocanegra, A. R.

    2009-07-01

    The pollution of aquatic ecosystems caused by heavy metals from industrial and domestic sources leads to the bioaccumulation of these toxicants in cyanobacteria and microalgae with damage or inhibition of specific enzymes and transfer of metals through the food web (He et al., 1998). Moreover, even through ions of some metals, such as zinc, are involved in the metabolism of algae. (Author)

  9. Effect of Cadmium on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Munoz, J. A.; Aguilar-Lopez, R.; Hernandez-Villagran, D.; Neria-Gonzalez, M. I.; Rios-Leal, E.; Dominguez-Bocanegra, A. R.

    2009-07-01

    The removal of heavy metal by microorganisms can occur through several mechanisms, such as simple adsorption, absorption, enzymatic synthesis or through the production of extracellular polymers. Cadmium (CD), a metal released in most mining and metallurgical processes, is one of the main agents responsible for water pollution. In spite of the increasing amount of research published on the interaction of microorganisms with heavy metals, few work describe this interaction with cyanobacteria. (Author)

  10. Optimization of Arthrospira platensis (Spirulina Growth: From Laboratory Scale to Pilot Scale

    Directory of Open Access Journals (Sweden)

    Florian Delrue

    2017-11-01

    Full Text Available Arthrospira platensis (Spirulina is the most cultivated microalga worldwide. Improving its cultivation in terms of biomass productivity, quality, or production cost could significantly impact the Spirulina industry. The objectives of this paper were defined as to contribute to this goal. Spirulina biomass productivity was investigated through medium choice. A modified Zarrouk’s medium was selected as it gave higher final dry weights and longer sustained growth than Hiri’s and Jourdan’s media. Then, in order to reduce Spirulina production cost, modified Zarrouk’s medium was rationalized by testing different dilutions. It was found that modified Zarrouk’s medium could be diluted up to five times without impacting the growth rates in a 28-days batch cultivation. Higher dry weights were even observed after 21 days of batch cultivation (1.21 g/L for 20%-modified Zarrouk’s medium in comparison to 0.84 g/L for modified Zarrouk’s medium. Iron uptake was then investigated as one of the major contributors to Spirulina nutritional quality. An increase in iron content was obtained by replacing iron sulfate by iron EDTA at a concentration of 10 mgFe/L (2.11 ± 0.13 mgFe/gbiomass for EDTA-FeNa, 3 H2O at 10 mgFe/L compared to 0.18 ± 0.13 for FeSO4,6H2O at 2 mgFe/L. Impact of light intensity on Spirulina biomass productivity was also investigated in a 2 L Photobioreactor (PBR. Specific growth rates were calculated for Photosynthetically Photon Flux Densities (PPFD from 85 to 430 µmol/m2/s. At 430 µmol/m2/s, photoinhibition was not observed and the specific growth rate was maximum (0.12/day. Finally, a 40-day cultivation experiment was conducted in a 1000 L PBR giving a maximum daily areal productivity of 58.4 g/m2/day. A techno-economic analysis gave production cost two to 20 times higher for PBR (from 18.71 to 74.29 €/kg than for open ponds (from 3.86 to 9.59 €/kg depending on Spirulina productivity.

  11. Protein production by Arthrospira (Spirulina platensis in solid state cultivation using sugarcane bagasse as support

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Pelizer

    2015-03-01

    Full Text Available The genus Arthrospira comprises a group of filamentous multicellular cyanobacteria and can be used for animal feed and human food. Solid state fermentation or cultivation (SSF involves the use of a culture medium composed of solid material with given moisture content. No studies have been published about the cultivation of microalgae or cyanobacteria on solid medium. Furthermore, although sugar-cane bagasse is used as source of energy in alcohol distilleries in Brazil, the excess could be a support to photosynthetic microorganism growth. The experimental design methodology was used to evaluate the protein production by Arthrospira platensis under SSF using sugarcane bagasse as support, taking into account the moisture content of the medium, light intensity and inoculum concentration. Moisture was found to have a strong influence on the performance of the process. The best conditions were: moisture of 98.8%; inoculum concentration of 0.15 g biomass·kg wet culture medium−1 and light intensity of 6.0 klx.

  12. Effect of microalga Spirulina platensis (Arthrospira platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Telma Elita Bertolin

    2009-10-01

    Full Text Available Studies have been conducted on microalga Spirulina platensis (Arthrospira platensis due to its therapeutic potential in several areas, including the capacity for preventing and decreasing the damages caused by hyperlipidemia and the antioxidant activity. The aim of the study was to evaluate the effect of microalga Spirulina platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia during 60 days. The measurement of hippocampus lipoperoxidation did not demonstrate significant difference (p>0.05 when Spirulina platensis was added to hypercholesterolemic diet. The evaluation of lipid profile showed that the administration of the microalga in therapeutic and preventive ways led to a significant protective effect (pA microalga Spirulina platensis (Arthrospira platensis vem sendo fonte de pesquisas devido a evidências de seu potencial terapêutico em diversas áreas, dentre elas a capacidade de prevenção e diminuição dos danos causados por dislipidemias e sua atividade antioxidante. Objetivou-se avaliar o efeito da microalga Spirulina platensis sobre a lipoperoxidação no hipocampo e perfil lipídico sérico em ratos com hipercolesterolemia induzida durante 60 dias. A dosagem da lipoperoxidação no hipocampo não demonstrou diferença significativa (p>0,05 quando Spirulina platensis foi adicionada na dieta hipercolêsterolemica. A avaliação do perfil lipídico demonstrou que a administração da microlaga de forma terapêutica e preventiva demonstrou efeito significativo (p<0,05 na proteção do desenvolvimento de hipercolesterolemia.

  13. Cultivation of Arthrospira (Spirulina platensis using confectionary wastes for aquaculture feeding

    Directory of Open Access Journals (Sweden)

    Hala Y. El-Kassas

    2015-12-01

    Full Text Available The microalga biomass production from confectionary effluent is a possible solution for the urgent need for a live food in aquaculture. Arthrospira (Spirulina platensis was the dominant alga in effluent of “Biscomisr a confectionary factory”, in Alexandria–Egypt. Therefore, it was isolated from the effluent samples and used throughout the study. The cyanobacterium, A. platensis was grown on the effluent using 22 Central Composite Design (22 CCD. This work addresses the best effluent dilution (WC, % as well as sodium bicarbonate concentration (SBC on the alga growth and biochemical composition. Total protein, carbohydrate, lipid contents and fatty acid profiles of the produced algal biomass were highly improved. The statistical analyses suggested that the main effect of (WC, % is significant negative influences on the algal contents of proteins, lipids and carbohydrates (p > 0.01. Although it had a significant positive influence on chlorophyll (p > 0.01, no significant effect on algal β carotenes (p > 0.05 had been reported. The inter action effect of SBC together with WC, % exerted a significant negative influence on the algal proteins (p > 0.01 and no significant effect on the other responses (p > 0.05. The produced alga biomass was used for feeding the rotifer, Brachionus plicatilis for further application in aquaculture. Growth rate, reproductive rate and fecundity attributes, fatty acid content of B. plicatilis were amended. The Pearson correlation test indicated that β carotenes displayed a highly positive significant correlation with the growth rate of B. plicatilis (r = 0.733, p < 0.01 and the carbohydrates showed significant positive correlations with Egg % (r = 0.657, p < 0.05.

  14. Role of pH on antioxidants production by Spirulina (Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Mostafa Mahmoud Sami Ismaiel

    2016-06-01

    Full Text Available Abstract Algae can tolerate a broad range of growing conditions but extreme conditions may lead to the generation of highly dangerous reactive oxygen species (ROS, which may cause the deterioration of cell metabolism and damage cellular components. The antioxidants produced by algae alleviate the harmful effects of ROS. While the enhancement of antioxidant production in blue green algae under stress has been reported, the antioxidant response to changes in pH levels requires further investigation. This study presents the effect of pH changes on the antioxidant activity and productivity of the blue green alga Spirulina (Arthrospira platensis. The algal dry weight (DW was greatly enhanced at pH 9.0. The highest content of chlorophyll a and carotenoids (10.6 and 2.4 mg/g DW, respectively was recorded at pH 8.5. The highest phenolic content (12.1 mg gallic acid equivalent (GAE/g DW was recorded at pH 9.5. The maximum production of total phycobiliprotein (159 mg/g DW was obtained at pH 9.0. The antioxidant activities of radical scavenging activity, reducing power and chelating activity were highest at pH 9.0 with an increase of 567, 250 and 206% compared to the positive control, respectively. Variation in the activity of the antioxidant enzymes superoxide dismutase (SOD, catalase (CAT and peroxidase (POD was also reported. While the high alkaline pH may favor the overproduction of antioxidants, normal cell metabolism and membrane function is unaffected, as shown by growth and chlorophyll content, which suggests that these conditions are suitable for further studies on the harvest of antioxidants from S. platensis.

  15. Fresh Water Cyanobacteria Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 as an Anticancer Drug Resource

    OpenAIRE

    Srivastava, Akanksha; Tiwari, Ratnakar; Srivastava, Vikas; Singh, Tej Bali; Asthana, Ravi Kumar

    2015-01-01

    An increasing number of cancer patients worldwide, especially in third world countries, have raised concern to explore natural drug resources, such as the less explored fresh water filamentous cyanobacteria. Six strains of cyanobacteria (Phormidium sp. CCC727, Geitlerinema sp. CCC728, Arthrospira sp. CCC729, Phormidium sp. CCC731, Phormidium sp. CCC730, and Leptolyngbya sp. CCC732) were isolated (paddy fields and ponds in the Banaras Hindu University, campus) and five strains screened for ant...

  16. Determination of antioxidant and chelating activity of protein hydrolysates from spirulina (Arthrospira maxima) obtained by simulated gastrointestinal digestion

    OpenAIRE

    Martínez-Palma, N.; Martínez-Ayala, A.; Dávila-Ortíz, G.

    2015-01-01

    Spirulina is a cyanobacteria that has been used as food since ancient times, for example in Mexico it was consumed by the Aztecs. Its high protein content, distribution and amino acid composition suggests the presence of important peptides encrypted within the sequences of parent proteins, that after been released by digestive process they could show an antioxidant effect. Our present study examined the above hypothesis through the determination of the antioxidant and chelating activity of tw...

  17. SpirPro: A Spirulina proteome database and web-based tools for the analysis of protein-protein interactions at the metabolic level in Spirulina (Arthrospira) platensis C1.

    Science.gov (United States)

    Senachak, Jittisak; Cheevadhanarak, Supapon; Hongsthong, Apiradee

    2015-07-29

    Spirulina (Arthrospira) platensis is the only cyanobacterium that in addition to being studied at the molecular level and subjected to gene manipulation, can also be mass cultivated in outdoor ponds for commercial use as a food supplement. Thus, encountering environmental changes, including temperature stresses, is common during the mass production of Spirulina. The use of cyanobacteria as an experimental platform, especially for photosynthetic gene manipulation in plants and bacteria, is becoming increasingly important. Understanding the mechanisms and protein-protein interaction networks that underlie low- and high-temperature responses is relevant to Spirulina mass production. To accomplish this goal, high-throughput techniques such as OMICs analyses are used. Thus, large datasets must be collected, managed and subjected to information extraction. Therefore, databases including (i) proteomic analysis and protein-protein interaction (PPI) data and (ii) domain/motif visualization tools are required for potential use in temperature response models for plant chloroplasts and photosynthetic bacteria. A web-based repository was developed including an embedded database, SpirPro, and tools for network visualization. Proteome data were analyzed integrated with protein-protein interactions and/or metabolic pathways from KEGG. The repository provides various information, ranging from raw data (2D-gel images) to associated results, such as data from interaction and/or pathway analyses. This integration allows in silico analyses of protein-protein interactions affected at the metabolic level and, particularly, analyses of interactions between and within the affected metabolic pathways under temperature stresses for comparative proteomic analysis. The developed tool, which is coded in HTML with CSS/JavaScript and depicted in Scalable Vector Graphics (SVG), is designed for interactive analysis and exploration of the constructed network. SpirPro is publicly available on the web

  18. Cultivation of microalgae Spirulina platensis (Arthrospira platensis from biological treatment of swine wastewater Cultivo da microalga Spirulina platensis (Arthrospira platensis a partir de tratamento biológico de efluente suíno

    Directory of Open Access Journals (Sweden)

    Natália Mezzomo

    2010-03-01

    Full Text Available The microalgae biomass production from swine wastewater is a possible solution for the environmental impact generated by wastewater discharge into water sources. The biomass can be added to fish feed, which can be used in the formulation of meat products. This work addresses the adaptation of the microalgae Spirulina platensis (Arthrospira platensis in swine wastewater and the study of the best dilution of the wastewater for maximum biomass production and for removal of Chemical Oxygen Demand (COD, ammonia and phosphorous to the microalgae. The cultivation of Spirulina platensis, strain Paracas presented maximum cellular concentrations and maximum specific growth rates in the wastewater concentration of 5.0 and 8.5%. The highest COD removals occurred with 26.5 and 30.0% of wastewater in the medium. The maximum removal of total phosphorous (41.6%, was with 8.5% of wastewater, which is related to the microalgae growth. The results of Spirulina culture in the swine wastewater demonstrated the possibility of using these microalgae for the COD and phosphorous removal and for biomass production.A produção de biomassa de microalgas a partir de efluente suíno consiste em uma possível solução para o impacto ambiental gerado pela descarga de efluentes em fontes naturais. A biomassa produzida pode ser adicionada a rações de peixes, os quais podem ser utilizados na formulação de produtos cárneos. O objetivo deste trabalho foi a adaptação da microalga Spirulina platensis (Arthrospira platensis em efluente suíno e o estudo da diluição ideal de efluente para obter a máxima produção de biomassa e remoção de Demanda Química de Oxigênio (DQO, amônia e fósforo do efluente pela microalga. O cultivo da Spirulina platensis, cepa Paracas apresentou máxima concentração celular e máxima taxa específica de crescimento em concentrações de efluente de 5,0 e 8,5%. As maiores remoções de DQO ocorreram com 26,5 e 30,0% de efluente no meio. A

  19. Fresh Water Cyanobacteria Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 as an Anticancer Drug Resource.

    Directory of Open Access Journals (Sweden)

    Akanksha Srivastava

    Full Text Available An increasing number of cancer patients worldwide, especially in third world countries, have raised concern to explore natural drug resources, such as the less explored fresh water filamentous cyanobacteria. Six strains of cyanobacteria (Phormidium sp. CCC727, Geitlerinema sp. CCC728, Arthrospira sp. CCC729, Phormidium sp. CCC731, Phormidium sp. CCC730, and Leptolyngbya sp. CCC732 were isolated (paddy fields and ponds in the Banaras Hindu University, campus and five strains screened for anticancer potential using human colon adenocarcinoma (HT29 and human kidney adenocarcinoma (A498 cancer cell lines. Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 were the most potent as determined by examination of morphological features and by inhibition of growth by graded concentrations of crude extracts and thin-layer chromatography (TLC eluates. Cell cycle analysis and multiplex assays using cancer biomarkers also confirmed Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 as cancer drug resources. Apoptotic studies in the cells of A498 (cancer and MCF-10A (normal human epithelial exposed to crude extracts and TLC fractions revealed no significant impact on MCF-10A cells emphasizing its importance in the development of anticancer drug. Identification of biomolecules from these extracts are in progress.

  20. Fresh Water Cyanobacteria Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 as an Anticancer Drug Resource.

    Science.gov (United States)

    Srivastava, Akanksha; Tiwari, Ratnakar; Srivastava, Vikas; Singh, Tej Bali; Asthana, Ravi Kumar

    2015-01-01

    An increasing number of cancer patients worldwide, especially in third world countries, have raised concern to explore natural drug resources, such as the less explored fresh water filamentous cyanobacteria. Six strains of cyanobacteria (Phormidium sp. CCC727, Geitlerinema sp. CCC728, Arthrospira sp. CCC729, Phormidium sp. CCC731, Phormidium sp. CCC730, and Leptolyngbya sp. CCC732) were isolated (paddy fields and ponds in the Banaras Hindu University, campus) and five strains screened for anticancer potential using human colon adenocarcinoma (HT29) and human kidney adenocarcinoma (A498) cancer cell lines. Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 were the most potent as determined by examination of morphological features and by inhibition of growth by graded concentrations of crude extracts and thin-layer chromatography (TLC) eluates. Cell cycle analysis and multiplex assays using cancer biomarkers also confirmed Geitlerinema sp. CCC728 and Arthrospira sp. CCC729 as cancer drug resources. Apoptotic studies in the cells of A498 (cancer) and MCF-10A (normal human epithelial) exposed to crude extracts and TLC fractions revealed no significant impact on MCF-10A cells emphasizing its importance in the development of anticancer drug. Identification of biomolecules from these extracts are in progress.

  1. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay

    OpenAIRE

    Eduardo Sommella; Giulio Maria Conte; Emanuela Salviati; Giacomo Pepe; Alessia Bertamino; Carmine Ostacolo; Francesca Sansone; Francesco Del Prete; Rita Patrizia Aquino; Pietro Campiglia

    2018-01-01

    Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary sup...

  2. Aplicación de estrategias nutricionales y su efecto en el crecimiento en el cultivo continuo de Spirulina (Arthrospira platensis)

    OpenAIRE

    Rojas,Elizabet; Ávila,Marcela; Parada,Gustavo

    2012-01-01

    Se realizó un cultivo continuo de Spirulina (Arthrospira platensis) durante 78 días en un fotobiorreactor tubular de 300 L de volumen. Durante este periodo se registró el crecimiento en biomasa y la respuesta del cultivo a la estrategia de adición del medio nutritivo. Utilizando como base el medio Zarrouk modificado, se elaboraron tres medios: medio inicial (MI), medio crecimiento (SA1+SA2) y medio mantenimiento (SB1+SB2) para las distintas etapas del cultivo. La entrega de los medios se efec...

  3. First description of a cyanophage infecting the cyanobacterium Arthrospira platensis (Spirulina)

    Digital Repository Service at National Institute of Oceanography (India)

    Jacquet, S.; Zhong, X.; Parvathi, A.; Ram, A.S.P.

    Cyanobacteria constitute a versatile group of photosynthetic bacteria of immense commercial and ecological importance. Some species of this group are cultivated and sold as food because of their high nutritional value. This is typically the case...

  4. Effect of dietary supplementation of spirulina (Arthrospira platensis and thyme (Thymus vulgaris on carcass composition, meat physical traits, and vitamin B12 content on growing rabbits

    Directory of Open Access Journals (Sweden)

    Antonella Dalle Zotte

    2014-03-01

    Full Text Available The aim of this study was to compare the effect and duration of dietary inclusion of 5% spirulina (Arthrospira platensis and/or 3% thyme (Thymus vulgaris on growing rabbit carcass composition, meat and bone rheological traits, and the vitamin B12 content of Longissimus dorsi (LD meat. The study involved 294 maternal line growing rabbits from the Pannon breeding programme. At weaning (5 wk, animals were randomly divided by dietary treatment into 7 groups of 42 rabbits each. A control group (C-C received a pellet with no supplementation throughout the trial (5-11 wk of age, whereas the other groups were fed diets supplemented with 5% spirulina (S, 3% thyme (T or with both ingredients (ST for either the entire growing period (5-11 wk of age; groups: S-S, T-T, ST-ST, respectively, or its final part only (8-11 wk of age; groups: C-S, C-T, C-ST, respectively. Results showed that regardless of the duration of supplementation, spirulina and thyme provided no effect on the traits examined, except for scapular fat content, whose value was higher in the S-S group than in the C-T group (P<0.05. Spirulina was confirmed as a rich source of vitamin B12 that was successfully transferred into LD meat, thus demonstrating its value as an effective natural supplement in producing food fortified with this vital element. Further studies are necessary to clarify the effect of spirulina on carcass fat deposition, bone development, and mineralisation.

  5. The effects of pH in profile of lipid and ester accumulation of arthrospira platensis (spirulina) as a potential source of biodiesel

    International Nuclear Information System (INIS)

    Reyes, Patrick A.; Ybañez, Manolito G. Jr.; Avilla, Ruel A.

    2013-01-01

    This study aimed to produce biodiesel (ester-based fuel) using the extracts of microalgae Arthrospira platensis (Spirulina). Specifically, the research focused in determining effect of pH in culturing the Spirulina and its lipid accumulation; determining the constituents present in the lipid extracts; and determining the methyl esters in the transesterified lipids. The best pH condition in culturing the algal sample was found to be at pH 10 to 11. Analysis of the extracted lipid samples revealed that pH condition in culturing medium has a significant effect on the lipid accumulation in Spirulina. Perkin Elmer Claurus 500 GC-MS system elucidated that the constituents present in the experimental samples were esterified lipids. The esters were derived from butanoic, hexadeanoic and octadecanoic acid. About 19 free fatty acids out of 23 determined compounds present were from the controlled sample which suggests that these were main precursors of the esters found in the sample were butyl, allyl nonyl, propyl tetradecyl, methylpropyl, allyl dodecyl, hexyl pentadecyl, dodecyl propyl, heptyl esters with the parent chain of fatty acids enumerated above. These showed that pH manipulations could be used as a direct transesterification of fatty acids in producing biodiesels. (author)

  6. Study of polyethyleneimine- and amidoxime-functionalized hybrid biomass of Spirulina (Arthrospira) platensis for adsorption of uranium (VI) ion.

    Science.gov (United States)

    Bayramoglu, Gulay; Akbulut, Aydin; Arica, M Yakup

    2015-11-01

    This study investigates the potential application of the polyethyleneimine- (PEI) and amidoxime-modified Spirulina (Arthrospira) platensis biomasses for the removal of uranium ion in batch mode using the native biomass as a control system. The uranium ion adsorption was also characterized by attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectra, zeta potential analysis, and surface area measurement studies. The effects of pH, biomass amount, contact time, initial uranium ion concentration, and ionic strength were evaluated by using native and modified algal biomass preparations. The uranium ion removal was rapid, with more than 70% of total adsorption taking place in 40 min, and equilibrium was established within 60 min. From the experimental data, it was found that the amount of adsorption uranium ion on the algal preparations decreased in the following series: amidoxime-modified algal biomass > PEI-modified algal biomass > native algal biomass. Maximum adsorption capacities of amidoxime- and PEI-modified, and native algal biomasses were found to be 366.8, 279.5, and 194.6 mg/g, respectively, in batchwise studies. The adsorption rate of U(VI) ion by amidoxime-modified algal biomass was higher than those of the native and PEI-modified counterparts. The adsorption processes on all the algal biomass preparations followed by the Dubinin-Radushkevitch (D-R) and Temkin isotherms and pseudo-second-order kinetic models. The thermodynamic parameters were determined at four different temperatures (i.e., 15, 25, 35, and 45 °C) using the thermodynamics constant of the Temkin isotherm model. The ΔH° and ΔG° values of U(VI) ion adsorption on algal preparations show endothermic heat of adsorption; higher temperatures favor the process. The native and modified algal biomass preparations were regenerated using 10 mM HNO3. These results show that amidoxime-modified algal biomass can be a potential candidate for effective removal of U(VI) ion from

  7. The potential effects of Spirulina platensis (Arthrospira platensis on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level

    Directory of Open Access Journals (Sweden)

    Mai D. Ibrahem

    2014-01-01

    Full Text Available The current study was designed to investigate the potential effect of Spirulina platensis, Arthrospira platensis, (SP on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level. Five isonitrogenous and isocaloric rations containing graded levels of dried SP 5, 7.5,10, 15, and 20 g/kg diet were fed separately to five equal groups of O. niloticus fingerlings, additional control group was assigned for 3 months. Liver samples were separately collected from each group by the end of each month. The expression level of P53 showed a substantial decrease among the treated groups in a time-dependent manner. It is therefore advisable to incorporate SP in diets for tissue protection and antioxidant effects in cultured O. niloticus.

  8. Mutant strains of Spirulina (Arthrospira) platensis to increase the efficiency of micro-ecological life support systems

    Science.gov (United States)

    Brown, Igor

    The European Micro-Ecological Life Support System Alternative (MELiSSA) is an advanced idea for organizing a bioregenerative system for long term space flights and extraterrestrial settlements (Hendrickx, De Wever et al., 2005). Despite the hostility of both lunar and Martian environments to unprotected life, it seems possible to cultivate photosynthetic bacteria using closed bioreactors illuminated and heated by solar energy. Such reactors might be employed in critical processes, e.g. air revitalization, foodcaloric and protein source, as well as an immunomodulators production. The MELiSSA team suggested cyanobacterium Spirulina as most appropriate agent to revitalize air and produce a simple "fast" food. This is right suggestion because Spirulina was recently shown to be an oxygenic organism with the highest level of O2 production per unit mass (Ananyev et al., 2005). Chemical composition of Spirulina includes proteins (55Aiming to make Spirulina cultivation in life support systems like MELiSSA more efficient, we selected Spirulina mutant strains with increased fraction of methionine in the biomass of this cyanobacterium and compared the effect of parental wild strain of Spirulina and its mutants on the tendency of such experimental illnesses as radiationinduced lesions and hemolythic anemia. Results: It was found that mutant strains 198B and 27G contain higher quantities of total protein, essential amino acids, c-phycocyanin, allophycocyanin and chlorophyll a than parental wild strain of S. platensis. The strain 198B is also characterized with increased content of carotenoids. Revealed biochemical peculiarities of mutant strains suggest that these strains can serve as an additional source of essential amino acids as well as phycobiliproteins and carotenoids for the astronauts. Feeding animals suffering from radiation-induced lesions, c-phycocyanin, extracted from strain 27G, led to a correction in deficient dehydrogenase activity and energy-rich phosphate levels

  9. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay

    Directory of Open Access Journals (Sweden)

    Eduardo Sommella

    2018-05-01

    Full Text Available Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS and Ultra High-Performance Liquid Chromatography (UHPLC for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS and coupled to UHPLC. DIMS showed to be a very fast (4 min and accurate (mass accuracy ≤ 0.01 ppm tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  10. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay.

    Science.gov (United States)

    Sommella, Eduardo; Conte, Giulio Maria; Salviati, Emanuela; Pepe, Giacomo; Bertamino, Alessia; Ostacolo, Carmine; Sansone, Francesca; Prete, Francesco Del; Aquino, Rita Patrizia; Campiglia, Pietro

    2018-05-11

    Arthrospira platensis , better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS) and coupled to UHPLC. DIMS showed to be a very fast (4 min) and accurate (mass accuracy ≤ 0.01 ppm) tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  11. Cultivation of Arthrospira (spirulina platensis in desalinator wastewater and salinated synthetic medium: protein content and amino-acid profile Cultivo de Arthrospira (Spirulina platensis em rejeito de dessalinizador e meio sintético salinizado: teor protéico e perfil de aminoácidos

    Directory of Open Access Journals (Sweden)

    Harriet Volkmann

    2008-03-01

    Full Text Available Arthrospira (Spirulina platensis was cultivated in laboratory under controlled conditions (30ºC, photoperiod of 12 hours light/dark provided by fluorescent lamps at a light intensity of 140 µmol photons.m-2.s-1 and constant bubbling air in three different culture media: (1 Paoletti medium (control, (2 Paoletti supplemented with 1 g.L-1 NaCl (salinated water and (3 Paoletti medium prepared with desalinator wastewater. The effects of these treatments on growth, protein content and amino acid profile were measured. Maximum cell concentrations observed in Paoletti medium, Paoletti supplemented with salinated water or with desalinator wastewater were 2.587, 3.545 and 4.954 g.L-1, respectively. Biomass in medium 3 presented the highest protein content (56.17%, while biomass in medium 2 presented 48.59% protein. All essential amino acids, except lysine and tryptophan, were found in concentrations higher than those requiried by FAO.Arthrospira (Spirulina platensis foi cultivada em laboratório sob condições controladas (30ºC, intensidade luminosa de 140 µmol fótons.m-2.s-1, 12 horas claro/escuro e insuflação constante de ar atmosférico, em três meios de cultivo: (1 meio de Paoletti (controle, (2 meio de Paoletti suplementado com 1,0 g.L-1 de NaCl (água salinizada e (3 meio de Paoletti preparado com rejeito de dessalinizador. Foi verificado o efeito destes tratamentos no crescimento, teor de proteínas e aminoácidos. As concentrações celulares máximas obtidas foram de 2,587; 3,545 e 4,954 g.L-1 no meio controle, meio de Paoletti suplementado com água salinizada ou com rejeito de dessalinizador, respectivamente. Com relação às concentrações protéicas, estas foram maiores na biomassa cultivada no meio 3, com 56,17%, enquanto que a biomassa cultivada no meio 2 apresentou 48,59%. A maioria dos aminoácidos essenciais encontrou-se acima dos limites requeridos pela FAO, com exceção apenas de lisina e triptofano.

  12. Fed-batch strategy for enhancing cell growth and C-phycocyanin production of Arthrospira (Spirulina) platensis under phototrophic cultivation.

    Science.gov (United States)

    Xie, Youping; Jin, Yiwen; Zeng, Xianhai; Chen, Jianfeng; Lu, Yinghua; Jing, Keju

    2015-03-01

    The C-phycocyanin generated in blue-green algae Arthrospira platensis is gaining commercial interest due to its nutrition and healthcare value. In this study, the light intensity and initial biomass concentration were manipulated to improve cell growth and C-phycocyanin production of A.platensis in batch cultivation. The results show that low light intensity and high initial biomass concentration led to increased C-phycocyanin accumulation. The best C-phycocyanin productivity occurred when light intensity and initial biomass concentration were 300μmol/m(2)/s and 0.24g/L, respectively. The fed-batch cultivation proved to be an effective strategy to further enhance C-phycocyanin production of A.platensis. The results indicate that C-phycocyanin accumulation not only requires nitrogen-sufficient condition, but also needs other nutrients. The highest C-phycocyanin content (16.1%), production (1034mg/L) and productivity (94.8mg/L/d) were obtained when using fed-batch strategy with 5mM medium feeding. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Antioxidant effect of Spirulina (Arthrospira) maxima in a neurotoxic model caused by 6-OHDA in the rat striatum.

    Science.gov (United States)

    Tobón-Velasco, J C; Palafox-Sánchez, Victoria; Mendieta, Liliana; García, E; Santamaría, A; Chamorro-Cevallos, G; Limón, I Daniel

    2013-08-01

    There is evidence to support that an impaired energy metabolism and the excessive generation of reactive oxygen species (ROS) contribute to brain injury in neurodegenerative disorders such as Parkinson's disease (PD), whereas diets enriched in foods with an antioxidant action may modulate its progression. Several studies have proved that the antioxidant components produced by Spirulina, a microscopic blue-green alga, might prevent cell death by decreasing free radicals, inhibiting lipoperoxidation and upregulating the antioxidant enzyme systems. In our study, we investigated the protective effect of the Spirulina maxima (S. maxima) against the 6-OHDA-caused toxicity in the rat striatum. The S. maxima (700 mg/kg/day, vo) was administered for 40 days before and 20 days after a single injection of 6-OHDA (16 μg/2 μL) into the dorsal striatum. At 20-day postsurgery, the brain was removed and the striatum was obtained to evaluate the indicators of toxicity, such as nitric oxide levels, ROS formation, lipoperoxidation, and mitochondrial activity. These variables were found significantly stimulated in 6-OHDA-treated rats and were accompanied by declines in dopamine levels and motor activity. In contrast, the animals that received the chronic treatment with S. maxima had a restored locomotor activity, which is associated with the decreased levels of nitric oxide, ROS, and lipoperoxidation in the striatum, although mitochondrial functions and dopamine levels remained preserved. These findings suggest that supplementation with antioxidant phytochemicals (such as contained in S. maxima) represents an effective neuroprotective strategy against 6-OHDA-caused neurotoxicity vía free radical production to preserve striatal dopaminergic neurotransmission in vivo.

  14. Nitrogen limitation in natural populations of cyanobacteria (Spirulina and Oscillatoria spp.) and its effect on macromolecular synthesis

    International Nuclear Information System (INIS)

    van Rijn, J.; Shilo, M.

    1986-01-01

    Natural populations of the cyanobacteria Spirulina species and Oscillatoria species obtained from Israeli fish ponds were limited in growth by nitrogen availability in summer. Physiological indicators for nitrogen limitation, such as phycocyanin, chlorophyll a, and carbohydrate content, did not show clear evidence for nitrogen limited growth, since these organisms are capable of vertical migration from and to the nitrogen-rich bottom. By means of 14 C labeling of the cells under simulated pond conditions followed by cell fractionation into macromolecular compounds, it was found that carbohydrates synthesized at the lighted surface were partially utilized for dark protein synthesis at the bottom of these ponds

  15. Arthrospira (Spirulina) in tannery wastewaters

    African Journals Online (AJOL)

    2012-05-29

    May 29, 2012 ... oxidation of sulphide and ammonia, and the trapping of other odour-causing compounds was observed. An attempt was made to achieve ... manipulation of the biological processes may offer a conceptual basis for the more ... oxidation, blending and aeration followed by flocculant-assisted settling of a por-.

  16. In vitro antioxidant activity assessment on alcoholic extract of cyanobacteria cultures from Spirulina platensis

    OpenAIRE

    Senthilkumaran Jagadeesh J, Jaiganesh K, Somasundaram G

    2013-01-01

    The antioxidant supplementation such as vitamin C, E, A and beta carotene etc, has proven to prevent the process of ageing caused by free radicals. Antioxidants either prevent free radical production or counteract the impeding damage by doing so they are involved in the protection and prevention of cellular damage which is the common pathway for cancer, aging and much disease. The cyanobacteria is a blue green micro algae believed to be a rich antioxidant source, found in abundance in Spiruli...

  17. Influência da ingestão de biomassas de spirulina (Arthrospira sp. sobre o peso corporal e consumo de ração em ratos

    Directory of Open Access Journals (Sweden)

    Araújo Kátia Gomes de Lima

    2003-01-01

    Full Text Available Neste trabalho verificou-se a influência do consumo de biomassas provenientes de três diferentes origens sobre o peso corporal e consumo de ração em ratos Wistar, machos e adultos. Grupos que consumiram 5% ou 10% (p/p da biomassa foram comparados com um controle. A biomassa I não promoveu diferença significativa no consumo de ração ou peso corporal dos três grupos. A biomassa II não causou diferença significativa no peso corporal, mas sim no consumo de ração. A biomassa III não causou diferença significativa no consumo de ração, nem no peso corporal, mas houve tendência de maior ganho de peso para o grupo que consumiu a ração contendo 10% de spirulina. Os resultados obtidos indicam que diferentes biomassas podem apresentar diferentes propriedades, mas não confirmam a alegação de que a spirulina pode levar a diminuição de peso ou de consumo de alimento.

  18. Efecto de la intensidad de diodos electroluminosos y fotoperiodo en la optimización de la producción de biomasa de Spirulina ( Arthrospira

    Directory of Open Access Journals (Sweden)

    V. Vásquez - Villalobos

    2017-01-01

    Full Text Available Se optimizó la producción de biomasa ( ф de cultivos batch d e Spirulina sp. en fotobiorreactores a escala de laboratorio (FBL de 0,2 L, por efecto de X 1 : intensidad de diodos electroluminosos (LED’s entre 1,25 a 41,7 klux y X 2 : fotoperiodo de12/12 a 24/0, h de luz/h de oscuridad (L/O utilizando un diseño compuesto central rotacional (DCCR y metodología de superficie de respuesta (MSR. Asimismo, se eval uaron las características hidráulicas y el valor ф de un cultivo batch de Spirulina en un fotobiorreactor de canal bucle cerrado abierto a la atmósfera (FB - BCAA por efecto de la iluminación LED de 8,3±1,9 klux y fotoperiodos de 12/12 y 24/0 h L/O. En los FBL se encontró dos zonas óptimas de ф , ambas con una intensidad LED de 21,5 klux y fotoperiodos 12/12 y 24/0 h L/O, siendo los valores ф de 1,65 y 1,62 respectivamente. El modelo matemático que indicó estas zonas fue de segundo orden (p = 0,000396 < 0,05 con una consistencia de predicción de R² = 0,92. En el FB - BCAA, el cultivo de Spirulina sp. con fotoperiodo de 12/12 h L/O, mostr ó un valor ф de 0,72, una adaptación más rápida de λ = 4,62 h, una mayor velocidad específica de crecimiento de μ max = 0,033 h - 1 y menor tiempo de consumo de energía de 74,05 h ; comparado con el cultivo desarrollado con fotoperiodo 24/0 h L/O. Los parámetros hidráulicos del FB - BCAA fueron: volumen de operación 2,5 L, velocidad de flujo 0,26 m/s, números de Reynolds ( Re 15488, Froude ( Fr 0,60 y Vedernikov ( V ed 0,90.

  19. GROWTH AND COMPOSITION OF Arthrospira (Spirulina platensis IN A TUBULAR PHOTOBIOREACTOR USING AMMONIUM NITRATE AS THE NITROGEN SOURCE IN A FED-BATCH PROCESS

    Directory of Open Access Journals (Sweden)

    C. Cruz-Martínez

    2015-06-01

    Full Text Available AbstractNH4NO3 simultaneously provides a readily assimilable nitrogen source (ammonia and a reserve of nitrogen (nitrate, allowing for an increase in Arthrospira platensis biomass production while reducing the cost of the cultivation medium. In this study, a 22plus star central composite experimental design combined with response surface methodology was employed to analyze the influence of light intensity (I and the total amount of added NH4NO3 (Mt on a bench-scale tubular photobioreactor for fed-batch cultures. The maximum cell concentration (Xm, cell productivity (PX and biomass yield on nitrogen (YX/N were evaluated, as were the protein and lipid contents. Under optimized conditions (I = 148 μmol·photons·m-2·s-1 and Mt = 9.7 mM NH4NO3, Xm = 4710 ±34.4 mg·L-1, PX = 478.9 ±3.8 mg·L-1·d-1 and YX/N = 15.87 ±0.13 mg·mg-1 were obtained. The best conditions for protein content in the biomass (63.2% were not the same as those that maximized cell growth (I = 180 μmol·photons·m-2·s-1 and Mt = 22.5 mM NH4NO3. Based on these results, it is possible to conclude that ammonium nitrate is an interesting alternate nitrogen source for the cultivation of A. platensisin a fed-batch process and could be used for other photosynthetic microorganisms.

  20. Isolation, characterization and localization of extracellular polymeric substances from the cyanobacterium Arthrospira platensis strain MMG-9

    NARCIS (Netherlands)

    Ahmed, M.; Moerdijk-Poortvliet, T.C.W.; Wijnholds, A.; Stal, L.J.; Hasnain, S.

    2014-01-01

    Arthrospira platensis is a cyanobacterium known for its nutritional value and secondary metabolites. Extracellular polymeric substances (EPS) are an important trait of most cyanobacteria, including A. platensis. Here, we extracted and analysed different fractions of EPS from a locally isolated

  1. Analysis of β-N-methylamino-L-alanine (BMAA) in spirulina-containing supplements by liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    McCarron, Pearse; Logan, Alan C; Giddings, Sabrina D; Quilliam, Michael A

    2014-01-01

    Over the last decade the amino acid beta-N-methylamino-L-alanine (BMAA) has come under intense scrutiny. International laboratory and epidemiological research continues to support the hypothesis that environmental exposure to BMAA (e.g., through dietary practices, water supply) can promote the risk of various neurodegenerative diseases. A wide variety of cyanobacteria spp. have previously been reported to produce BMAA, with production levels dependent upon species, strain and environmental conditions. Since spirulina (Arthrospira spp.) is a member of the cyanobacteria phylum frequently consumed via dietary supplements, the presence of BMAA in such products may have public health implications. In the current work, we have analyzed ten spirulina-containing samples for the presence of BMAA; six pure spirulina samples from two separate raw materials suppliers, and four commercially-available multi-ingredient products containing 1.45 g of spirulina per 8.5 g serving. Because of controversy surrounding the measurement of BMAA, we have used two complementary liquid chromatography-tandem mass spectrometry (LC-MS/MS) methods: one based on reversed phase LC (RPLC) with derivatization and the other based on hydrophilic interaction LC (HILIC). Potential matrix effects were corrected for by internal standardization using a stable isotope labeled BMAA standard. BMAA was not detected at low limits of detection (80 ng/g dry weight) in any of these product samples. Although these results are reassuring, BMAA analyses should be conducted on a wider sample selection and, perhaps, as part of ongoing spirulina production quality control testing and specifications.

  2. Acoustic, electrochemical and microscopic characterization of interaction of Arthrospira platensis biofilm and heavy metal ions

    OpenAIRE

    Tekaya , Nadèje; Gammoudi , Ibtissèm; Braiek , Mohamed; Tarbague , Hakim; Morote , Fabien; Raimbault , Vincent; Sakly , Nawfel; Rebière , Dominique; Ben Ouada , Hatem; Lagarde , Florence; Ben Ouada , Hafedh; Cohen-Bouhacina , Touria; Déjous , Corinne; Jaffrezic-Renault , Nicole

    2013-01-01

    International audience; This study examines a biofilm of Arthrospira platensis and its interactions with cadmium and mercury, using electrochemical admittance spectroscopy technique combined with highly sensitive Love wave platform for the real-time detection in liquid medium. Spirulina cells were immobilized via multilayers of polyelectrolyte (PEM) on Si/SiO2 surface of both transducers and characterized using atomic force microscopy (AFM). Scanning electron microscopy (SEM) cell images reve...

  3. Enhancement of natural killer cell activity in healthy subjects by Immulina®, a Spirulina extract enriched for Braun-type lipoproteins

    DEFF Research Database (Denmark)

    Nielsen, Claus Henrik; Balachandran, Premalatha; Christensen, Ole

    2010-01-01

    Immulina®, a commercial extract of Arthrospira (Spirulina) platensis is a potent activator of THP-1 monocytes and CD4+ T cells IN VITRO and enhances several immunological functions in mice. We further characterized Immulina® by determining that Braun-type lipoproteins are responsible for a major...

  4. Oral administration of a Spirulina extract enriched for Braun-type lipoproteins protects mice against influenza A(H1N1) virus infection

    Science.gov (United States)

    Previous studies indicate that Immulina, a commercial extract of Arthrospira (Spirulina) platensis, is a potent activator of innate immune cells and that Braun-type lipoproteins (a principal toll-like receptor (TLR) 2 ligand) are the main active components within this product. In the present study, ...

  5. Drying Spirulina with Foam Mat Drying at Medium Temperature

    Directory of Open Access Journals (Sweden)

    Aji Prasetyaningrum

    2012-10-01

    Full Text Available Spirulina is a single cell blue green microalgae (Cyanobacteria containing many Phytonutrients (Beta-carotene, Chlorophyl, Xanthophyl, Phyocianin using as anti-carcinogen in food. Producing dry spirulina by quick drying process at medium temperature is very important to retain the Phytonutrient quality. Currently, the work is still challenging due to the gel formation that block the water diffusion from inside to the surface.  This research studies the performance of foam-mat drying on production of dry spirulina. In this method the spirulina was mixed with foaming agent (glair/egg albumen, popular as white egg at 2.5% by weight at air velocity 2.2 m/sec. Here, the effect of spirulina thickness and operational temperature on drying time and quality (Beta-carotene and color were observed. The drying time was estimated based on the measurement of water content in spirulina versus time. Result showed that the thicker spirulina, the longer drying time. Conversely, the higher operational temperature, faster drying time. At thickness ranging 1-3 mm and operational temperature below 70oC, the quality of spirulina can fit the market requirement

  6. Arthrospira (Spirulina) in tannery wastewaters. Part 2: Evaluation of ...

    African Journals Online (AJOL)

    Part 2: Evaluation of tannery wastewater as production media for the mass culture of ... as a critical driver in the profitability of the algal biotechnology enterprise. ... and possibly marginal economics of, biofuels production from the microalgae ...

  7. Effect of Nickel on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez-Bocanegra, A. R.; Torres-Munoz, J. A.; Neria-Gonzalez, M. I.; Rios-Leal, E.; Aguilar-Lopez, R.

    2009-07-01

    Nickel is not produced in Mexico, but is a component widely used in the paper industry, fertilizers, iron foundry, and jewels fabrication among others. therefore it is founded in residual waters coming form domestic and industrial. It is known that such a heavy metal is essential to the life of some microorganisms including microalgae, however at relatively high concentrations it turns to be toxic inside some physiological processes (Jin et al., 1996). (Author)

  8. Extraction of Nutraceuticals from Spirulina (Blue-Green Alga): A Bioorganic Chemistry Practice Using Thin-layer Chromatography

    Science.gov (United States)

    Herrera Bravo de Laguna, Irma; Toledo Marante, Francisco J.; Luna-Freire, Kristerson R.; Mioso, Roberto

    2015-01-01

    Spirulina is a blue-green alga (cyanobacteria) with high nutritive value. This work provides an innovative and original approach to the consideration of a bioorganic chemistry practice, using Spirulina for the separation of phytochemicals with nutraceutical characteristics via thin-layer chromatography (TLC) plates. The aim is to bring together…

  9. Molecular exploration of the highly radiation resistant cyanobacterium Arthrospira sp. PCC 8005

    Science.gov (United States)

    Badri, Hanène; Leys, Natalie; Wattiez, Ruddy

    Arthrospira (Spirulina) is a photosynthetic cyanobacterium able to use sunlight to release oxygen from water and remove carbon dioxide and nitrate from water. In addition, it is suited for human consumption (edible). For these traits, the cyanobacterium Arthrospira sp. PCC 8005 was selected by the European Space Agency (ESA) as part of the life support system MELiSSA for recycling oxygen, water, and food during future long-haul space missions. However, during such extended missions, Arthrospira sp. PCC 8005 will be exposed to continuous artificial illumination and harmful cosmic radiation. The aim of this study was to investigate how Arthrospira will react and behave when exposed to such stress environment. The cyanobacterium Arthrospira sp. PCC 8005 was exposed to high gamma rays doses in order to unravel in details the response of this bacterium following such stress. Test results showed that after acute exposure to high doses of 60Co gamma radiation upto 3200 Gy, Arthrospira filaments were still able to restart photosynthesis and proliferate normally. Doses above 3200 Gy, did have a detrimental effect on the cells, and delayed post-irradiation proliferation. The photosystem activity, measured as the PSII quantum yield immediately after irradiation, decreased significantly at radiation doses above 3200 Gy. Likewise through pigment content analysis a significant decrease in phycocyanin was observed following exposure to 3200 Gy. The high tolerance of this bacterium to 60Co gamma rays (i.e. ca. 1000x more resistant than human cells for example) raised our interest to investigate in details the cellular and molecular mechanisms behind this amazing resistance. Optimised DNA, RNA and protein extraction methods and a new microarray chip specific for Arthrospira sp. PCC 8005 were developed to identify the global cellular and molecular response following exposure to 3200 Gy and 5000 Gy A total of 15,29 % and 30,18 % genes were found differentially expressed in RNA

  10. A lithium-sensitive and sodium-tolerant 3'-phosphoadenosine-5'-phosphatase encoded by halA from the cyanobacterium Arthrospira platensis is closely related to its counterparts from yeasts and plants.

    Science.gov (United States)

    Zhang, Ju-Yuan; Zou, Jie; Bao, Qiyu; Chen, Wen-Li; Wang, Li; Yang, Huanming; Zhang, Cheng-Cai

    2006-01-01

    3'-Phosphoadenosine-5'-phosphatase (PAPase) is required for the removal of toxic 3'-phosphoadenosine-5'-phosphate (PAP) produced during sulfur assimilation in various eukaryotic organisms. This enzyme is a well-known target of lithium and sodium toxicity and has been used for the production of salt-resistant transgenic plants. In addition, PAPase has also been proposed as a target in the treatment of manic-depressive patients. One gene, halA, which could encode a protein closely related to the PAPases of yeasts and plants, was identified from the cyanobacterium Arthrospira (Spirulina) platensis. Phylogenic analysis indicated that proteins related to PAPases from several cyanobacteria were found in different clades, suggesting multiple origins of PAPases in cyanobacteria. The HalA polypeptide from A. platensis was overproduced in Escherichia coli and used for the characterization of its biochemical properties. HalA was dependent on Mg2+ for its activity and could use PAP or 3'-phosphoadenosine-5'-phosphosulfate as a substrate. HalA is sensitive to Li+ (50% inhibitory concentration [IC50] = 3.6 mM) but only slightly sensitive to Na+ (IC50 = 600 mM). The salt sensitivity of HalA was thus different from that of most of its eukaryotic counterparts, which are much more sensitive to both Li+ and Na+, but was comparable to the PAPase AtAHL (Hal2p-like protein) from Arabidopsis thaliana. The properties of HalA could help us to understand the structure-function relationship underlying the salt sensitivity of PAPases. The expression of halA improved the Li+ tolerance of E. coli, suggesting that the sulfur-assimilating pathway is a likely target of salt toxicity in bacteria as well.

  11. Effect of Spirulina supplementation on plasma metabolites in crossbred and purebred Australian Merino lambs

    Directory of Open Access Journals (Sweden)

    A.E.O. Malau-Aduli

    2015-06-01

    Full Text Available The effect of supplementing purebred and crossbred Merino lambs with Arthrospira platensis (Spirulina on plasma metabolite concentrations under pasture-based management system and the influences of sire breed and sex were investigated. A completely randomized experimental design balanced by 4 sire breeds (Merino, White Suffolk, Dorset and Black Suffolk, 3 Spirulina supplementation levels (0, 100 and 200 ml representing the control, low and high, respectively and 2 sexes (ewe and wether lambs was utilised. All lambs had ad libitum access to the basal diet of ryegrass pastures and barley. Lambs in the treatment groups were individually drenched daily with Spirulina prior to being released with the control group of lambs for grazing over a 6-week period following a 3-week adjustment phase. At the start and completion of the feeding trial, blood samples were centrifuged and plasma metabolites measured. Data were analysed with Spirulina supplementation level, sire breed, sex and their second-order interactions fitted as fixed effects and metabolite concentrations as dependent variables. Gamma-glutamyl transferase (GGT concentrations decreased (from 79.40 to 69.25 UI and glucose increased (from 3.81 to 4.19 mmol/L as the level of Spirulina supplementation increased from 0 ml in the control to 200 ml in the high treatment groups (P < 0.05. Lambs supplemented at low Spirulina levels had the highest creatinine concentrations (61.75 μmol/L. Interactions between sex and supplementation level significantly affected glucose, aspartate aminotransferase (AST and Mg concentrations (P < 0.05, while sire breed and supplementation level interactions influenced albumin to globulin (A/G ratio, creatinine and GGT concentrations. It was demonstrated that Spirulina supplementation does not negatively impact lamb health and productivity.

  12. Technological and nutritional assessment of dry pasta with oatmeal and the microalga Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Fernanda Arnhold Pagnussatt

    2014-12-01

    Full Text Available Wheat flour is the most important raw material in the production of pasta. The production process consists of mixing water and flour, kneading, extrusion and drying. Oats and the microalga Spirulina platensis play a physiological role in the growth, development and maintenance of the human organism due to their high nutritional value. The aim of this study was to assess the technological and nutritional properties of dry pasta prepared with the addition of oatmeal and Spirulina platensis. The wheat flour was characterized and the effect of partial replacement by oatmeal and Spirulina platensis (Arthrospira platensis was evaluated using response surface methodology (RSM. The mixtures were analysed for moisture, protein, ash, colour, particle size, falling number and alveography. The formulated pastas were dried and evaluated for moisture, colour, cooking test, acidity, proximate composition and amino acids. Generally, the addition of Spirulina platensis influenced the soluble solids content and colour of the pasta, while the oatmeal mainly affected the acid content. The oatmeal increased the values of crude protein and total dietary fibre (13.06% when compared with the commercial pasta (2.40% and may be considered as a source of fibre.

  13. Synthesis of CdSe nanoparticles and their effect on the antioxidant activity of Spirulina platensis and Porphyridium cruentum cells

    International Nuclear Information System (INIS)

    Rudic, V.; Cepoi, L.; Rudi, L.; Chiriac, T.; Nicorici, A.; Todosiciuc, A.; Gutsul, T.

    2011-01-01

    Single-crystalline cadmium selenide nanoparticles were obtained using high-temperature solution phase synthesis (HTSPS) synthesis. X-Ray powder diffraction and transmission electron microscopy were used to confirm the crystallinity and morphology of the resulting nanoparticles. To study the action of CdSe on antioxidant activity, we selected two biotechnological important strains of microalgae: cyanobacteria Spirulina platensis and red microalgae Porphyridium cruentum. In the case of Porphyridium cruentum, the obtained results demonstrated an increase in the productivity. For Spirulina platensis, the presence of the compound in the cultivating medium decreased the productivity of cyanobacteria.

  14. Antibacterial activities of the extracts of cyanobacteria and green ...

    African Journals Online (AJOL)

    In compliance to the recent surveys on algal species and their potentials to produce biologically active compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, Nostoc linckia, Phormidium autumnale, Tolypothrix distorta and Microcystis aeruginosa and green algae such as Chlorella vulgaris, ...

  15. SYSTEMS BIOLOGY AND METABOLIC ENGINEERING OF ARTHROSPIRA CELL FACTORIES

    Directory of Open Access Journals (Sweden)

    Amornpan Klanchui

    2012-10-01

    Full Text Available Arthrospira are attractive candidates to serve as cell factories for production of many valuable compounds useful for food, feed, fuel and pharmaceutical industries. In connection with the development of sustainable bioprocessing, it is a challenge to design and develop efficient Arthrospira cell factories which can certify effective conversion from the raw materials (i.e. CO2 and sun light into desired products. With the current availability of the genome sequences and metabolic models of Arthrospira, the development of Arthrospira factories can now be accelerated by means of systems biology and the metabolic engineering approach. Here, we review recent research involving the use of Arthrospira cell factories for industrial applications, as well as the exploitation of systems biology and the metabolic engineering approach for studying Arthrospira. The current status of genomics and proteomics through the development of the genome-scale metabolic model of Arthrospira, as well as the use of mathematical modeling to simulate the phenotypes resulting from the different metabolic engineering strategies are discussed. At the end, the perspective and future direction on Arthrospira cell factories for industrial biotechnology are presented.

  16. Protein (Cyanobacteria): 161200 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available otein SPLC1_S051210 Arthrospira platensis C1 MKVAINKLPLPTIIDDCTLSSFVPAIMAILELVSVAALGVLVGLFLFNINSKREEQRQLDHAFYQLIESQDGEISLIQLAALARVSADVAQEYLDRQAGVFAAIPEFDQDGNTFYRFPRLRLPKQFPERSPNQDW ...

  17. Protein (Cyanobacteria): 161210 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available rotein AmaxDRAFT_3596 Arthrospira maxima CS-328 MAINKLPLPTIIDDCTLSSFVPAIMAILELVSVAALGVLVGLFLFNINSKREEQRQLDHAFYQLIESQDGEISLIQLAALARVSADVAQEYLDRQAGVFAAIPEFDQDGNTFYRFPRLRLPKQFPERSPNQDW ...

  18. Protein (Cyanobacteria): 479132100 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 05 696747:1505 ... hypothetical protein Arthrospira platensis NIES-39 MGGGNGTQQHHLSVMLGFTLVSPNLPRAIAYLSRLGGGNGTQQHHLSVMLGFTLVSPKLPRAIA...YLSRLGGGNGTQQHHLSVMLGFTLVSPNLPRAIAYLSRLGGGNGTQQHHLSVMLGFTLVSPNLQMLGETRATKSDRLFK

  19. Protein (Cyanobacteria): 479132040 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 05 696747:1505 ... hypothetical protein Arthrospira platensis NIES-39 MGGGNGTQQHHLSVMLGFTLVSPNLPRAIAYLSRLGGGNGTQQHHLSVMLGFTLVSPKLPRAIA...YLSRLGGGNGTQQHHLSVMLGFTLVSPNLPRAIAYLSRLGGGNGTQQHHLSVMLGFTLVSPNLQMLGETRATKSDRLFK

  20. Protein (Cyanobacteria): 479132036 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 05 696747:1505 ... hypothetical protein Arthrospira platensis NIES-39 MEVRNPTTPSLNDVGFHGVSPNLQRAIAYLSRLGGGNGTQHHHLSVMFGFTLVSPNLPRAIA...YLSRLGGGNGTQQHHLSVMLGFTLVSPKLPRAIAYLSRLGGGNGTQHHHLSVILGFTLVSPNLQMLGETQATKSDRLFK

  1. Protein (Cyanobacteria): 454073 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available -repair coupling factor Arthrospira platensis C1 MCDRKFWAAKERGFRAIALVSYSLFRNHIITSPSPSPSVGARFRAIALVSYSLFRNHIIT...SPSPSPSVGARFRAIALVSYSLFRNHIITSPSPSPSVGARFRAIALVSYSLFRNHIITSPSPSPFVGARFRAIALVSYSLFRNHIITSPSPSPFVGARFRAIALVSYSLFRNHIIT...SPSPSPFVGARFRAIALVSYSLFRNHIITSPSPSPFVGARFRAIALVSYSLFRNHIITSPSPSPFVGEGFRVRGNVLSDW ...

  2. Indicators: Cyanobacteria

    Science.gov (United States)

    Cyanobacteria, also referred to as blue-green algae, naturally occur in all freshwater ecosystems. However, too many nutrients such as phosphorus and nitrogen in the waterway can result in conditions that lead to cyanobacterial blooms.

  3. Antioxidant activity of the microalga Spirulina maxima

    OpenAIRE

    Miranda M.S.; Cintra R.G.; Barros S.B.M.; Mancini-Filho J.

    1998-01-01

    Spirulina maxima, which is used as a food additive, is a microalga rich in protein and other essential nutrients. Spirulina contains phenolic acids, tocopherols and ß-carotene which are known to exhibit antioxidant properties. The aim of the present study was to evaluate the antioxidant capacity of a Spirulina extract. The antioxidant activity of a methanolic extract of Spirulina was determined in vitro and in vivo. The in vitro antioxidant capacity was tested on a brain homogenate incubated ...

  4. Phycocyanin extraction in Spirulina produced using agricultural waste

    Science.gov (United States)

    Taufiqurrahmi, N.; Religia, P.; Mulyani, G.; Suryana, D.; Ichsan; Tanjung, F. A.; Arifin, Y.

    2017-06-01

    Phycocyanin is a pigment-protein complex synthesized by blue-green microalgae such as Arthrospira (Spirulina) platensis. This pigment is used mainly as natural colouring in food industry. Previous studies have demonstrated the potential health benefits of this natural pigment. The price of phycocyanin is a vital factor that dictates its marketability. The cost of culturing the algae, particularly from the substrate used for growth, is one of the main factors that determine the price of phycocyanin. Another important factor is the growth yield of the algae. In our research, agricultural waste such as charcoal produced from rice husk was utilized for the algae cultivation to replace the synthetic chemicals such as urea and triple superphosphate used the mineral medium. The use of this low cost substrate increases the cell concentration by 60 % during 8 days’ cultivation to reach 0.39 g/l. The phycocyanin extraction was performed using water at the different biomass-to-solvent ratio and shaking rates. The phycocyanin concentration and purity (A615/A280) obtained were 1.2 g/l and 0.3. These values are 40 % and 20 % lower than the value obtained from the algae produced using the synthetic chemicals. Further purification produced the extract purity required for food grade. The biomass-solvent ratio does not significantly affect the extract purity; however, the higher shaking rate during extraction reduces the purity. This finding demonstrates the potential of using rice husk as an alternative substrate to cultivate algae for phycocyanin extraction.

  5. Hydrogen production by several cyanobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Dhruv; Kumar, H.D. (Banaras Hindu Univ., Varanasi (India). Dept. of Botany)

    1992-11-01

    Twenty species belonging to eleven genera of nitrogen-fixing and non-nitrogen-fixing cyanobacteria were screened for production of hydrogen. Only one species each of Nostoc and Anabaena showed light-and nitrogenase-dependent aerobic hydrogen production. The highest rate of aerobic hydrogen production was recorded in Anabaena sp. strain CA. When incubated anaerobically under 99% Ar + 1% CO[sub 2], all the tested strains produced hydrogen. Nickel supplementation completely abolished hydrogen production both under aerobic and anaerobic conditions, except in Anabaena sp. strain CA, where only the rate of production was decreased. Species of Plectonema, Oscillatoria and Spirulina showed methyl viologen-dependent (hydrogenase-dependent) hydrogen production. Other physiological activities were also studied with a view to selecting a suitable organism for large-scale production of hydrogen. (author)

  6. Antioxidative effect of Arthrospira platensis biomass on the lipid oxidation| Efeito antioxidante da biomassa de Arthrospira platensis sobre a oxidação lipídica

    Directory of Open Access Journals (Sweden)

    Dayane Meireles de Souza

    2017-08-01

    Full Text Available Introduction: Cyanobacteria are promising natural sources of antioxidants. Environmental conditions that influence synthesis of substances in cultures of cyanobacteria have been studied. Objective: This investigation aimed to evaluate the antioxidative effect of Arthrospira platensis biomass on the process of lipid oxidation in bulk oil and oil/water emulsion. Method: Arthrospira platensis growth potential for antioxidant production under different cultivation conditions using an experimental design. The antioxidative effect of the methanolic extracts and the biomass on preventing lipid oxidation was measured by peroxide value (PV. Results: The results showed that the growing conditions to obtain the biomass promoted change in the protective ability of different biomass extracts. Extracts obtained from the cultivated biomass grown under 150 μmol photons/m2s-1, 1.875 g.L-1 NaNO3; 13.5 g.L-1 NaHCO3 (assay14 and 50 μmol photons/m2s-1, 2.5 g.L-1 NaNO3; 18.0 g.L-1 NaHCO3 (standard showed the most antioxidative effect on preventing lipid oxidation, therefore used in the formulation of mayonnaise. The mayonnaise made with soybean oil and 0.5% biomass was preserved against lipid photodegradation during seven days of storage, but the peroxide value related to control varied from 2.9 to 3.1 mEqO2.Kg-1, with no significant difference in the preservation afforded by tert-butilhydroquinone, in the same period of storage. In mayonnaise made with sunflower oil, biomass, independent of concentration, was unable to protect the product against photooxidation. Conclusions: The results demonstrate the protective ability on preventing lipid oxidation of Arthrospira platensis biomass and its potential for use in food lipid-based of soybean oil. ============================================== Introdução: Cianobactérias são promissoras fontes naturais de antioxidantes. Condições ambientais que influenciam síntese de substâncias em cultivos de cianobact

  7. Bioethanol Production by Carbohydrate-Enriched Biomass of Arthrospira (Spirulina) platensis

    DEFF Research Database (Denmark)

    Markou, Giorgos; Angelidaki, Irini; Nerantzis, Elias

    2013-01-01

    at four concentrations, 2.5 N, 1 N, 0.5 N and 0.25 N, and for each acid concentration the saccharification was conducted under four temperatures (40 °C, 60 °C, 80 °C and 100 °C). Higher acid concentrations gave in general higher reducing sugars (RS) yields (%, gRS/gTotal sugars) with higher rates, while...... the increase in temperature lead to higher rates at lower acid concentration. The hydrolysates then were used as substrate for ethanolic fermentation by a salt stress-adapted Saccharomyces cerevisiae strain. The bioethanol yield (%, gEtOH/gBiomass) was significantly affected by the acid concentration used...

  8. Sequence of the gamma-subunit of Spirulina platensis : a new principle of thiol modulation of F0F1 ATP synthase?

    NARCIS (Netherlands)

    Steinemann, D.; Lill, H

    1995-01-01

    The gene encoding the gamma subunit of Spirulina platensis F0F1, the relative of the chloroplast F1 subunit responsible for thiol activation, has been cloned and sequenced. As in other cyanobacteria, a specific couple of cysteines like those involved in thiol modulation of the chloroplast enzyme was

  9. New genome sequence data and molecular tools promote the use of photosynthetic and edible cyanobacteria in bioregenerative systems to support human space exploration.

    Science.gov (United States)

    Leys, Natalie; Morin, Nicolas; Janssen, Paul; Mergeay, Max

    Cyanobacteria are daily used as nutritional supplements (e.g. Spirulina) and are considered for promising applications beyond Earth, in space, where they can play a crucial role in closed miniaturised biological waste recycling systems that are currently developed to support future long-term space missions. Cyanobacteria can be cultured with artificial light in controllable photobioreactors, and used for the efficient removal of CO2 from and production of O2 in the at-mosphere of the confined spacecraft, for removal of nitrate from waste water that is recycled to potable water, and as complementary food source. In this context, the filamentous cyanobac-terium Arthrospira sp. PCC 8005 was selected as part of the bio-regenerative life-support system MELiSSA from the European Space Agency. For bioprocess control and optimisation, the access to its genetic information and the development of molecular tools is crucial. Here we report on our efforts to determine the full genome of the cyanobacterium Arthrospira sp. PCC 8005. The obtained sequence data were analysed in detail to gain a better insight in the photosynthetic, nutritive, or potential toxic potential of this strain. In addition, the sensitivity of PCC 8005 to ionizing radiation was investigated because prolonged exposure of PCC 8005 to cosmic radiation in space might have a deleterious effect on its metabolism and oxygenic properties. To our knowledge, of the 6 different research groups across the globe trying to sequence Arthrospira strains, none of them, including us, were yet able to obtain a complete genome sequence. For Arthrospira sp. strain PCC 8005, we obtained 119 contigs (assembled in 16 scaffolds), representing 6,3 Mb, with 5,856 predicted protein-coding sequences (CDSs) and 176 genes encoding RNA. The PCC 8005 genome displays an unusual high number of large repeated sequences, covering around 8% of the genome, which likely hampered the sequenc-ing. The PCC 8005 genome is also ridden by mobile

  10. Biological CO2 mitigation from coal power plant by Chlorella fusca and Spirulina sp.

    Science.gov (United States)

    Duarte, Jessica Hartwig; de Morais, Etiele Greque; Radmann, Elisângela Martha; Costa, Jorge Alberto Vieira

    2017-06-01

    CO 2 biofixation by microalgae and cyanobacteria is an environmentally sustainable way to mitigate coal burn gas emissions. In this work the microalga Chlorella fusca LEB 111 and the cyanobacteria Spirulina sp. LEB 18 were cultivated using CO 2 from coal flue gas as a carbon source. The intermittent flue gas injection in the cultures enable the cells growth and CO 2 biofixation by these microorganisms. The Chlorella fusca isolated from a coal power plant could fix 2.6 times more CO 2 than Spirulina sp. The maximum daily CO 2 from coal flue gas biofixation was obtained with Chlorella fusca (360.12±0.27mgL -1 d -1 ), showing a specific growth rate of 0.17±<0.01d -1 . The results demonstrated the Chlorella fusca LEB 111 and Spirulina sp. LEB 18 potential to fix CO 2 from coal flue gas, and sequential biomass production with different biotechnological destinations. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Protein (Cyanobacteria): 479132094 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 30 696747:230 ... WD-40 repeat protein Arthrospira platensis NIES-39 MVIASGGASLFNLATGEAVWEIDCPALGGAVSADGRLLALRSNKDIYLWDLSTGQLLRQLTGHTST...VNSVRFSRRGQTLASGSGDNTVRLWDVATGRELRQLTGHTSTVNSVRFSRRGQTLASGSGDNTVRLWDVATGRELRQLTGHTSTVYSVSFSRRGQTLASGSDDGVVRLWRVGF

  12. Large red cyanobacterial mats (Spirulina subsalsa Oersted ex Gomont in the shallow sublittoral of the southern Baltic

    Directory of Open Access Journals (Sweden)

    Piotr Balazy

    2014-06-01

    Full Text Available We report the first observation of large red cyanobacterial mats in the southern Baltic Sea. The mats (up to 2.5 m in diameter were observed by SCUBA divers at 7.7 m depth on loamy sediments in the Gulf of Gdańsk in mid-November 2013. The main structure of the mat was formed by cyanobacteria Spirulina subsalsa Oersted ex Gomont; a number of other cyanobacteria, diatoms and nematode species were also present. After a few days in the laboratory, the red trichomes of S. subsalsa started to turn blue-green in colour, suggesting the strong chromatic acclimation abilities of this species.

  13. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption

    Science.gov (United States)

    Markou, Giorgos; Depraetere, Orily; Vandamme, Dries; Muylaert, Koenraad

    2015-01-01

    In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P) source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina) platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control). Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control. PMID:25690037

  14. Possible role of Arthrospira platensis in reversing oxidative stress-mediated liver damage in rats exposed to lead.

    Science.gov (United States)

    Khalil, Samah R; Elhady, Walaa M; Elewa, Yaser H A; Abd El-Hameed, Noura E; Ali, Sozan A

    2018-01-01

    Environmental pollutants, particularly metallic elements, mobilized and released into the environment, eventually accumulate in the food chain and thus pose a serious threat to human and animal health. In the present study, the role of Arthrospira (Spirulina platensis; SP) as a protector against oxidative stress-mediated liver damage induced by an exposure to lead acetate (LA; as a metallic pollutant) was assessed. To achieve this aim, rats were orally administered with 300 mg/kg bw SP for 15 days, before and concurrently with an intraperitoneal injection of 50 mg/kg bw LA (6 injections throughout 15 days). As a result, co-administration of SP with LA reduced the amount of lead that accumulated in both blood and liver tissue of the exposed rats and minimized the increased levels of lipid peroxidation, protein oxidation, DNA oxidative damage, and liver enzyme endpoints. In addition, because of SP administration, the levels of depleted biomarkers of antioxidant status and total antioxidant capacity in LA-exposed rats improved. Moreover, SP protected the liver tissue against the changes caused by LA exposure and also decreased the reactivity of HSP70 in the cytoplasm of hepatocytes. Collectively, our data suggest that SP has a potential use as a food supplement in the regions highly polluted with heavy metals such as lead. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption

    Directory of Open Access Journals (Sweden)

    Giorgos Markou

    2015-02-01

    Full Text Available In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control. Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control.

  16. Construction of a Genome-Scale Metabolic Model of Arthrospira platensis NIES-39 and Metabolic Design for Cyanobacterial Bioproduction.

    Directory of Open Access Journals (Sweden)

    Katsunori Yoshikawa

    Full Text Available Arthrospira (Spirulina platensis is a promising feedstock and host strain for bioproduction because of its high accumulation of glycogen and superior characteristics for industrial production. Metabolic simulation using a genome-scale metabolic model and flux balance analysis is a powerful method that can be used to design metabolic engineering strategies for the improvement of target molecule production. In this study, we constructed a genome-scale metabolic model of A. platensis NIES-39 including 746 metabolic reactions and 673 metabolites, and developed novel strategies to improve the production of valuable metabolites, such as glycogen and ethanol. The simulation results obtained using the metabolic model showed high consistency with experimental results for growth rates under several trophic conditions and growth capabilities on various organic substrates. The metabolic model was further applied to design a metabolic network to improve the autotrophic production of glycogen and ethanol. Decreased flux of reactions related to the TCA cycle and phosphoenolpyruvate reaction were found to improve glycogen production. Furthermore, in silico knockout simulation indicated that deletion of genes related to the respiratory chain, such as NAD(PH dehydrogenase and cytochrome-c oxidase, could enhance ethanol production by using ammonium as a nitrogen source.

  17. Photosensitizers from Spirulina for Solar Cell

    Directory of Open Access Journals (Sweden)

    Liqiu Wang

    2014-01-01

    Full Text Available Spirulina is a kind of blue-green algae with good photosynthetic efficiency and might be used for photovoltaic power generation. So this paper used living spirulina as novel photosensitizer to construct spirulina biosolar cell. The results showed that spirulina had the photoelectric conversion effect, and could let the spirulina biosolar cell have 70 μA photocurrent. Meanwhile, adding glucose sucrose or chitosan in the spirulina anode chamber, they could make the maxima current density of the cell greatly increased by 80 μA, 100 μA, and 84 μA, respectively, and the sucrose could improve the maximum power density of the cell to 63 mW/m−2. Phycobiliprotein played an important role in the photosynthesis of spirulina. So in this paper phycobiliprotein was extracted from spirulina to composite with squaraine dye to sensitize nanocrystalline TiO2 photoanode for building dye sensitized solar cell, and the photoelectric properties of the cell also were investigated.

  18. Response of Spirulina Platensis to Sulfamethazine Contamination

    Science.gov (United States)

    Xu, Xiankuan; Lu, Xiaohong; Ma, Xiangjuan; Xia, Huilong

    2018-01-01

    The interaction between a positive important biological energy source algae Spirulina platensis and an antimicrobial drug sulfamethazine was studied by a panel of bioassays. The result demonstrated that the acute toxicity of sulfadimidine on Spirulina platensis gradually increased with the increasing of the concentration of sulfadimidine. During the exposure, the toxicity of sulfamethazine on Spirulina platensis enlarged at first and reduced thereafter, and the summit was at 48 h, showing a typical “bell” curve. The EC50 in 48 h was 6.06 mg/L. Spirulina platensis was able to accumulate and degrade sulfamethazine simultaneously. The amounts of sulfamethazine accumulated and degraded by Spirulina platensis were 1.40 mg/kg and 0.64 mg/kg (dry weight) at 24 h, respectively. After 96 h of exposure, the accumulation decreased to 0.47 mg/kg, however, the degradation of sulfamethazine increased to 6.57 mg/kg. Due to biological activity, the removal rate of sulfamethazine was 5.2 times in the nutrient solution with Spirulina platensis as that of without Spirulina platensis. The results of this study implied that Spirulina platensis had a potential to remove sulfamethazine in the sulfamethazine contaminated aquatic ecosystems.

  19. Production of phenolic compounds from Spirulina maxima ...

    African Journals Online (AJOL)

    The purpose of this study was to illustrate the enhancing process of phenolics synthesis in Spirulina maxima grown in Zarrouk's medium supplemented with different concentration of NaNO3 and/or combined with phenylalanine (L-PA). Also, the protective efficacy of Spirulina polyphenolic (SPP) extracts against ...

  20. Development of cassava doughnuts enriched with Spirulina platensis biomass Desenvolvimento de 'sonho de mandioca' enriquecido com biomassa de Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Samantha Ferreira Rabelo

    2013-03-01

    Full Text Available The cyanobacteria Spirulina platensis has been cultivated in a fed batch process with urea as the nitrogen source, in order to obtain dehydrated biomass for incorporation into food, aiming at nutritional enrichment and the production of a functional character, due to the amount of proteins, vitamins and several bioactive compounds found in this cyanobacterium. In this study, response surface methodology was used to analyze the substitution of wheat flour by cassava in the development of doughnuts with added Spirulina platensis biomass and inverted sugar, in order to increase the rate of the Maillard's reaction and mask the green colour of the biomass. The formulations were evaluated in relation to their proximate, sensory and technological compositions, which, when compared to the standard formulation, without the addition of S. platensis biomass and inverted sugar, showed the feasibility of adding the biomass to bestow nutritional enrichment without significantly affecting the sensory acceptance of the product or its typical characteristics.Cultivos da cianobactéria Spirulina platensis vêm sendo conduzidos utilizando-se ureia como fonte de nitrogênio, em processo descontínuo alimentado, para obtenção de biomassa desidratada para ser incorporada em alimentos visando enriquecimento nutricional e conferir caráter funcional em virtude da composição rica em proteínas, vitaminas e diversos componentes bioativos. Neste trabalho, foi estudada a substituição da farinha de trigo pela mandioca, além da adição de biomassa de Spirulina platensis e açúcar invertido, para desenvolver um 'sonho' com elevada taxa da Reação de Maillard para mascarar a coloração verde da biomassa, por meio da metodologia de superfície de resposta. As formulações foram avaliadas em relação aos aspectos de composição centesimal, sensoriais e tecnológicos que, quando comparados com o padrão, sem adição de biomassa de S. platensis e açúcar invertido

  1. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis.

    Science.gov (United States)

    Fang, Linchuan; Zhou, Chen; Cai, Peng; Chen, Wenli; Rong, Xingmin; Dai, Ke; Liang, Wei; Gu, Ji-Dong; Huang, Qiaoyun

    2011-06-15

    Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH(4)NO(3), respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. Copyright © 2011 Elsevier B.V. All rights reserved.

  2. Fermentation in cyanobacteria

    NARCIS (Netherlands)

    Stal, L.J.; Moezelaar, R.

    1997-01-01

    Although cyanobacteria are oxygenic phototrophic organisms, they often thrive in environments that become periodically anoxic. This is particularly the case in the dark when photosynthetic oxygen evolution does not take place. Whereas cyanobacteria generally utilize endogenous storage carbohydrate

  3. Improvement the Yoghurt Nutritional Value, Organoleptic Properties and Preferences by Spirulina (Spirulina platensis) Supplementation

    Science.gov (United States)

    Suzery, M.; Hadiyanto; Sutanto, H.; Widiastuti, Y.; Judiono

    2018-04-01

    Spirulina sp has been identified as potential source food functional such as protein, amino acids and other high added value compounds from microalgae. One of the compounds is phycocyanin as also known for antioxidant use. This research was aimed to increase the nutritional value and organoleptic properties and preferences yoghurt by Spirulina platensis supplementation. Completely randomized controlled group design conducted by 31 respondents. Spirulina Research accomplished in Food Technology, Microbiology and Chemistry Laboratory at Bandung Health Polytechnic in Bandung. Samples divided randomly into three groups: (1) yoghurt standard supplemented 50 ml, (2) yoghurt and spirulina 1% supplemented 50 ml, (3) yoghurt and spirulina 1,2% supplemented 50 ml. Spirulina was added concentration by 0, 1, 1,2 % calculated by dx trial. Proximate analysis revealed the highest protein in enriched by spirulina 1%. However fat was lower 3.48 – 3.56 compare to control. All products found growing Lactobacillus acidophilus with a pH of 4.0 range. There was no microbial contamination such as E coli, Salmonella sp, Pseudomonas sp. Supplementation of spirulina to yoghurt products can be accepted by organoleptic, chemical and microbiological tests of concentrations of 1 and 1.2%. The material makes the blue colours more attractive and can be accepted by the expert panellist.

  4. Antioxidant activity of the microalga Spirulina maxima

    Directory of Open Access Journals (Sweden)

    M.S. Miranda

    1998-08-01

    Full Text Available Spirulina maxima, which is used as a food additive, is a microalga rich in protein and other essential nutrients. Spirulina contains phenolic acids, tocopherols and ß-carotene which are known to exhibit antioxidant properties. The aim of the present study was to evaluate the antioxidant capacity of a Spirulina extract. The antioxidant activity of a methanolic extract of Spirulina was determined in vitro and in vivo. The in vitro antioxidant capacity was tested on a brain homogenate incubated with and without the extract at 37oC. The IC50 (concentration which causes a 50% reduction of oxidation of the extract in this system was 0.18 mg/ml. The in vivo antioxidant capacity was evaluated in plasma and liver of animals receiving a daily dose of 5 mg for 2 and 7 weeks. Plasma antioxidant capacity was measured in brain homogenate incubated for 1 h at 37oC. The production of oxidized compounds in liver after 2 h of incubation at 37oC was measured in terms of thiobarbituric acid reactant substances (TBARS in control and experimental groups. Upon treatment, the antioxidant capacity of plasma was 71% for the experimental group and 54% for the control group. Data from liver spontaneous peroxidation studies were not significantly different between groups. The amounts of phenolic acids, a-tocopherol and ß-carotene were determined in Spirulina extracts. The results obtained indicate that Spirulina provides some antioxidant protection for both in vitro and in vivo systems.

  5. Functional Lycopene Cyclase (CruA) in Cyanobacterium, Arthrospira platensis NIES-39, and its Role in Carotenoid Synthesis.

    Science.gov (United States)

    Sugiyama, Kenjiro; Ebisawa, Masashi; Yamada, Masaharu; Nagashima, Yoshiki; Suzuki, Hideyuki; Maoka, Takashi; Takaichi, Shinichi

    2017-04-01

    The genus Arthrospira is filamentous, non-nitrogen-fixing cyanobacteria that is commercially important. We identified the molecular structures of carotenoids in Arthrospira platensis NIES-39. The major carotenoid identified was β-carotene. In addition, the hydroxyl derivatives of β-cryptoxanthin and (3R,3'R)-zeaxanthin were also found to be present. The carotenoid glycosides were identified as (3R,2'S)-myxol 2'-methylpentoside and oscillol 2,2'-dimethylpentoside. The methylpentoside moiety was a mixture of fucoside and chinovoside in an approximate ratio of 1 : 4. Trace amounts of the ketocarotenoid 3'-hydroxyechinenone were also found. Three types of lycopene cyclases have been functionally confirmed in carotenogenesis organisms. In cyanobacteria, the functional lycopene cyclases (CrtL, CruA and CruP) have only been found in four species. In this study, we found that CruA exhibited lycopene cyclase activity in transformed Escherichia coli, which contains lycopene, but CruP exhibited no lycopene cyclase activity and crtL was absent. This is the third cyanobacterial species in which CruA activity has been confirmed. Neurosporene was not a substrate of CruA in E. coli, whereas lycopene cyclases of CrtY (bacteria), CrtL (plants) and CrtYB (fungi) have been reported to convert neurosporene to 7,8-dihydro-β-carotene. β-Carotene hydroxylase (CrtR) was found to convert β-carotene to zeaxanthin in transformed E. coli, which contains β-carotene. Among the β-carotene hydroxylases, bacterial CrtZ and eukaryotic CrtR and BCH have similarities, whereas cyanobacterial CrtR appears to belong to another clade. Based on the identification of the carotenoids and the completion of the entire nucleotide sequence of the A. platensis NIES-39 genome, we propose a biosynthetic pathway for the carotenoids as well as the corresponding genes and enzymes. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved

  6. SP/RULINA (ARTHROSPIRA: AN EDIBLE MICROORGANISM: A REVIEW

    Directory of Open Access Journals (Sweden)

    Martba Sáncbez

    2003-06-01

    Full Text Available Spirulina is a photosynthetic, filamentous, helical-shaped, multicellular and green-blue microalga. The two most important species of which are Spirulina maxima and Spirulina platensis. For these microórgarusms cell division occurs by binary fission. Since this material contains chlorophyll a, Jike higher plants, botanists classify it as a microalgae belonging to Cyanophyceae class; but according to bacteriologists it is a bacteria dueto its prokaryotic structure. Before Columbus, Mexicans (Aztecs exploited this microorganism as human food; presently, African tribes (Kanembu use it for the same purpose. Its chemical composition includes proteins (55%-70%, carbohydrates (15%-25%, essential fatty acids (18%, vitamins, minerals and pigments like carotenes, chlorophyll a and phycocyanin. The last one is used in food and cosmetic industries. Spirulina is considered as an excellent food, lacking toxicity and having corrective properties against viral attacks, anemia, tumor growth and malnUtrition. It has been reported in literature that the use of these microalgae as animal food supplement implies enhancement of the yellow coloration of skin and eggs yo !k in poultry and flaDlÍOgos, growth acceleration, sexual maturation and increase of fertility in cattle.

  7. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    International Nuclear Information System (INIS)

    Fang Linchuan; Zhou Chen; Cai Peng; Chen Wenli; Rong Xingmin; Dai Ke; Liang Wei; Gu Jidong; Huang Qiaoyun

    2011-01-01

    Highlights: → The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. → Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. → XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH 4 NO 3 , respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  8. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    Energy Technology Data Exchange (ETDEWEB)

    Fang Linchuan [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Zhou Chen; Cai Peng [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Chen Wenli [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Rong Xingmin; Dai Ke; Liang Wei [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Gu Jidong [Department of Ecology and Biodiversity, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Huang Qiaoyun, E-mail: qyhuang@mail.hzau.edu.cn [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China)

    2011-06-15

    Highlights: {yields} The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. {yields} Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. {yields} XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH{sub 4}NO{sub 3}, respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  9. Culture of microalgae Spirulina platensis with isotope stable Carbon-13

    International Nuclear Information System (INIS)

    Cronemberger, Luiz C.A.; Costa, Vladimir E.

    2017-01-01

    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical 99m Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ( 13 C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of 13 C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure 13 C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard

  10. Determination of the elemental composition of cyanobacteria cells and cell fractions by atomic emission and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Sedykh, Eh.M.; Lyabusheva, O.A.; Bannykh, L.N.; Tambiev, A.Kh.

    2005-01-01

    An approach to studying the elemental composition of cyanobacteria Spirulina platensis and Nostoc commune using a set of complementary analytical methods (ICP-AES, PAAS, and ETAAS) was proposed . The procedures were adapted for the determination of macro- and microelements (Na, K, Mg, Ca, Fe, Mn, Cu, Mo, Zn, B, and Se) in the biomass of cyanobacteria and separated cell fractions (chloroform and water-methanol extracts and precipitates). The conditions for the mineralization of biological materials were optimized for autoclave and microwave sample preparation procedures. The evaporation and atomization of Se and Mo in a graphite furnace in the presence of chloroform and methanol were studied [ru

  11. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani

    2015-06-01

    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy. Keywords: Dietary fiber, jelly drink, protein, seaweed, Spirulina platensis

  12. Separation, identification and quantification of carotenoids and chlorophylls in dietary supplements containing Chlorella vulgaris and Spirulina platensis using High Performance Thin Layer Chromatography.

    Science.gov (United States)

    Hynstova, Veronika; Sterbova, Dagmar; Klejdus, Borivoj; Hedbavny, Josef; Huska, Dalibor; Adam, Vojtech

    2018-01-30

    In this study, 14 commercial products (dietary supplements) containing alga Chlorella vulgaris and cyanobacteria Spirulina platensis, originated from China and Japan, were analysed. UV-vis spectrophotometric method was applied for rapid determination of chlorophylls, carotenoids and pheophytins; as degradation products of chlorophylls. High Performance Thin-Layer Chromatography (HPTLC) was used for effective separation of these compounds, and also Atomic Absorption Spectrometry for determination of heavy metals as indicator of environmental pollution. Based on the results obtained from UV-vis spectrophotometric determination of photosynthetic pigments (chlorophylls and carotenoids), it was confirmed that Chlorella vulgaris contains more of all these pigments compared to the cyanobacteria Spirulina platensis. The fastest mobility compound identified in Chlorella vulgaris and Spirulina platensis using HPTLC method was β-carotene. Spectral analysis and standard calibration curve method were used for identification and quantification of separated substances on Thin-Layer Chromatographic plate. Quantification of copper (Cu 2+ , at 324.7 nm) and zinc (Zn 2+ , at 213.9nm) was performed using Flame Atomic Absorption Spectrometry with air-acetylene flame atomization. Quantification of cadmium (Cd 2+ , at 228.8 nm), nickel (Ni 2+ , at 232.0nm) and lead (Pb 2+ , at 283.3nm) by Electrothermal Graphite Furnace Atomic Absorption Spectrometry; and quantification of mercury (Hg 2+ , at 254nm) by Cold Vapour Atomic Absorption Spectrometry. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Quantitative Isotope-Dilution High-Resolution-Mass-Spectrometry Analysis of Multiple Intracellular Metabolites in Clostridium autoethanogenum with Uniformly 13C-Labeled Standards Derived from Spirulina.

    Science.gov (United States)

    Schatschneider, Sarah; Abdelrazig, Salah; Safo, Laudina; Henstra, Anne M; Millat, Thomas; Kim, Dong-Hyun; Winzer, Klaus; Minton, Nigel P; Barrett, David A

    2018-04-03

    We have investigated the applicability of commercially available lyophilized spirulina ( Arthrospira platensis), a microorganism uniformly labeled with 13 C, as a readily accessible source of multiple 13 C-labeled metabolites suitable as internal standards for the quantitative determination of intracellular bacterial metabolites. Metabolites of interest were analyzed by hydrophilic-interaction liquid chromatography coupled with high-resolution mass spectrometry. Multiple internal standards obtained from uniformly (U)- 13 C-labeled extracts from spirulina were used to enable isotope-dilution mass spectrometry (IDMS) in the identification and quantification of intracellular metabolites. Extraction of the intracellular metabolites of Clostridium autoethanogenum using 2:1:1 chloroform/methanol/water was found to be the optimal method in comparison with freeze-thaw, homogenization, and sonication methods. The limits of quantification were ≤1 μM with excellent linearity for all of the calibration curves ( R 2 ≥ 0.99) for 74 metabolites. The precision and accuracy were found to be within relative standard deviations (RSDs) of 15% for 49 of the metabolites and within RSDs of 20% for all of the metabolites. The method was applied to study the effects of feeding different levels of carbon monoxide (as a carbon source) on the central metabolism and Wood-Ljungdahl pathway of C. autoethanogenum grown in continuous culture over 35 days. Using LC-IDMS with U- 13 C spirulina allowed the successful quantification of 52 metabolites in the samples, including amino acids, carboxylic acids, sugar phosphates, purines, and pyrimidines. The method provided absolute quantitative data on intracellular metabolites that was suitable for computational modeling to understand and optimize the C. autoethanogenum metabolic pathways active in gas fermentation.

  14. JST Thesaurus Headwords and Synonyms: Arthrospira platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Arthrospira platensis 名詞 一般 * * *... * スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Arthrospira platensis

  15. Trade-Off between Growth and Carbohydrate Accumulation in Nutrient-Limited Arthrospira sp. PCC 8005 Studied by Integrating Transcriptomic and Proteomic Approaches.

    Directory of Open Access Journals (Sweden)

    Orily Depraetere

    Full Text Available Cyanobacteria have a strong potential for biofuel production due to their ability to accumulate large amounts of carbohydrates. Nitrogen (N stress can be used to increase the content of carbohydrates in the biomass, but it is expected to reduce biomass productivity. To study this trade-off between carbohydrate accumulation and biomass productivity, we characterized the biomass productivity, biomass composition as well as the transcriptome and proteome of the cyanobacterium Arthrospira sp. PCC 8005 cultured under N-limiting and N-replete conditions. N limitation resulted in a large increase in the carbohydrate content of the biomass (from 14 to 74% and a decrease in the protein content (from 37 to 10%. Analyses of fatty acids indicated that no lipids were accumulated under N-limited conditions. Nevertheless, it did not affect the biomass productivity of the culture up to five days after N was depleted from the culture medium. Transcriptomic and proteomic analysis indicated that de novo protein synthesis was down-regulated in the N-limited culture. Proteins were degraded and partly converted into carbohydrates through gluconeogenesis. Cellular N derived from protein degradation was recycled through the TCA and GS-GOGAT cycles. In addition, photosynthetic energy production and carbon fixation were both down-regulated, while glycogen synthesis was up-regulated. Our results suggested that N limitation resulted in a redirection of photosynthetic energy from protein synthesis to glycogen synthesis. The fact that glycogen synthesis has a lower energy demand than protein synthesis might explain why Arthrospira is able to achieve a similar biomass productivity under N-limited as under N-replete conditions despite the fact that photosynthetic energy production was impaired by N limitation.

  16. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani

    2015-06-01

    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy.

  17. Genetically Engineered Cyanobacteria

    Science.gov (United States)

    Zhou, Ruanbao (Inventor); Gibbons, William (Inventor)

    2015-01-01

    The disclosed embodiments provide cyanobacteria spp. that have been genetically engineered to have increased production of carbon-based products of interest. These genetically engineered hosts efficiently convert carbon dioxide and light into carbon-based products of interest such as long chained hydrocarbons. Several constructs containing polynucleotides encoding enzymes active in the metabolic pathways of cyanobacteria are disclosed. In many instances, the cyanobacteria strains have been further genetically modified to optimize production of the carbon-based products of interest. The optimization includes both up-regulation and down-regulation of particular genes.

  18. Control of Branchionus sp. and Amoeba sp. in cultures of Arthrospira sp. Control de Branchionus sp. y Amoeba sp. en cultivos de Arthrospira sp.

    Directory of Open Access Journals (Sweden)

    Carlos Méndez

    2012-09-01

    Full Text Available Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U and ammonium bicarbonate (AB, in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concentration 100 (LC100 at 24 h for Branchionus sp. and Amoeba sp. determined was of 60-80 mg L-1 (U and 100-150 mg L-1 (AB. The average effective inhibition concentration for 50% of the population (IC50 in Arthrospira sp., after 72 h, was 80 mg L-1 (U and 150 mg L-1 (AB. The application of doses of 60 mg L-1 (U or 100 mg L-1 (AB in the outdoor mass culture of this contaminated microalga, completely inhibited grazing and did not affect the growth of Arthrospira sp. but rather promoted rapid recovery of algal density at levels prior to infestation. These compounds provided an economical and effective control of predators in cultures of Arthrospira sp.El cultivo de la cianobacteria Arthrospira sp. ha sido desarrollado en muchos países para la obtención de proteínas, pigmentos y otros compuestos. Cultivo que a nivel industrial se ve afectado frecuentemente por contaminación biológica, reduciendo drásticamente la productividad hasta causar la muerte. Este estudio evalúa el control de Branchionus sp. y de Amoeba sp. con dos compuestos químicos, la urea (U y bicarbonato de amonio (AB en cultivos de Arthrospira sp. La concentración letal 100 (LC100 determinada a las 24 h para Branchionus sp. y Amoeba sp. fue de 60-80 mg L-1 (U y 100-150 mg L-1 (AB. La concentración media de inhibición efectiva, después de 72 h, para el 50% de la población (IC50 en Arthrospira fue de 80 mg L-1 (U y 150 mg L-1 (AB. La aplicación de dosis de 60 mg L-1 (U ó 100 mg L-1 (AB en

  19. Cyanobacteria Index (MERIS)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset shows the concentration of cyanobacteria cells/ml in fresh water bodies and estuaries of the Ohio and Florida derived from 300x300 meter MEdium...

  20. Low-parachor solvents extraction and thermostated micro-thin-layer chromatography separation for fast screening and classification of spirulina from pharmaceutical formulations and food samples.

    Science.gov (United States)

    Zarzycki, Paweł K; Zarzycka, Magdalena B; Clifton, Vicki L; Adamski, Jerzy; Głód, Bronisław K

    2011-08-19

    The goal of this paper is to demonstrate the separation and detection capability of eco-friendly micro-TLC technique for the classification of spirulina and selected herbs from pharmaceutical and food products. Target compounds were extracted using relatively low-parachor liquids. A number of the spirulina samples which originated from pharmaceutical formulations and food products, were isolated using a simple one step extraction with small volume of methanol, acetone or tetrahydrofuran. Herb samples rich in chlorophyll dyes were analyzed as reference materials. Quantitative data derived from micro-plates under visible light conditions and after iodine staining were explored using chemometrics tools including cluster analysis and principal components analysis. Using this method we could easily distinguish genuine spirulina and non-spirulina samples as well as fresh from expired commercial products and furthermore, we could identify some biodegradation peaks appearing on micro-TLC profiles. This methodology can be applied as a fast screening or fingerprinting tool for the classification of genuine spirulina and herb samples and in particular may be used commercially for the rapid quality control screening of products. Furthermore, this approach allows low-cost fractionation of target substances including cyanobacteria pigments in raw biological or environmental samples for preliminary chemotaxonomic investigations. Due to the low consumption of the mobile phase (usually less than 1 mL per run), this method can be considered as environmentally friendly analytical tool, which may be an alternative for fingerprinting protocols based on HPLC machines and simple separation systems involving planar micro-fluidic or micro-chip devices. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Antioxidant potential of selected Spirulina platensis preparations.

    Science.gov (United States)

    Dartsch, Peter C

    2008-05-01

    Recent studies suggest that Spirulina, a unicellular blue-green alga, may have a variety of health benefits and therapeutic properties and is also capable of acting as an antioxidant and antiinflammatory agent. In this study, a cell-free and a cell-based test assay were used to examine the antioxidant and antiinflammatory properties of four selected Spirulina platensis preparations: (1) Biospirulina, (2) SpiruComplex, a preparation with naturally bound selenium, chromium and zinc, (3) SpiruZink, a preparation with naturally bound zinc, (4) Zinkspirulina + Acerola, a preparation with naturally bound zinc and acerola powder. The cell-free test assay used potassium superoxide as a donor for superoxide radicals, whereas the cell-based test assay used the formation of intracellular superoxide radicals of functional neutrophils upon stimulation by phorbol-12-myristate-13-acetate as a model to investigate the potential of Spirulina preparations to inactivate superoxide radicals. In accordance with the recommended daily dosage, test concentrations ranging from 50 to 1000 microg/mL were chosen. The results showed a dose-dependent inactivation of free superoxide radicals (antioxidant effect) as well as an antiinflammatory effect characterized by a dose-dependent reduction of the metabolic activity of functional neutrophils and a dose-dependent inactivation of superoxide radicals generated during an oxidative burst. The results demonstrate that the tested Spirulina preparations have a high antioxidant and antiinflammatory potential. Especially SpiruZink and Zinkspirulina + Acerola might be useful as a supportive therapeutic approach for reducing oxidative stress and/or the generation of oxygen radicals in the course of inflammatory processes.

  2. Temporal Gene Expression of the Cyanobacterium Arthrospira in Response to Gamma Rays

    Science.gov (United States)

    Badri, Hanène; Monsieurs, Pieter; Coninx, Ilse; Nauts, Robin; Wattiez, Ruddy; Leys, Natalie

    2015-01-01

    The edible cyanobacterium Arthrospira is resistant to ionising radiation. The cellular mechanisms underlying this radiation resistance are, however, still largely unknown. Therefore, additional molecular analysis was performed to investigate how these cells can escape from, protect against, or repair the radiation damage. Arthrospira cells were shortly exposed to different doses of 60Co gamma rays and the dynamic response was investigated by monitoring its gene expression and cell physiology at different time points after irradiation. The results revealed a fast switch from an active growth state to a kind of 'survival modus' during which the cells put photosynthesis, carbon and nitrogen assimilation on hold and activate pathways for cellular protection, detoxification, and repair. The higher the radiation dose, the more pronounced this global emergency response is expressed. Genes repressed during early response, suggested a reduction of photosystem II and I activity and reduced tricarboxylic acid (TCA) and Calvin-Benson-Bassham (CBB) cycles, combined with an activation of the pentose phosphate pathway (PPP). For reactive oxygen species detoxification and restoration of the redox balance in Arthrospira cells, the results suggested a powerful contribution of the antioxidant molecule glutathione. The repair mechanisms of Arthrospira cells that were immediately switched on, involve mainly proteases for damaged protein removal, single strand DNA repair and restriction modification systems, while recA was not induced. Additionally, the exposed cells showed significant increased expression of arh genes, coding for a novel group of protein of unknown function, also seen in our previous irradiation studies. This observation confirms our hypothesis that arh genes are key elements in radiation resistance of Arthrospira, requiring further investigation. This study provides new insights into phasic response and the cellular pathways involved in the radiation resistance of

  3. Temporal Gene Expression of the Cyanobacterium Arthrospira in Response to Gamma Rays.

    Directory of Open Access Journals (Sweden)

    Hanène Badri

    Full Text Available The edible cyanobacterium Arthrospira is resistant to ionising radiation. The cellular mechanisms underlying this radiation resistance are, however, still largely unknown. Therefore, additional molecular analysis was performed to investigate how these cells can escape from, protect against, or repair the radiation damage. Arthrospira cells were shortly exposed to different doses of 60Co gamma rays and the dynamic response was investigated by monitoring its gene expression and cell physiology at different time points after irradiation. The results revealed a fast switch from an active growth state to a kind of 'survival modus' during which the cells put photosynthesis, carbon and nitrogen assimilation on hold and activate pathways for cellular protection, detoxification, and repair. The higher the radiation dose, the more pronounced this global emergency response is expressed. Genes repressed during early response, suggested a reduction of photosystem II and I activity and reduced tricarboxylic acid (TCA and Calvin-Benson-Bassham (CBB cycles, combined with an activation of the pentose phosphate pathway (PPP. For reactive oxygen species detoxification and restoration of the redox balance in Arthrospira cells, the results suggested a powerful contribution of the antioxidant molecule glutathione. The repair mechanisms of Arthrospira cells that were immediately switched on, involve mainly proteases for damaged protein removal, single strand DNA repair and restriction modification systems, while recA was not induced. Additionally, the exposed cells showed significant increased expression of arh genes, coding for a novel group of protein of unknown function, also seen in our previous irradiation studies. This observation confirms our hypothesis that arh genes are key elements in radiation resistance of Arthrospira, requiring further investigation. This study provides new insights into phasic response and the cellular pathways involved in the radiation

  4. Protein (Cyanobacteria): 279248 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Arthrospira maxima CS-328 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPV...ZP_03273626.1 1117:4884 1150:2505 35823:234 129910:158 513049:158 diguanylate cycla

  5. Protein (Cyanobacteria): 279234 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09781866.1 1117:4884 1150:2505 35823:234 376219:95 putative Diguanylate cyclase with PAS/PAC and GAF sens...ors Arthrospira sp. PCC 8005 MNQLMEDRSKILWIAGNVGNDNHSLPQSILQNNGYEVHLVIGLKPAYNAIQSWP

  6. Protein (Cyanobacteria): 279247 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_09782276.1 1117:4884 1150:2505 35823:234 376219:114 putative Diguanylate cyclase with PAS/PAC and GAF sen...sors Arthrospira sp. PCC 8005 MMDKYLCPCCSEPLLIHIIAHKKIGFCMNCHQEMPLIEQSRQMATVTEPVDVS

  7. Protein (Cyanobacteria): 479131140 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available xylamine reductase Arthrospira platensis NIES-39 MFCEQCEQTASGQGCHQWGACGKGPDVNAVQDLL... YP_005071100.1 NC_016640 1117:23174 ... 1150:27534 1301283:45982 ... 35823:1467 118562:2804 696747:2804 ... hydro

  8. Protein (Cyanobacteria): 479130489 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_005070449.1 NC_016640 1117:22154 ... 1150:29420 1301283:48078 ... 35823:3164 118562:2384 696747:2384 ... creat...ininase Arthrospira platensis NIES-39 MHNFIPPHRFFPYLTWTEIAEMPDRENTVIIQPIGAIEQHGPHLP

  9. Spirulina maxima Protects Liver From Isoniazid and Rifampicin Drug Toxicity.

    Science.gov (United States)

    Jatav, Santosh Kumar; Kulshrestha, Archana; Zacharia, Anish; Singh, Nita; Tejovathi, G; Bisen, P S; Prasad, G B K S

    2014-07-01

    Hepatotoxicity associated with isoniazid and rifampicin is one of the major impediments in antituberculosis therapy. The present study explored the prophylactic and therapeutic efficacies of Spirulina maxima in isoniazid and rifampicin induced hepatic damage in a rat model. Hepatic damage induced in Wistar rats by isoniazid and rifampicin resulted in significant alterations in biomarkers of liver function, namely, bilirubin, aspartate transaminase, alanine transaminase, alkaline phosphatase, and oxidative stress markers such as superoxide dismutase, catalase, glutathione, and thiobarbituric acid reactive substances. Co-administration of Spirulina maxima along with antituberculosis drugs protected liver from hepatotoxicity due to isoniazid and rifampicin. Administration of Spirulina maxima consecutively for 2 weeks to hepatodamaged animals resulted in restoration of hepatic function as evident from normalization of serum markers of liver function. Thus, the present study revealed remarkable prophylactic and therapeutic potential of Spirulina maxima. Co-administration of Spirulina maxima and antituberculosis drugs is advantageous as it provides extra nutritional benefit. © The Author(s) 2014.

  10. Antiviral activity of exopolysaccharides from Arthrospira platensis against koi herpesvirus.

    Science.gov (United States)

    Reichert, M; Bergmann, S M; Hwang, J; Buchholz, R; Lindenberger, C

    2017-10-01

    Although koi herpesvirus (KHV) has a history of causing severe economic losses in common carp and koi farms, there are still no treatments available on the market. Thus, the aim of this study was to test exopolysaccharides (EPS) for its antiviral activity against KHV, by monitoring inhibition and cytotoxic effects in common carp brain cells. These substances can be easily extracted from extracellular algae supernatant and were identified as groups of sulphated polysaccharides. In order to reach this aim, Arthrospira platensis, which is well known for its antiviral activity of intra- and extracellular compounds towards mammalian herpesviruses, was investigated as standard organism and compared to commercial antiviral drug, ganciclovir, which inhibits the viral DNA polymerization. The antiviral activity of polysaccharides of A. platensis against KHV was confirmed in vitro using qualitative assessment of KHV life cycle genes, and it was found by RT-PCR that EPS, applied at a concentration of >18 μg mL -1 and a multiplicity of infection (MOI) of 0.45 of KHV, suppressed the viral replication in common carp brain (CCB) cells even after 22 days post-infection, entirely. Further, this study presents first data indicating an enormous potential using polysaccharides as an additive for aquacultures to lower or hinder the spread of the KHV and koi herpesvirus disease (KHVD) in future. © 2017 John Wiley & Sons Ltd.

  11. Toxicology of freshwater cyanobacteria.

    Science.gov (United States)

    Liyanage, H M; Arachchi, D N Magana; Abeysekara, T; Guneratne, L

    2016-07-02

    Many chemical contaminants in drinking water have been shown to cause adverse health effects in humans after prolonged exposure. Cyanobacteria are one of the most potent and diverse groups of photosynthetic prokaryotes. One key component of cyanobacterial success in the environment is the production of potent toxins as secondary metabolites, which have been responsible for numerous adverse health impacts in humans. Anthropogenic activities have led to the increase of eutrophication in freshwater bodies' worldwide, causing cyanobacterial blooms to become more frequent. The present article will discuss about harmful cyanobacteria and their toxicology with special references to microcystin, nodularin, and cylindrospermopsin.

  12. The toxins of Cyanobacteria.

    Science.gov (United States)

    Patocka, J

    2001-01-01

    Cyanobacteria, formerly called "blue-green algae", are simple, primitive photosynthetic microorganism wide occurrence in fresh, brackish and salt waters. Forty different genera of Cyanobacteria are known and many of them are producers of potent toxins responsible for a wide array of human illnesses, aquatic mammal and bird morbidity and mortality, and extensive fish kills. These cyanotoxins act as neurotoxins or hepatotoxins and are structurally and functionally diverse, and many are derived from unique biosynthetic pathways. All known cyanotoxins and their chemical and toxicological characteristics are presented in this article.

  13. Spirulina as a livestock supplement and animal feed.

    Science.gov (United States)

    Holman, B W B; Malau-Aduli, A E O

    2013-08-01

    Spirulina (Athrospira sp.) is an edible microalga and a highly nutritious potential feed resource for many agriculturally important animal species. Research findings have associated Spirulina to improvements in animal growth, fertility, aesthetic and nutritional product quality. Spirulina intake has also been linked to an improvement in animal health and welfare. Its influence over animal development stems from its nutritive and protein-rich composition, thus leading to an increased commercial production to meet consumer demand. Consequently, Spirulina is emerging as a cost-effective means of improving animal productivity for a sustainable and viable food security future. However, our present knowledge of animal response to dietary Spirulina supplementation is relatively scanty and largely unknown. Therefore, the primary objective of this paper was to review past and current findings on the utilisation of Spirulina as a feed supplement and its impact on animal productivity and health. Only animals deemed to be of agricultural significance were investigated; hence, only ruminants, poultry, swine and rabbits and their responses to dietary Spirulina supplementation are covered. © 2012 Blackwell Verlag GmbH.

  14. Evaluation of anaerobic digestates from different feedstocks as growth media for Tetradesmus obliquus, Botryococcus braunii, Phaeodactylum tricornutum and Arthrospira maxima

    NARCIS (Netherlands)

    Massa, Marina; Buono, Silvia; Langellotti, Antonio Luca; Castaldo, Luigi; Martello, Anna; Paduano, Antonello; Sacchi, Raffaele; Fogliano, Vincenzo

    2017-01-01

    In this paper, two freshwater microalgae (Tetradesmus obliquus and Botryococcus braunii), a marine diatom (Phaeodactylum tricornutum) and a photosynthetic cyanobacterium (Arthrospira maxima) were investigated for their ability to grow on liquid digestates (LDs). Three LDs were obtained from

  15. Cyanobacteria: an economic perspective

    NARCIS (Netherlands)

    Sharma, N.K.; Rai, A.K.; Stal, L.J.

    2014-01-01

    Written by leading experts in the field, Cyanobacteria: An Economic Perspective is a comprehensive edited volume covering all areas of an important field and its application to energy, medicine and agriculture. Issues related to environment, food and energy have presented serious challenge to the

  16. Ultraviolet radiation and cyanobacteria.

    Science.gov (United States)

    Rastogi, Rajesh Prasad; Sinha, Rajeshwar P; Moh, Sang Hyun; Lee, Taek Kyun; Kottuparambil, Sreejith; Kim, Youn-Jung; Rhee, Jae-Sung; Choi, Eun-Mi; Brown, Murray T; Häder, Donat-Peter; Han, Taejun

    2014-12-01

    Cyanobacteria are the dominant photosynthetic prokaryotes from an ecological, economical, or evolutionary perspective, and depend on solar energy to conduct their normal life processes. However, the marked increase in solar ultraviolet radiation (UVR) caused by the continuous depletion of the stratospheric ozone shield has fueled serious concerns about the ecological consequences for all living organisms, including cyanobacteria. UV-B radiation can damage cellular DNA and several physiological and biochemical processes in cyanobacterial cells, either directly, through its interaction with certain biomolecules that absorb in the UV range, or indirectly, with the oxidative stress exerted by reactive oxygen species. However, cyanobacteria have a long history of survival on Earth, and they predate the existence of the present ozone shield. To withstand the detrimental effects of solar UVR, these prokaryotes have evolved several lines of defense and various tolerance mechanisms, including avoidance, antioxidant production, DNA repair, protein resynthesis, programmed cell death, and the synthesis of UV-absorbing/screening compounds, such as mycosporine-like amino acids (MAAs) and scytonemin. This study critically reviews the current information on the effects of UVR on several physiological and biochemical processes of cyanobacteria and the various tolerance mechanisms they have developed. Genomic insights into the biosynthesis of MAAs and scytonemin and recent advances in our understanding of the roles of exopolysaccharides and heat shock proteins in photoprotection are also discussed. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Glycolipid biosynthesis in cyanobacteria

    International Nuclear Information System (INIS)

    Van Dusen, W.J.; Jaworski, J.G.

    1987-01-01

    The biosynthesis of monogalactosyldiacyl-glycerol (MGDG) was studied in five different cyanobacteria. Previous work has shown Anabaena variabilis to synthesize both MGDG and monoglucosyl-diacylglycerol (MG1cDG) with MG1cDG being the precursor of MGDG. They have examined four other cyanobacteria to determine if a similar relationship exists. The cyanobacteria studied were Anabaena variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis nidulans, and Anacystis marina. Each were grown in liquid culture and lipids were labeled with 14 C]CO 2 for 20 min., 1.0 hr, 1.0 hr + 10 hr chase. Glycolipids were analyzed by initial separation of MGDG and MG1cDG by TLC followed by further analysis by HPLC. Complete separation of molecular species was obtained isocratically on an ODS column. All of the cyanobacteria labeled 16-C and 18-C fatty acids except for A. marina which labeled only 14-C and 16-C fatty acids. Desaturation of the fatty acids could be observed in the 1.0 hr and chase experiments. All were capable of labeling both MG1cDG and MGDG with the precursor-product relationship being observed. There does not appear to be a direct relationship between the epimerization of the sugar moiety and fatty acid desaturation

  18. Nitrogen Fixation in Cyanobacteria

    NARCIS (Netherlands)

    Stal, L.J.

    2008-01-01

    Cyanobacteria are oxygenic photosynthetic bacteria that are widespread in marine, freshwater and terrestrial environments and many of them are capable of fixing atmospheric nitrogen. But ironically, nitrogenase, the enzyme that is responsible for the reduction of N2, is extremely sensitive to O2.

  19. New lantibiotics from cyanobacteria

    OpenAIRE

    Yang, Jiahui Jr

    2016-01-01

    Lantibiotics are a subgroup of bacteriocins, produced by Gram-positive bacteria to inhibit the growth of closely related strains. They are used as food preservatives e.g. nisin, and some are in clinical trials, e.g. duramycin A and microbisporicin. Cinnamycin is a 19 amino acid lantibiotic that inhibits the growth of Gram-positive rods. Recent work suggests that cyanobacteria might be able to make variants of cinnamycin. Here I determined the product of a cinnamycin biosynthetic pathway prese...

  20. Bacterial control of cyanobacteria

    CSIR Research Space (South Africa)

    Ndlela, Luyanda L

    2017-08-01

    Full Text Available of biological control appears to be direct contact. • Ndlela, L. L. et al. (2016) ‘An overview of cyanobacterial bloom occurrences and research in Africa over the last decade’, Harmful Algae, 60 • Gumbo, J.R. et al. (2010) The Isolation and identification... of Predatory Bacteria from a Microcystis algal Bloom.. African Journal of Biotechnology, 9. *Special acknowledgement goes to the National Research foundation for funding this presentation Bacterial control of cyanobacteria Luyanda...

  1. Antifungal compounds from cyanobacteria.

    Science.gov (United States)

    Shishido, Tânia K; Humisto, Anu; Jokela, Jouni; Liu, Liwei; Wahlsten, Matti; Tamrakar, Anisha; Fewer, David P; Permi, Perttu; Andreote, Ana P D; Fiore, Marli F; Sivonen, Kaarina

    2015-04-13

    Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  2. Antifungal Compounds from Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Tânia K. Shishido

    2015-04-01

    Full Text Available Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  3. Performance of the mixed LED light quality on the growth and energy efficiency of Arthrospira platensis.

    Science.gov (United States)

    Mao, Ruixin; Guo, Shuangsheng

    2018-06-01

    The effect of mixed light quality with red, blue, and green LED lamps on the growth of Arthrospira platensis was studied, so as to lay the theoretical and technical basis for establishing a photo-bioreactor lighting system for application in space. Meanwhile, indexes, like morphology, growth rate, photosynthetic pigment compositions, energy efficiency, and main nutritional components, were measured respectively. The results showed that the blue light combined with red light could decrease the tightness of filament, and the effect of green light was opposite. The combination of blue light or green light with red light induced the filaments to get shorter in length. The 8R2B treatment could promote the growth of Arthrospira platensis significantly, and its dry weight reached 1.36 g L -1 , which was 25.93% higher than the control. What's more, 8R2B treatment had the highest contents of carbohydrate and lipid, while 8R2G was rich in protein. 8R0.5G1.5B had the highest efficiency of biomass production, which was 161.53 mg L -1  kW -1  h -1 . Therefore, the combination of red and blue light is more conducive to the growth of Arthrospira platensis, and a higher biomass production and energy utilization efficiency can be achieved simultaneously under the mixed light quality with the ratio of 8R0.5G1.5B.

  4. Proteome-wide analysis and diel proteomic profiling of the cyanobacterium Arthrospira platensis PCC 8005.

    Directory of Open Access Journals (Sweden)

    Sabine Matallana-Surget

    Full Text Available The filamentous cyanobacterium Arthrospira platensis has a long history of use as a food supply and it has been used by the European Space Agency in the MELiSSA project, an artificial microecosystem which supports life during long-term manned space missions. This study assesses progress in the field of cyanobacterial shotgun proteomics and light/dark diurnal cycles by focusing on Arthrospira platensis. Several fractionation workflows including gel-free and gel-based protein/peptide fractionation procedures were used and combined with LC-MS/MS analysis, enabling the overall identification of 1306 proteins, which represents 21% coverage of the theoretical proteome. A total of 30 proteins were found to be significantly differentially regulated under light/dark growth transition. Interestingly, most of the proteins showing differential abundance were related to photosynthesis, the Calvin cycle and translation processes. A novel aspect and major achievement of this work is the successful improvement of the cyanobacterial proteome coverage using a 3D LC-MS/MS approach, based on an immobilized metal affinity chromatography, a suitable tool that enabled us to eliminate the most abundant protein, the allophycocyanin. We also demonstrated that cell growth follows a light/dark cycle in A. platensis. This preliminary proteomic study has highlighted new characteristics of the Arthrospira platensis proteome in terms of diurnal regulation.

  5. One Health and Toxic Cyanobacteria

    Science.gov (United States)

    One Health and toxic cyanobacteria Blooms of toxic freshwater blue-green algae or cyanobacteria (HABs) have been in the news after HABs associated with human and animal health problems have been reported in Florida, California and Utah during 2016. HABs occur in warm, slow moving...

  6. Adsorption of procion red and congo red dyes using microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Risfidian Mohadi

    2017-10-01

    Full Text Available Adsorption of procion red and congo red dyes using microalgae Spirulina sp was conducted. Spirulina sp was obtained by cultivation and production in laboratory scale. Spirulina sp was used as adsorbent for adsorption of dyes. Adsorption process was studied by kinetic and thermodynamic in order to know the adsorption phenomena. The results showed that kinetically congo red is reactive than procion red on Spirulina sp. On the other hand, thermodynamically procion red was stable than congo red on Spirulina sp which was indicated by adsorption capacity, enthalpy, and entropy.

  7. Anaerobic digestion of wastewater generated from the hydrothermal liquefaction of Spirulina: Toxicity assessment and minimization

    International Nuclear Information System (INIS)

    Zheng, Mingxia; Schideman, Lance C.; Tommaso, Giovana; Chen, Wan-Ting; Zhou, Yan; Nair, Ken; Qian, Wanyi; Zhang, Yuanhui; Wang, Kaijun

    2017-01-01

    Highlights: • Nutrient reuse and energy recovery of HTL-WW are realized. • Anaerobic digestion of HTL-WW is vital to the sustainability of algal biocrude. • An anaerobic toxicity assay was conducted to evaluate HTL-WW toxicity. • The presence of adsorbents and biofilms effectively minimized inhibition. • A portion of the toxic compounds could be removed after anaerobic digestion. - Abstract: Previous studies demonstrate anaerobic digestion of hydrothermal liquefaction wastewater (HTL-WW) is significant to the sustainability of algal biofuel development for nutrient reuse and residual energy recovery. HTL-WW contains substantial amounts of residual energy but is toxic to anaerobes. With 6% HTL-WW converted from cyanobacteria (e.g. Spirulina), anaerobes were 50% inhibited. In this study, zeolite, granular activated carbon (GAC), and polyurethane matrices (PM) were used during a two-round anaerobic batch test with HTL-WW, and in the presence of each material, the total methane yields were 136 mL/g COD, 169 mL/g COD, and 168 mL/g COD, respectively, being 11%, 37% and 36% higher than the control. GAC was considered promising due to its highest methane yield of 124 mL/g COD at the second feeding, indicating a good recovery of adsorption capacity. The observed low methane production rates indicated the necessity for anaerobic process optimization. The physicochemical analysis of the digestates demonstrated that most of the compounds identified in the HTL-WW were degraded.

  8. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    Directory of Open Access Journals (Sweden)

    Liliana CEPOI

    2009-11-01

    Full Text Available The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC, radical-scavenging activity by DPPH method (DPPH, antioxidant activity by the ABTS+ radical cation assay (ABTS, Folin-Ciocalteu reducing capacity (FCRC. We showed the presence of antioxidative substances in ethanol extractions from 2 species of cyanobacteria, and possibility to increase their activity varying ethanol concentration. It facilitates the extraction both water- and lipid-soluble components from biomass. Regarding used methods for antioxidative activity determination, we have used only those based on reaction of electrons return (which widely used nowadays in vitro. Obtained in different ways results demonstrate high reduction capacity of the extracts and possibility to select suitable analytical methods for each case.

  9. Protocol optimization for enhanced production of pigments in Spirulina.

    Science.gov (United States)

    Kumar, Devendra; Kumar, Neeraj; Pabbi, Sunil; Walia, Suresh; Dhar, Dolly Wattal

    2013-01-01

    Spirulina has attracted special attention due to its importance as human foodstuff and natural colours with specific functional properties. These functional properties have been attributed to phycobilins, carotenoids, phenolics and unsaturated fatty acids. Present study was conducted under controlled phytotron conditions to identify the efficient strains of Spirulina in terms of pigment synthesis and to optimize their enhanced production. Methodology for enhanced production was standardized by varying specific environmental parameters (light intensity, temperature, carbon dioxide concentration, pH and NaCl level). Different strains of Spirulina depicted variability and environmental parameters showed distinct influence on pigments. Growth and pigment production was recorded to be most efficient under optimized conditions of light intensity (70 μmol m -2  s -1 ), temperature (30 °C), CO 2 concentration (550 ppm and 750 ppm), pH (10.5) and NaCl level (2 g L -1 ).

  10. Extraction and In Vitro Antimalarial Activity Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Diah Anggraini

    2016-04-01

    Full Text Available Phycocyanin is biopigment found only in a conductor such as Spirulina platensis. Phycocyanin from Nostoc can inhibit Plasmodium falciparum with IC50 8.4 μg/mL so that phycocyanin from S. platensis also can inhibit P. falciparum like Nostoc. The aim of this study was to determine the best method for phycocyanin extraction using three solvents. They were phosphate buffer, water, and aseton. Spirulina were cultured in the conditions intensity of light 3000 Lux, salinity 15 ppt, dark-light 8-16 hours. The response parameters of this study were C-phycocyanin (C-PC content, yield, and protein content. Yield biomass of Spirulina which cultivated using toplest was higher than the aquarium. The best solvent for phycocyanin extraction was a phosphate buffer with C-PC content, yield, and protein content 8 mg/mL, 202.26 mg/g, and 1.88%.

  11. Origin of marine planktonic cyanobacteria.

    Science.gov (United States)

    Sánchez-Baracaldo, Patricia

    2015-12-01

    Marine planktonic cyanobacteria contributed to the widespread oxygenation of the oceans towards the end of the Pre-Cambrian and their evolutionary origin represents a key transition in the geochemical evolution of the Earth surface. Little is known, however, about the evolutionary events that led to the appearance of marine planktonic cyanobacteria. I present here phylogenomic (135 proteins and two ribosomal RNAs), Bayesian relaxed molecular clock (18 proteins, SSU and LSU) and Bayesian stochastic character mapping analyses from 131 cyanobacteria genomes with the aim to unravel key evolutionary steps involved in the origin of marine planktonic cyanobacteria. While filamentous cell types evolved early on at around 2,600-2,300 Mya and likely dominated microbial mats in benthic environments for most of the Proterozoic (2,500-542 Mya), marine planktonic cyanobacteria evolved towards the end of the Proterozoic and early Phanerozoic. Crown groups of modern terrestrial and/or benthic coastal cyanobacteria appeared during the late Paleoproterozoic to early Mesoproterozoic. Decrease in cell diameter and loss of filamentous forms contributed to the evolution of unicellular planktonic lineages during the middle of the Mesoproterozoic (1,600-1,000 Mya) in freshwater environments. This study shows that marine planktonic cyanobacteria evolved from benthic marine and some diverged from freshwater ancestors during the Neoproterozoic (1,000-542 Mya).

  12. Oleic acid biosynthesis in cyanobacteria

    International Nuclear Information System (INIS)

    VanDusen, W.J.; Jaworski, J.G.

    1986-01-01

    The biosynthesis of fatty acids in cyanobacteria is very similar to the well characterized system found in green plants. However, the initial desaturation of stearic acid in cyanobacteria appears to represent a significant departure from plant systems in which stearoyl-ACP is the exclusive substrate for desaturation. In Anabaena variabilis, the substrate appears to be monoglucosyldiacylglycerol, a lipid not found in plants. The authors examined five different cyanobacteria to determine if the pathway in A. variabilis was generally present in other cyanobacteria. The cyanobacteria studied were A. variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis marina, and Anacystis nidulans. Each were grown in liquid culture, harvested, and examined for stearoyl-ACP desaturase activity or incubated with 14 CO 2 . None of the cyanobacteria contained any stearoyl-ACP desaturase activity in whole homogenates or 105,000g supernatants. All were capable of incorporating 14 CO 2 into monoglucosyldiacylglycerol and results from incubations of 20 min, 1 hr, 1 hr + 10 hr chase were consistent with monoglucosyldiacylglycerol serving as precursor for monogalctosyldiacylglycerol. Thus, initial evidence is consistent with oleic acid biosynthesis occurring by desaturation of stearoyl-monoglucosyldiacylglycerol in all cyanobacteria

  13. Measuring System for Growth Control of the Spirulina Aquaculture

    Science.gov (United States)

    Ponce S., Claudio; Ponce L., Ernesto; Bernardo S., Barraza

    2008-11-01

    It describes the workings of a data-logging instrument that measures growth levels of the Spirulina aquaculture. The Spirulina is a very delicate algae and its culture may be suddenly lost due to overgrowth. This kind of instrument is not at present available in the market. The transduction is a submergible laser device whose measuring margin of error is near to 0.28%. The advantage of this new instrument is the improvement in the measurement and the low cost. The future application of this work is related to the industrial production of food and fuel from micro algae culture, for the growing world population.

  14. Consumption of an aqueous cyanophyta extract derived from Arthrospira platensis is associated with reduction of chronic pain: results from two human clinical pilot studies

    Directory of Open Access Journals (Sweden)

    Jensen GS

    2016-05-01

    Full Text Available Gitte S Jensen,1 Victoria L Attridge,1 Steve G Carter,1 Jesse Guthrie,2 Axel Ehmann,2 Kathleen F Benson1 1NIS Labs, 2Cerule LLC, Klamath Falls, OR, USA Objectives: The aim of this study was to evaluate the effects of consumption of an aqueous cyanophyta extract (ACE from Arthrospira platensis on chronic pain in humans, in two clinical pilot studies. Design and interventions: The two pilot studies each involved 12 subjects experiencing chronic pain. The initial study followed an open-label 4-week study design involving consumption of 1 g ACE per day. A subsequent placebo-controlled, single-blind, crossover study involved consumption of 500 mg ACE, 250 mg ACE, or 0 mg ACE (placebo per day for 1-week duration, separated by 1-week washout period. Subjects: Adult subjects of both sexes, with chronic joint-related pain for at least 6 months prior to enrollment, were recruited after obtaining written informed consent. Outcome measures: Visual analog scales were used to score pain at rest and during physical activity for each person's primary and secondary areas of chronic pain. An activities of daily living questionnaire was used to collect data on physical functioning. Results: The data showed rapid reduction of chronic pain in people consuming ACE, where the reduction in pain scores for each person's primary pain area reached a high level of statistical significance after 2 weeks of consumption (P<0.01, both when at rest and when being physically active. Secondary pain areas when physically active showed highly significant improvements within 1 week of consumption of 1 g/d (P<0.001 and borderline significant improvements within 1 week of consuming 500 mg/d (P<0.065 and 250 mg/d (P<0.05. This was accompanied by an increased ability to perform daily activities (P<0.05. A small but significant weight loss was observed during the 4-week study, as the average body mass index dropped from 31.4 to 29.4 (P<0.01. Conclusion: Consumption of ACE was associated

  15. Hydrogen production by Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Chaudhuri Surabhi

    2005-12-01

    Full Text Available Abstract The limited fossil fuel prompts the prospecting of various unconventional energy sources to take over the traditional fossil fuel energy source. In this respect the use of hydrogen gas is an attractive alternate source. Attributed by its numerous advantages including those of environmentally clean, efficiency and renew ability, hydrogen gas is considered to be one of the most desired alternate. Cyanobacteria are highly promising microorganism for hydrogen production. In comparison to the traditional ways of hydrogen production (chemical, photoelectrical, Cyanobacterial hydrogen production is commercially viable. This review highlights the basic biology of cynobacterial hydrogen production, strains involved, large-scale hydrogen production and its future prospects. While integrating the existing knowledge and technology, much future improvement and progress is to be done before hydrogen is accepted as a commercial primary energy source.

  16. The biomechanical role of overall-shape transformation in a primitive multicellular organism: A case study of dimorphism in the filamentous cyanobacterium Arthrospira platensis.

    Science.gov (United States)

    Chaiyasitdhi, Atitheb; Miphonpanyatawichok, Wirat; Riehle, Mathis Oliver; Phatthanakun, Rungrueang; Surareungchai, Werasak; Kundhikanjana, Worasom; Kuntanawat, Panwong

    2018-01-01

    Morphological transformations in primitive organisms have long been observed; however, its biomechanical roles are largely unexplored. In this study, we investigate the structural advantages of dimorphism in Arthrospira platensis, a filamentous multicellular cyanobacterium. We report that helical trichomes, the default shape, have a higher persistence length (Lp), indicating a higher resistance to bending or a large value of flexural rigidity (kf), the product of the local cell stiffness (E) and the moment of inertia of the trichomes' cross-section (I). Through Atomic Force Microscopy (AFM), we determined that the E of straight and helical trichomes were the same. In contrast, our computational model shows that I is greatly dependent on helical radii, implying that trichome morphology is the major contributor to kf variation. According to our estimation, increasing the helical radii alone can increase kf by 2 orders of magnitude. We also observe that straight trichomes have improved gliding ability, due to its structure and lower kf. Our study shows that dimorphism provides mechanical adjustability to the organism and may allow it to thrive in different environmental conditions. The higher kf provides helical trichomes a better nutrient uptake through advection in aquatic environments. On the other hand, the lower kf improves the gliding ability of straight trichomes in aquatic environments, enabling it to chemotactically relocate to more favorable territories when it encounters certain environmental stresses. When more optimal conditions are encountered, straight trichomes can revert to their original helical form. Our study is one of the first to highlight the biomechanical role of an overall-shape transformation in cyanobacteria.

  17. Monitoring Cyanobacteria with Satellites Webinar

    Science.gov (United States)

    real-world satellite applications can quantify cyanobacterial harmful algal blooms and related water quality parameters. Provisional satellite derived cyanobacteria data and different software tools are available to state environmental and health agencies.

  18. Studying the Effect of Ionization Radiation of 60Co on the Spirulina

    Science.gov (United States)

    Ai, Weidang; Guo, Shuang-Sheng; Ai, Weidang; Dong, Wen-Ping; Qin, Li-Feng; Tang, Yong-Kang

    It studied the effect of ionization radiation on the Spirulina plastensis(No.6) by using the γ-rays of 60 Co. In the experiment, Spirulina were irradiated, and the dose of the ionization radiation covered 0, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0kGy. After irradiating, these Spirulina were cultured under the same conditions. During the course of the experiment, the growth rate, photosynthetic efficiency and nutrition quality of the Spirulina, were analyzed. From the results, low dose of γ-rays (less than 1.5kGy) could improve the content of phycobilin and protein of Spirulina. Only small changes in the morphology of algae filament were found at dose less than 1.0kGy. But with the increase of the dose of γ-rays (more than 1.5kGy), the filaments would break up or even disintegrate. Spirulina had stronger ionization radiation proof and self-rehabilitation capacity, but the growth of Spirulina was stagnated. The LD50 (i.e. the dose resulted in 50% death of the Spirulina) of the colony was 2.0kGy. Considering the capacity of being resistant to γ-rays irradiation, Spirulina can be considered as one of the key biological components in the Controlled Ecological Life Support System (CELSS) for future long-term space missions. Keywords: Controlled Ecological Life Support System (CELSS); Spirulina; ionization radiation; biological component

  19. Culture of microalgae Spirulina platensis with isotope stable Carbon-13; Cultivo da microalga Spirulina platensis com isótopo estável Carbono-13

    Energy Technology Data Exchange (ETDEWEB)

    Cronemberger, Luiz C.A.; Costa, Vladimir E., E-mail: luiz_cnst@hotmail.com, E-mail: vladimir@ibb.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (CIE/UNESP), Botucatu, SP (Brazil). Centro de Isótopos Estáveis Prof. Dr. Carlos Ducatti

    2017-07-01

    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical {sup 99m}Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ({sup 13}C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of {sup 13}C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure {sup 13}C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard.

  20. Determination of Volatile Organic Compounds in Selected Strains of Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Ivan Milovanović

    2015-01-01

    Full Text Available Microalgal biomass can be used in creating various functional food and feed products, but certain species of microalgae and cyanobacteria are known to produce various compounds causing off-flavour. In this work, we investigated selected cyanobacterial strains of Spirulina, Anabaena, and Nostoc genera originating from Serbia, with the aim of determining the chemical profile of volatile organic compounds produced by these organisms. Additionally, the influence of nitrogen level during growth on the production of volatile compounds was investigated for Nostoc and Anabaena strains. In addition, multivariate techniques, namely, principal component analysis (PCA and hierarchical cluster analysis (HCA, were used for making distinction among different microalgal strains. The results show that the main volatile compounds in these species are medium chain length alkanes, but other odorous compounds such as 2-methylisoborneol (0.51–4.48%, 2-pentylfuran (0.72–8.98%, β-cyclocitral (0.00–1.17%, and β-ionone (1.15–2.72% were also detected in the samples. Addition of nitrogen to growth medium was shown to negatively affect the production of 2-methylisoborneol, while geosmin was not detected in any of the analyzed samples, which indicates that the manipulation of growth conditions may be useful in reducing levels of some unwanted odor-causing components.

  1. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria

    African Journals Online (AJOL)

    pc

    2015-05-13

    May 13, 2015 ... Key words: Spirulina platensis, nutritional, quality, proteins, fatty acids. ... advantages make S. platensis a good raw material for the healthy food (Anitha and ... The fat content is determined by the Soxhlet extraction method by using .... human milk and some expensive vegetable oils according to Pierlovisi ...

  2. Total lipid accumulation and fatty acid profiles of microalga Spirulina ...

    African Journals Online (AJOL)

    Nutrient limitation in terms of nitrogen and phosphorus increased lipid accumulation under depleted growth in Spirulina strains. Nitrogen limitation was found more effective than phosphorus in accumulating lipid. The fatty acid profile was variable: palmitic (48%), linolenic (21%) and linoleic acids (15%) were the most ...

  3. The radioactivity of spirulina and its heavy elements

    International Nuclear Information System (INIS)

    Fantariandraintsoa, A.A.

    2014-01-01

    Spirulina is one of the three classes of algae that have the ability to accumulate contaminants from the environment in which they live. The main aim of this work is to study the radioactive contamination of Spirulina using gamma spectrometry and to determine its content of heavy elements using the technique of X-ray fluorescence analysis. Use of detector and Gamma Vision software, in the laboratory of nuclear analysis of the I nstitut National des Sciences et Techniques Nucleaires -Madagascar (INSTN-Madagascar), allowed us to find some amount of radioactive elements such as potassium, lead, thallium and bismuth. The elements found in the laboratory of X-ray fluorescence analysis, of the same institute, using the conventional method along with the XRF AXIL software are calcium, iron, magnesium, bromine, rubidium and strontium as well as heavy elements zinc and copper. Spirulina is rich in potassium, its activity is 98±56 Bq.Kg -1 and the average concentration of the radioactive element is 16.2 g.Kg -1 . Analysis results leads us to say that it is best to consume spirulina from well secured against pollution (greenhouse) culture and we can say that we need to improve crops in natural environments. [fr

  4. Effect of Spirulina platensis powder on metabolic syndrome in ...

    African Journals Online (AJOL)

    S. platensis inhibits also hemolysis of erythrocytes induced by AAPH. In conclusion, S. platensis powder prevent metabolic syndrome induced by high fructose and fat diet. These results justify the use of the plant in the treatment of diabetes in Benin. Keywords: Spirulina platensis, metabolic syndrome, fructose, diabetes, ...

  5. Characterization of phycocyanin from Spirulina fusiformis and its thermal stability

    Science.gov (United States)

    Munawaroh, H. S. H.; Darojatun, K.; Gumilar, G. G.; Aisyah, S.; Wulandari, A. P.

    2018-05-01

    Microalgae have some pigments which are potential to be used as functional colorant for foods and cosmetics industries. Here, Spirulina fusiformis is one of the major sources of a blue pigment phycocyanin which has commercial and biotechnological value for biomedical research, as well as a natural colorant for food and cosmetic industries. This study aims at investigating the characteristic of isolated C-phycocyanin from Spirulina fusiformis and its stability under different temperature. A food grade phycocyanin with purity of 2.0 (A620/A280) was obtained successfully from Spirulina fusiformis cultured in seawater-based modified medium and purified by ammonium sulfate precipitation. No significant changes were observed in the spectrum absorbance of C-phycocyanin at temperature up to 60°C over 30 minutes of incubation, and was observed to significantly denaturation at 70°C and higher temperature. Incubation of the pigment at relatively high temperature resulted in a decrease in the spectrum intensities of the C-phycocyanin in a temperature-dependent manner. Taken together, our results suggest that the optimal condition for preserving the stability of food grade phycocyanin isolated from Spirulina fusiformis is taking it at low temperature.

  6. Effect of feeding duration of Spirulina platensis on growth ...

    African Journals Online (AJOL)

    Spirulina platensis is a good candidate as an in-feed antibiotics substitute for broilers. However, its use seems impractical owing to its high price, especially when being administered throughout the whole rearing period. This study aimed to investigate the effects of feeding duration of S. platensis on growth, haematological ...

  7. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria ...

    African Journals Online (AJOL)

    Spirulina platensis, a blue green microalga, has been used since ancient times as a source of food because of its high protein content (65%) and nutritional value. Lipids isolated from S. platensis have been shown to contain high levels of polyunsaturated fatty acids, including linolenic acid which is a precursor of ...

  8. CO2 partial pressure - pH relationships in the memdium and relevance to CO2 mass balance in outdoor open thin-layer Arthrospira (Spirulina) cultures

    Czech Academy of Sciences Publication Activity Database

    Lívanský, Karel; Doucha, Jiří; Hu, H.; Li, Y.

    2006-01-01

    Roč. 165, č. 3 (2006), s. 365-381 ISSN 0003-9136 R&D Projects: GA MŠk ME 637 Institutional research plan: CEZ:AV0Z50200510 Keywords : medium * carbon dioxide * equilibrium Subject RIV: EE - Microbiology, Virology Impact factor: 1.362, year: 2006

  9. Circadian Rhythms in Cyanobacteria

    Science.gov (United States)

    Golden, Susan S.

    2015-01-01

    SUMMARY Life on earth is subject to daily and predictable fluctuations in light intensity, temperature, and humidity created by rotation of the earth. Circadian rhythms, generated by a circadian clock, control temporal programs of cellular physiology to facilitate adaptation to daily environmental changes. Circadian rhythms are nearly ubiquitous and are found in both prokaryotic and eukaryotic organisms. Here we introduce the molecular mechanism of the circadian clock in the model cyanobacterium Synechococcus elongatus PCC 7942. We review the current understanding of the cyanobacterial clock, emphasizing recent work that has generated a more comprehensive understanding of how the circadian oscillator becomes synchronized with the external environment and how information from the oscillator is transmitted to generate rhythms of biological activity. These results have changed how we think about the clock, shifting away from a linear model to one in which the clock is viewed as an interactive network of multifunctional components that are integrated into the context of the cell in order to pace and reset the oscillator. We conclude with a discussion of how this basic timekeeping mechanism differs in other cyanobacterial species and how information gleaned from work in cyanobacteria can be translated to understanding rhythmic phenomena in other prokaryotic systems. PMID:26335718

  10. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets

    OpenAIRE

    Birot, Raphaëlle; Jouvencel, Diane de; Raginel, Laetitia; Rouillé, Geneviève

    2012-01-01

    Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced...

  11. Culture Conditions stimulating high γ-Linolenic Acid accumulation by Spirulina platensis Condições de cultura simulando o levado acúmulo de ácido γ-linolênico por Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Srinivasa Reddy Ronda

    2008-12-01

    Full Text Available Gamma-linolenic acid (GLA production by Spirulina platensis under different stress-inducing conditions was studied. Submerged culture studies showed that low temperature (25ºC, strong light intensity (6 klux and primrose oil supplement (0.8%w/v induced 13.2 mg/g, 14.6 mg/g and 13.5 mg linolenic acid per gram dry cell weight respectively. A careful observation of fatty acid profile of the cyanobacteria shows that, oleic acid and linoleic acid, in experiments with varying growth temperature and oil supplements respectively, helped in accumulating excess γ-linolenic acid. In addition, cultures grown at increasing light regimes maintained the γ-linolenic acid to the total fatty acid ratio(GLA/TFA constant, despite any change in γ-linolenic acid content of the cyanobacteria.Estudou-se a produção de ácido γ-linolênico por Spirulina platensis em diferentes condições de estresse. Culturas submersas indicaram que temperatura baixa (25ºC, forte intensidade de luz (6 klux e suplementação com óleo de prímula (0,8% p/v induziram a produção de ácido linolênico de 13,2 mg/g, 14,6 mg/g e 13,5 mg/g peso seco, respectivamente. Uma observação cuidadosa do perfil de ácidos graxos da cianobacteria indica que os ácidos oléico e linoléico, em experimentos com diferentes temperaturas de crescimento e suplementos de óleo, auxiliaram no acúmulo de excesso de ácido γ-linolênico. Além disso, as culturas obtidas em intensidades crescentes de luz mantiveram a relação ácido γ-linolênico/ácidos graxos totais constante, independentemente de qualquer mudança no conteúdo de ácido γ-linolênico da cianobactéria.

  12. CYANOBACTERIA OF THE GENUS PROCHLOROTHRIX

    Directory of Open Access Journals (Sweden)

    Alexander Vasilievich Pinevich

    2012-05-01

    Full Text Available Green cyanobacteria are distinguished from blue-green ones by the possession of a chlorophyll-containing light harvesting antenna. Three genera of green cyanobacteria, namely Acaryochloris, Prochlorococcus and Prochloron, are unicellular and of marine habitat; Prochlorococcus marinus attracts most attention due to its outstanding role in prime productivity. The fourth genus, Prochlorothrix, is represented by filamentous freshwater strains. Unlike the rest of green cyanobacteria, Prochlorothrix is paradoxically rare: it has been isolated from two European locations only. Taking into account fluctuating blooms, morphological resemblance with Planktothrix and Pseudanabaena, and unsuccessful enrichment of Prochlorothrix, the preferred strategy of search for this cyanobacterium is based on PCR with natural DNA and specific primers. This approach already demonstrates a broader distribution of Prochlorothrix: marker genes have been found in at least two additional locations. Despite the growing evidence for naturally occurring Prochlorothrix, there are only a few cultivated strains, and only one of them (PCC 9006 is claimed to be axenic. In multixenic cultures, Prochlorothrix is accompanied by heterotrophic bacteria, indicating a consortium-type association. The genus Prochlorothrix includes two species: P. hollandica and P. scandica based on distinctions in genomic DNA, cell size, temperature optimum, and fatty acid composition of membrane lipids. In this short review, the properties of cyanobacteria of the genus Prochlorothrix are described, and the evolutionary scenario of green cyanobacteria, especially taking into account their role in the origin of simple chloroplast is given.

  13. Secondary metabolites of cyanobacteria Nostoc sp.

    Science.gov (United States)

    Kobayashi, Akio; Kajiyama, Shin-Ichiro

    1998-03-01

    Cyanobacteria attracted much attention recently because of their secondary metabolites with potent biological activities and unusual structures. This paper reviews some recent studies on the isolation, structural, elucidation and biological activities of the bioactive compounds from cyanobacteria Nostoc species.

  14. Grazing livestock are exposed to terrestrial cyanobacteria

    OpenAIRE

    McGorum , Bruce C; Pirie , R Scott; Glendinning , Laura; McLachlan , Gerry; Metcalf , James S; Banack , Sandra A; Cox , Paul A; Codd , Geoffrey A

    2015-01-01

    While toxins from aquatic cyanobacteria are a well-recognised cause of disease in birds and animals, exposure of grazing livestock to terrestrial cyanobacteria has not been described. This study identified terrestrial cyanobacteria, predominantly Phormidium spp., in the biofilm of plants from most livestock fields investigated. Lower numbers of other cyanobacteria, microalgae and fungi were present on many plants. Cyanobacterial 16S rDNA, predominantly from Phormidium spp., was detected in al...

  15. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals

    OpenAIRE

    Radhakrishnan Ammu; Lim Yen-Wei; Chu Wan-Loy; Lim Phaik-Eem

    2010-01-01

    Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protectiv...

  16. Experimental grounds for developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Frontas'eva, M.V.; Pavlov, S.S.; Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.

    2002-01-01

    The possibility of using blue-green algae Spirulina platensis as a matrix for production of the selenium- and iodine-containing pharmaceuticals was studied. The dependence of Se and I accumulation in Spirulina biomass during the cultivation in a nutrient medium loading of above elements was determined more precisely. The dynamics of Spirulina biomass growth was observed with nutrient medium loading of selenium. It is found that Spirulina platensis biomass quality may be used for pharmaceutical purposes

  17. Composition and functional property of photosynthetic pigments under circadian rhythm in the cyanobacterium Spirulina platensis.

    Science.gov (United States)

    Kumar, Deepak; Kannaujiya, Vinod K; Richa; Pathak, Jainendra; Sundaram, Shanthy; Sinha, Rajeshwar P

    2018-05-01

    Circadian rhythm is an important endogenous biological signal for sustainable growth and development of cyanobacteria in natural ecosystems. Circadian effects of photosynthetically active radiation (PAR), ultraviolet-A (UV-A) and ultraviolet-B (UV-B) radiations on pigment composition have been studied in the cyanobacterium Spirulina platensis under light (L)/dark (D) oscillation with a combination of 4/20, 8/16, 12/12, 16/8, 20/4 and 24/24 h time duration. Circadian exposure of PAR + UV-A (PA) and PAR + UV-A + UV-B (PAB) showed more than twofold decline in Chl a, total protein and phycocyanin (PC) in light phase and significant recovery was achieved in dark phase. The fluorescence emission wavelength of PC was shifted towards lower wavelengths in the light phase of PAB in comparison to P and PA whereas the same wavelength was retrieved in the dark phase. The production of free radicals was accelerated twofold in the light phase (24 h L) whereas the same was retrieved to the level of control during the dark phase. Oxidatively induced damage was alleviated by antioxidative enzymes such as catalase (CAT), peroxidase (POD), superoxide dismutase (SOD) and ascorbate peroxidase (APX) in the light phase (0-24-h L) whereas the dark phase showed significant inhibition of the same enzymes. Similar characteristic inhibition of free radicals and recovery of PC was observed inside cellular filament after circadian rhythm of 24/24 h (L/D). Circadian exposure of P, PA and PAB significantly altered the synthesis and recovery of pigments that could be crucial for optimization and sustainable production of photosynthetic products for human welfare.

  18. Direct catalytic hydrothermal liquefaction of spirulina to biofuels with hydrogen

    Science.gov (United States)

    Zeng, Qin; Liao, Hansheng; Zhou, Shiqin; Li, Qiuping; Wang, Lu; Yu, Zhihao; Jing, Li

    2018-01-01

    We report herein on acquiring biofuels from direct catalytic hydrothermal liquefaction of spirulina. The component of bio-oil from direct catalytic hydrothermal liquefaction was similar to that from two independent processes (including liquefaction and upgrading of biocrude). However, one step process has higher carbon recovery, due to the less loss of carbons. It was demonstrated that the yield and HHV of bio-oil from direct catalytic algae with hydrothermal condition is higher than that from two independent processes.

  19. Production of Spirulina platensis by adding sodium bicarbonate and ...

    African Journals Online (AJOL)

    In this study, dry chicken manure (DCM) was used as the source of nitrogen in the production of Spirulina platensis. Experiment was conducted in two different types of nutrition. In the type I nutrition, the highest average cell increase was recorded as 289.70 filaments mL-1 in value in the type I group (DCM+urea). In the type ...

  20. Producción de pigmentos procedentes de Arthrospira maxima cultivada en fotobiorreactores

    Directory of Open Access Journals (Sweden)

    Lolymar de los Ángeles Romero Maza

    2017-01-01

    Full Text Available El cultivo de cianobacterias, como Arthrospira, puede realizarse en sistemas abiertos y sistemas cerrados o fotobiorreactores. El objetivo de la presente investigación fue evaluar la producción de pigmentos de Arthrospira maxima cultivada en dos tipos de fotobiorreactores. El cultivo se realizó de forma discontinua (Batch bajo ambiente controlado, en fotobiorreactores helicoidales y cilíndricos, durante 30 días, en medio Zarrouk. La determinación de los pigmentos se realizó en las fases de crecimiento exponencial y estacionario. Para los pigmentos liposolubles, la biomasa se sometió a extracción con acetona 90%, y posterior determinación por Cromatografía Líquida de Alta Eficiencia, y para la extracción de los pigmentos ficobiliproteínicos se ensayaron cuatro métodos: 1. regulador de fosfatos/enzimas; 2. solución alcalina, previo tratamiento con CaCl2; 3. buffer de fosfato, previo tratamiento con hielo seco y 4. agua (4ºC, y posterior determinación por Espectrofotometría UV-Visible. Los mayores valores de pigmentos liposolubles fueron obtenidos en los cultivos realizados en fotobiorreactor helicoidal durante la fase exponencial (clorofila a 11,08±0,006 µg mL-1; β-caroteno 1,82±0,003 µg mL-1; zeaxantina 0,72±0,002 µg mL-1; mientras que los mayores contenidos de los pigmentos ficobiliproteínicos se obtuvieron en fotobiorreactor cilíndrico, durante la fase estacionaria, utilizando el buffer de fosfato tratado con hielo seco para la extracción. Dentro de las ficobiliproteínas, fue la ficocianina la que se encontró en mayor proporción (FC = 77,74±0,767 mg L-1, seguido por la aloficocianina y ficoeritrina. Se concluye que la biomasa de Arthrospira maxima presenta potencial biotecnológico por sus altos contenidos de pigmentos.

  1. IRON-TOLERANT CYANOBACTERIA: IMPLICATIONS FOR ASTROBIOLOGY

    Science.gov (United States)

    Brown, Igor I.; Allen, Carlton C.; Mummey, Daniel L.; Sarkisova, Svetlana A.; McKay, David S.

    2006-01-01

    The review is dedicated to the new group of extremophiles - iron tolerant cyanobacteria. The authors have analyzed earlier published articles about the ecology of iron tolerant cyanobacteria and their diversity. It was concluded that contemporary iron depositing hot springs might be considered as relative analogs of Precambrian environment. The authors have concluded that the diversity of iron-tolerant cyanobacteria is understudied. The authors also analyzed published data about the physiological peculiarities of iron tolerant cyanobacteria. They made the conclusion that iron tolerant cyanobacteria may oxidize reduced iron through the photosystem of cyanobacteria. The involvement of both Reaction Centers 1 and 2 is also discussed. The conclusion that iron tolerant protocyanobacteria could be involved in banded iron formations generation is also proposed. The possible mechanism of the transition from an oxygenic photosynthesis to an oxygenic one is also discussed. In the final part of the review the authors consider the possible implications of iron tolerant cyanobacteria for astrobiology.

  2. PENGURANGAN KADAR CO2 MENGGUNAKAN SPIRULINA PLATENSIS DALAM TUBULAR BIOREACTOR

    Directory of Open Access Journals (Sweden)

    Zainal Syam Arifin

    2015-06-01

    Full Text Available Increasing the population impact on increasing energy demand. On the other hand, the energy generation industry has been blamed as one of the contributors of carbon dioxide about 25% of total CO2 emissions worldwide. Meanwhile, the production of biogas, which aims to address the increasing need of energy, produces carbon dioxide in the range of 25–50% by volume. To overcome this, a cheap method, optimum and efficient as well as environmentally friendly in reducing CO2 levels by using Spirulina platensis is needed. This research aims to created a mathematical models and found the optimum flow rate to reduced levels of CO2 by using Spirulina platensis. This study used a glass tubular bioreactor (D = 2.6 cm at a temperature of 30°C and irradiated with a fluorescent lamp Philips TL 36 Watt, color temperature: 6,200K cool daylight, light output: 2,600 lm, 72 lm/W. Tubular reactor was placed in a box lined with silver foil walls on three sides. With mathematical models of tubular reactor, the reaction rate constants could be predicted. Based on calculations of data and graphs, optimum volumetric velocity could also be predicted. Variation of flowrate to observed the reduction rate of CO2 was 0.25 mL/sec, 0.35 mL/sec, 0.5 mL/sec, 0.75 mL/sec, 1 mL/sec. Carbon source was 99.99% CO2.Observations of Spirulina growth was made on the flow rate of 0.25 mL/sec at the initial levels of dry weight 2.1208 g/L. The results of this study indicated that the low flowratewas a more effective way to reduced carbon dioxide levels using Spirulina platensis (= 2.82×10-4 sec-1. The highest conversion was obtained at a volumetric flow rate of 0.25 mL/sec and optimum speeds in the range of 0.3 to 0.4 mL/sec. The rate of incoming CO2 flux should be less than 0.047 mL/cm2.detik. Specific Growth Rate (µ of Spirulina platensis in this study was 2.56×10-2 minute-1.   Keywords: Spirulina platensis, a vertical tubular bioreactor, CO2 reduction     ABSTRAK

  3. Effets des extraits ou de la poudre de Spirulina platensis et Jatropha ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2015 ... générale, les extraits ou la poudre de Spirulina platensis ont eu des ... Mots clés: Biostimulant, croissance, Spirulina platensis, Jatropha curcas, Solanum lycopersicum .... Le test de ..... in antioxidant metabolites, enzymes, and.

  4. Experimental and modelling of Arthrospira platensis cultivation in open raceway ponds.

    Science.gov (United States)

    Ranganathan, Panneerselvam; Amal, J C; Savithri, S; Haridas, Ajith

    2017-10-01

    In this study, the growth of Arthrospira platensis was studied in an open raceway pond. Furthermore, dynamic model for algae growth and CFD modelling of hydrodynamics in open raceway pond were developed. The dynamic behaviour of the algal system was developed by solving mass balance equations of various components, considering light intensity and gas-liquid mass transfer. A CFD modelling of the hydrodynamics of open raceway pond was developed by solving mass and momentum balance equations of the liquid medium. The prediction of algae concentration from the dynamic model was compared with the experimental data. The hydrodynamic behaviour of the open raceway pond was compared with the literature data for model validation. The model predictions match the experimental findings. Furthermore, the hydrodynamic behaviour and residence time distribution in our small raceway pond were predicted. These models can serve as a tool to assess the pond performance criteria. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Propriedades de saúde de Spirulina spp.

    Directory of Open Access Journals (Sweden)

    M. A. Ambrosi

    2009-02-01

    Full Text Available

    Espécies de Spirulina têm sido utilizadas mundialmente na alimentação humana e animal, assim como na obtenção de aditivos utilizados em formas farmacêuticas e alimentos. Esta bactéria é uma fonte rica em proteínas, vitaminas, aminoácidos essenciais, minerais, ácidos graxos poliinsaturados e outros nutrientes, sendo seu principal uso como suplemento alimentar. As propriedades nutricionais de Spirulina spp. têm sido relacionadas com possíveis atividades terapêuticas, caracterizando o microrganismo no âmbito dos alimentos funcionais e nutracêuticos. A ação de Spirulina spp. é comprovada a nível experimental ‘in vivo’ e ‘in vitro’, verificandose sua efetividade na inibição da replicação de alguns vírus, na ação citostática e citotóxica no tratamento de câncer, na diminuição dos lipídios e da glicose no sangue e da pressão sangüínea, na redução de peso em obesos, no aumento da população de microrganismos da flora intestinal, na melhoria da resposta imunológica, na proteção renal contra metais pesados e fármacos, além de apresentar atividade rádio - protetora e de ser eficiente na desnutrição, aumentando a absorção de minerais. Dados da literatura permitem concluir que biomassa de Spirulina spp., além de ser um excelente suplemento alimentar, é uma fonte potencial no tratamento de diversas enfermidades, constituindo uma alternativa eficiente para o desenvolvimento de produtos nutracêuticos. Palavras-chave: Spirulina spp.; nutracêutico; câncer; hiperlipidemia; diabetes; desnutrição.

  6. Supercritical Carbon Dioxide and Microwave-Assisted Extraction of Functional Lipophilic Compounds from Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Diego A. Esquivel-Hernández

    2016-05-01

    Full Text Available Arthrospira platensis biomass was used in order to obtain functional lipophilic compounds through green extraction technologies such as supercritical carbon dioxide fluid extraction (SFE and microwave-assisted extraction (MAE. The temperature (T factor was evaluated for MAE, while for SFE, pressure (P, temperature (T, and co-solvent (ethanol (CS were evaluated. The maximum extraction yield of the obtained oleoresin was (4.07% ± 0.14% and (4.27% ± 0.10% for SFE and MAE, respectively. Extracts were characterized by gas chromatography mass spectrometry (GC-MS and gas chromatography flame ionization detector (GC-FID. The maximum contents of functional lipophilic compounds in the SFE and MAE extracts were: for carotenoids 283 ± 0.10 μg/g and 629 ± 0.13 μg/g, respectively; for tocopherols 5.01 ± 0.05 μg/g and 2.46 ± 0.09 μg/g, respectively; and for fatty acids 34.76 ± 0.08 mg/g and 15.88 ± 0.06 mg/g, respectively. In conclusion, the SFE process at P 450 bar, T 60 °C and CS 53.33% of CO2 produced the highest yield of tocopherols, carotenoids and fatty acids. The MAE process at 400 W and 50 °C gives the best extracts in terms of tocopherols and carotenoids. For yield and fatty acids, the MAE process at 400 W and 70 °C produced the highest values. Both SFE and MAE showed to be suitable green extraction technologies for obtaining functional lipophilic compounds from Arthrospira platensis.

  7. Cyanobacteria in Coral Reef Ecosystems: A Review

    Directory of Open Access Journals (Sweden)

    L. Charpy

    2012-01-01

    Full Text Available Cyanobacteria have dominated marine environments and have been reef builders on Earth for more than three million years (myr. Cyanobacteria still play an essential role in modern coral reef ecosystems by forming a major component of epiphytic, epilithic, and endolithic communities as well as of microbial mats. Cyanobacteria are grazed by reef organisms and also provide nitrogen to the coral reef ecosystems through nitrogen fixation. Recently, new unicellular cyanobacteria that express nitrogenase were found in the open ocean and in coral reef lagoons. Furthermore, cyanobacteria are important in calcification and decalcification. All limestone surfaces have a layer of boring algae in which cyanobacteria often play a dominant role. Cyanobacterial symbioses are abundant in coral reefs; the most common hosts are sponges and ascidians. Cyanobacteria use tactics beyond space occupation to inhibit coral recruitment. Cyanobacteria can also form pathogenic microbial consortia in association with other microbes on living coral tissues, causing coral tissue lysis and death, and considerable declines in coral reefs. In deep lagoons, coccoid cyanobacteria are abundant and are grazed by ciliates, heteroflagellates, and the benthic coral reef community. Cyanobacteria produce metabolites that act as attractants for some species and deterrents for some grazers of the reef communities.

  8. Edible Cyanobacterial Genus Arthrospira: Actual State of the Art in Cultivation Methods, Genetics, and Application in Medicine

    Directory of Open Access Journals (Sweden)

    Magda A. Furmaniak

    2017-12-01

    Full Text Available The cyanobacterial genus Arthrospira appears very conserved and has been divided into five main genetic clusters on the basis of molecular taxonomy markers. Genetic studies of seven Arthrospira strains, including genome sequencing, have enabled a better understanding of those photosynthetic prokaryotes. Even though genetic manipulations have not yet been performed with success, many genomic and proteomic features such as stress adaptation, nitrogen fixation, or biofuel production have been characterized. Many of above-mentioned studies aimed to optimize the cultivation conditions. Factors like the light intensity and quality, the nitrogen source, or different modes of growth (auto-, hetero-, or mixotrophic have been studied in detail. The scaling-up of the biomass production using photobioreactors, either closed or open, was also investigated to increase the production of useful compounds. The richness of nutrients contained in the genus Arthrospira can be used for promising applications in the biomedical domain. Ingredients such as the calcium spirulan, immulina, C-phycocyanin, and γ-linolenic acid (GLA show a strong biological activity. Recently, its use in the fight against cancer cells was documented in many publications. The health-promoting action of “Spirulina” has been demonstrated in the case of cardiovascular diseases and age-related conditions. Some compounds also have potent immunomodulatory properties, promoting the growth of beneficial gut microflora, acting as antimicrobial and antiviral. Products derived from Arthrospira were shown to successfully replace biomaterial scaffolds in regenerative medicine. Supplementation with the cyanobacterium also improves the health of livestock and quality of the products of animal origin. They were also used in cosmetic preparations.

  9. Utilization of the terrestrial cyanobacteria

    Science.gov (United States)

    Katoh, Hiroshi; Tomita-Yokotani, Kaori; Furukawa, Jun; Kimura, Shunta; Yokoshima, Mika; Yamaguchi, Yuji; Takenaka, Hiroyuki

    The terrestrial, N _{2}-fixing cyanobacterium, Nostoc commune has expected to utilize for agriculture, food and terraforming cause of its extracellular polysaccharide, desiccation tolerance and nitrogen fixation. Previously, the first author indicated that desiccation related genes were analyzed and the suggested that the genes were related to nitrogen fixation and metabolisms. In this report, we suggest possibility of agriculture, using the cyanobacterium. Further, we also found radioactive compounds accumulated N. commune (cyanobacterium) in Fukushima, Japan after nuclear accident. Thus, it is investigated to decontaminate radioactive compounds from the surface soil by the cyanobacterium and showed to accumulate radioactive compounds using the cyanobacterium. We will discuss utilization of terrestrial cyanobacteria under closed environment. Keyword: Desiccation, terrestrial cyanobacteria, bioremediation, agriculture

  10. Spatial analysis of freshwater lake cyanobacteria blooms, 2008-2011

    Science.gov (United States)

    Background/Question/Methods Cyanobacteria and associated harmful algal blooms cause significant social, economic, and environmental impacts. Cyanobacteria synthesize hepatotoxins, neurotoxins, and dermatotoxins, affecting the health of humans and other species. The Cyanobacteria ...

  11. Spirulina platensis attenuates the associated neurobehavioral and inflammatory response impairments in rats exposed to lead acetate.

    Science.gov (United States)

    Khalil, Samah R; Khalifa, Hesham A; Abdel-Motal, Sabry M; Mohammed, Hesham H; Elewa, Yaser H A; Mahmoud, Hend Atta

    2018-08-15

    Heavy metals are well known as environmental pollutants with hazardous impacts on human and animal health because of their wide industrial usage. In the present study, the role of Spirulina platensis in reversing the oxidative stress-mediated brain injury elicited by lead acetate exposure was evaluated. In order to accomplish this aim, rats were orally administered with 300 mg/kg bw Spirulina for 15 d, before and simultaneously with an intraperitoneal injection of 50 mg/kg bw lead acetate [6 injections through the two weeks]. As a result, the co-administration of Spirulina with lead acetate reversed the most impaired open field behavioral indices; however, this did not happen for swimming performance, inclined plane, and grip strength tests. In addition, it was observed that Spirulina diminished the lead content that accumulated in both the blood and the brain tissue of the exposed rats, and reduced the elevated levels of oxidative damage indices, and brain proinflammatory markers. Also, because of the Spirulina administration, the levels of the depleted biomarkers of antioxidant status and interleukin-10 in the lead-exposed rats were improved. Moreover, Spirulina protected the brain tissue (cerebrum and cerebellum) against the changes elicited by lead exposure, and also decreased the reactivity of HSP70 and Caspase-3 in both cerebrum and cerebellum tissues. Collectively, our findings demonstrate that Spirulina has a potential use as a food supplement in the regions highly polluted with heavy metals. Copyright © 2018 Elsevier Inc. All rights reserved.

  12. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals

    Directory of Open Access Journals (Sweden)

    Radhakrishnan Ammu

    2010-09-01

    Full Text Available Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. Methods The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3 cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS. The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls. Results Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL. The extract reduced significantly (p Conclusions The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  13. Antimicrobial assay and genetic screening of selected freshwater Cyanobacteria and identification of a biomolecule dihydro-2H-pyran-2-one derivative.

    Science.gov (United States)

    Srivastava, A; Singh, V K; Patnaik, S; Tripathi, J; Singh, P; Nath, G; Asthana, R K

    2017-04-01

    Explorations of freshwater Cyanobacteria as antimicrobial (bacteria, fungi and methicillin-resistant Staphylococcus aureus (MRSA) strains) drug resource using bioassay, NRPS (non-ribosomal polypeptide synthetase) and PKS (polyketide synthase) genes, as well as in silico approach. We have bioassayed the extracts of Phormidium CCC727, Geitlerinema CCC728, Arthrospira CCC729, Leptolyngbya CCC732, Phormidium CCC730, Phormidium CCC731 against six pathogenic bacteria comprising Gram (+ve): S. aureus including seven clinical MRSA and Enterococcus faecalis, Gram (-ve): Escherichia coli, Salmonella Typhimurium, Klebsiella pneumoniae and Shigella boydii along with non-pathogenic Enterobacter aerogenes as well as fungal strains (Cryptococcus neoformans and Candida albicans, C. krusei, C. tropicalis and Aspergillus niger) exhibiting antimicrobial potential. The NRPS and PKS genes of the target strains were also amplified and sequenced. The putative protein structures were predicted using bioinformatics approach. PKS gene expression indicated β keto-acyl synthase as one of the important active domains in the biomolecules related to antitumour and antifungal group. The simultaneous identification of the biomolecule (dihydro-2H-pyran-2-one derivative) was also inferred spectroscopically. Freshwater Cyanobacteria are prolific producers of secondary metabolite(s) that may act as the antimicrobial drug resource in addition to their much explored marine counterpart. © 2016 The Society for Applied Microbiology.

  14. Influence of desalinator wastewater for the cultivation of Arthrospira platensis. Fatty acids profile

    Directory of Open Access Journals (Sweden)

    Volkmann, Harriet

    2007-12-01

    Full Text Available The need for a desalination processes in northeastern Brazil is due to the salinity of its water sources. However, these processes produce residues with high saline concentrations and a significant environmental impact. These wastewaters can be used for Arthrospira platensis cultivation. This work aimed to cultivate Arthrospira platensis in three different media: Paoletti Synthetic Medium (PSM, Salinated Water Medium (SWM and Desalinator Wastewater Médium (DWWM. Microalgae were cultivated under controlled conditions, in 4 L photobioreactors, 30±1°C, 12 hours of light/dark photoperiod provided by fluorescent lamps at a light intensity of 140 μmol• m–2•s–1 and constant bubbling of air (0.5 L•L–1 •min–1. The effect of different media on cell concentration, productivity, total content of lipids and fatty acids profile was verified. Higher cell concentration, as well as higher productivity was observed in DWWM: 4.954 (±0.554 g•L–1 and 0.225 (±0.042 g•L–1 •day–1, respectively. Concerning total lipids, the contents of 4.54% and 4.69% were observed in DWWM and SWM, respectively. High levels of saturated fatty acids were observed in both treatments. Concerning γ-linolenic acid, the contents of 13.09% (DWWM and 11.95% (SWM were found.En la región nordeste de Brasil, debido a la elevada salinidad de los acuíferos, existe la necesidad de utilizar procesos de desalación. Sin embargo, estos procesos generan residuos con alta concentración salina, con significativo impacto ambiental. El objetivo de este trabajo fue el cultivo de Arthrospira platensis en tres medios de cultivo diferentes: medio de Paoletti, medio de agua salinizada y medio de agua de desecho obtenida en el proceso de desalación de acuíferos. Las microalgas fueron cultivadas en laboratorio, con condiciones controladas, en fotobiorreactores de 4 L, a 30±1°C y periodos de 12 horas de claridad/oscuridad con iluminación de 140 μmol•m–2•s–1 e

  15. OPTIMALISASI EKSTRAKSI DAN UJI STABILITAS PHYCOCYANIN DARI MIKROALGA Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Bakti Jos

    2012-02-01

    Full Text Available The growing awareness of the importance of natural colours especially food and cosmetic colorants has placedgreat demand on biological sources of natural colours. It is for this reason that the phycobiliproteins inSpirulina platensis is gaining increasing attention as an alternative colour for these products. Numerousscientific reports confirm the fact that Phycocyanin from Spirulina platensis, is not only an effective naturalblue colorant, but also a compound that is beneficial to the health of the consumer. The aim of this research is toconduct evaluation studies phycocyanin production by extraction with polar solvents at various concentrationsto obtain extracts for maximum yield. The methods in this study has several stages, namely preparation ofmaterials, extraction, solubility studies of phycocyanin, phycocyanin’s stability test. Changing variables in thisstudy are water, acetic acid 70%, 75%, 80%, ammonium sulphate 50%, 55%, 60%. The analysis of the extractsof phycocyanin’s content using spectrophotometric methods. The observations produces a blue pigment whichhas the highest color intensity with maximum absorbance of 620 nm. Acetic acid 80% is the most effectivesolvent to extract the blue pigment phycocyanin than water and ammonium sulfate. Extraction is influenced bythe pH of the increase in absorption (absorbance with increasing pH and was not influenced by storagetemperature and time

  16. Evaluation of the Influence of Nitrogen and Phosphorus Nutrients in the Culture and Production ofbiosurfactants by MicroalgaSpirulina

    OpenAIRE

    Lisiane Fernandes De Carvalho; Mariana Souza De Oliveira

    2014-01-01

    The aim of this study was to verify the influence of phosphorus and nitrogen nutrients in the culture and production of biosurfactants by Spirulina platensis LEB 52,Spirulina platensisParacas and Spirulina sp. LEB 18. For this, experiments were performed using Full Factorial Design 22 to evaluate the influence of phosphorus and nitrogen nutrients on the maximum biomass concentration and maximum productivity in the cultures, as well as in production biosurfactant by extracts...

  17. Análisis microscópico de muestras comerciales de Spirulina (Cyanophyta)

    OpenAIRE

    Arenas, Patricia Marta; Cortella, Alicia Rita

    1996-01-01

    Se analizó el contenido de muestras comerciales de Spirulina (Cyanophytu), expendidas en el mercado como suplementos dietéticos y adelgazantes. Fueron observadas al microscopio fotónico y al microscopio electrónico de barrido (MEB), previo tratamiento por "freeze drying". Los resultados indican que todas contienen Spirulina platensis. En algunas de ellas esta especie se presenta pura, mientras que en otras se halla mezclada con otras Cyanophyta (Oscillatoria y Phormidium) debido probablemente...

  18. DESEMPENHO DE CORDEIROS SANTA INÊS SUBMETIDOS A ALEITAMENTO ARTIFICIAL ENRIQUECIDO COM Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Leilson Rocha Bezerr a

    2010-06-01

    Full Text Available The experiment was carried out in Maria Paz Ranch/SheepProduction Department, in São José de Espinharas, PB. Analyseswere performed in the Laboratory of Animal Nutrition/Centrode Saúde e Tecnologia Rural/Universidade Federal de CampinaGrande. The objectives of this study were to evaluate the effectof the supplementation with cow milk enriched with Spirulinaplatensis (Sp on lamb performance submitted to creep feeding,and determine the most adequate period to suplemet nursinglambs with Spirulina platensis. Data on dry matter (DMC andcrude protein (CPC consumptions, body weight (BW, and meandaily body weight gain (MDBWG were colleted. The three levelsof Spirulina supplementation were assigned to 30 lambs (plotsaccording to a randomized block (lamb weight design with 10replications. Data were collected in four consecutive periods,characterizing a split plot in time. DM and CP consumptions werenot affected by spirulina level x period interaction, and increasedwith periods (animal age. BW and MDBWG were affected bythe spirulina level x period interaction. Spirulina levels affectedMDBWG only from day 0 to day 15, when the MDBWG (300gwas higher at level 10g than at level zero of Spirulina that resulted in 205g in MDBWG. Live body weight at the end of each periodwas also higher when the lambs were supplemented with 10 g ofSpirulina (12.00 17.02, 19.71 and 25.30kg, respectively, for thefour consecutive periods. The dilution of Spirulina platensis incow milk showed to be efficient on the daily performance of lambswhen utilized in concentration of 10g/day and from period 15 to30 days of age.

  19. A chiral microwave absorbing absorbent of Fe–CoNiP coated on spirulina

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Yonggang, E-mail: xuyonggang221@163.com [Science and Technology on Electromagnetic Scattering Laboratory, Shanghai, 200438 (China); Yuan, Liming [Science and Technology on Electromagnetic Scattering Laboratory, Shanghai, 200438 (China); Zhang, Deyuan [School of Mechanical Engineering and Automation, Beihang University, Beijing, 100191 (China)

    2015-11-15

    A chiral bio-absorbent of Fe–CoNiP coated on the spirulina was fabricated by the electroless and chemical vapor decomposition. The scanning electron microscopy (SEM) was used to evaluate the spirulina cells particle morphology. X-ray diffraction (XRD) patterns were done to analyze the particle crystal grain structure. The permittivity and permeability was measured by a vector network analyzer in frequency 8–18 GHz, and the reflection loss (RL) was calculated. The results showed the carbonyl iron particles (CIPs) and CoNiP were bonded to the spirulina surface, the permittivity and permeability could be enlarged as Fe films coated on the particles compared with the CoNiP spirulina, it was attributed to the excellent electromagnetic property of CIPs. The chiral Fe–CoNiP composites had a better absorbing property at 8–18 GHz than the CoNiP spirulina composite, the RL was −16.26 dB at 10.48 GHz, the absorbing band was 9.5–11.5 GHz of RL less than −10 dB, which indicated the Fe–CoNiP spirulina could be an effective absorbent used in 8–18 GHz. - Highlights: • Absorbers filled with Fe–CoNiP coating on the spirulina were fabricated. • The permittivity and permeability increased as CIPs coated. • The Fe material enhanced the electromagnetic property. • The spirulina coated Fe–CoNiP was effective in 8–18 GHz.

  20. Excited-state properties of the 16 kDa red carotenoid protein from Arthrospira maxima

    Czech Academy of Sciences Publication Activity Database

    Chábera, P.; Durchan, Milan; Shih, P.M.; Kerfeld, C.A.; Polívka, Tomáš

    2011-01-01

    Roč. 1807, č. 1 (2011), s. 30-35 ISSN 0005-2728 Institutional research plan: CEZ:AV0Z50510513 Keywords : cyanobacteria * carotenoid * excited-state Subject RIV: BO - Biophysics Impact factor: 4.843, year: 2011

  1. Key Role of Alphaproteobacteria and Cyanobacteria in the Formation of Stromatolites of Lake Dziani Dzaha (Mayotte, Western Indian Ocean

    Directory of Open Access Journals (Sweden)

    Emmanuelle Gérard

    2018-05-01

    Full Text Available Lake Dziani Dzaha is a thalassohaline tropical crater lake located on the “Petite Terre” Island of Mayotte (Comoros archipelago, Western Indian Ocean. Stromatolites are actively growing in the shallow waters of the lake shores. These stromatolites are mainly composed of aragonite with lesser proportions of hydromagnesite, calcite, dolomite, and phyllosilicates. They are morphologically and texturally diverse ranging from tabular covered by a cauliflower-like crust to columnar ones with a smooth surface. High-throughput sequencing of bacterial and archaeal 16S rRNA genes combined with confocal laser scanning microscopy (CLSM analysis revealed that the microbial composition of the mats associated with the stromatolites was clearly distinct from that of the Arthrospira-dominated lake water. Unicellular-colonial Cyanobacteria belonging to the Xenococcus genus of the Pleurocapsales order were detected in the cauliflower crust mats, whereas filamentous Cyanobacteria belonging to the Leptolyngbya genus were found in the smooth surface mats. Observations using CLSM, scanning electron microscopy (SEM and Raman spectroscopy indicated that the cauliflower texture consists of laminations of aragonite, magnesium-silicate phase and hydromagnesite. The associated microbial mat, as confirmed by laser microdissection and whole-genome amplification (WGA, is composed of Pleurocapsales coated by abundant filamentous and coccoid Alphaproteobacteria. These phototrophic Alphaproteobacteria promote the precipitation of aragonite in which they become incrusted. In contrast, the Pleurocapsales are not calcifying but instead accumulate silicon and magnesium in their sheaths, which may be responsible for the formation of the Mg-silicate phase found in the cauliflower crust. We therefore propose that Pleurocapsales and Alphaproteobacteria are involved in the formation of two distinct mineral phases present in the cauliflower texture: Mg-silicate and aragonite

  2. Epithermal neutron activation analysis of Spirulina platensis biomass, of the C-phycocianin and of DNA extracted from it

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pomyakushina, E.V.

    2002-01-01

    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration of 27 macro-, micro- and trace elements ranging from 10 -3 up to 10 4 ppm were determined. It was found that the biomass of Spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole Spirulina biomass with that of a refined C-phycocianin preparation was made

  3. Application of Epithermal Neutron Activation Analysis to Investigate Accumulation and Adsorption of Mercury by Spirulina platensis Biomass

    CERN Document Server

    Mosulishvili, L M; Khizanishvili, A I; Frontasyeva, M V; Kirkesali, E I; Aksenova, N G

    2004-01-01

    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations \\sim 100 {\\mu}g/l.

  4. Protective effects of Spirulina maxima on hyperlipidemia and oxidative-stress induced by lead acetate in the liver and kidney.

    Science.gov (United States)

    Ponce-Canchihuamán, Johny C; Pérez-Méndez, Oscar; Hernández-Muñoz, Rolando; Torres-Durán, Patricia V; Juárez-Oropeza, Marco A

    2010-03-31

    Oxidative damage has been proposed as a possible mechanism involved in lead toxicity, specially affecting the liver and kidney. Previous studies have shown the antioxidant effect of Spirulina maxima in several experimental models of oxidative stress. The current study was carried out to evaluate the antioxidant activity of Spirulina maxima against lead acetate-induced hyperlipidemia and oxidative damage in the liver and kidney of male rats. Control animals were fed on a standard diet and did not receive lead acetate (Control group). Experimental animals were fed on a standard laboratory diet with or without Spirulina maxima 5% in the standard laboratory diet and treated with three doses of lead acetate (25 mg each/weekly, intraperitoneal injection) (lead acetate with Spirulina, and lead acetate without Spirulina groups). The results showed that Spirulina maxima prevented the lead acetate-induced significant changes on plasma and liver lipid levels and on the antioxidant status of the liver and kidney. On the other hand, Spirulina maxima succeeded to improve the biochemical parameters of the liver and kidney towards the normal values of the Control group. It was concluded that Spirulina maxima has protective effects on lead acetate-induced damage, and that the effects are associated with the antioxidant effect of Spirulina.

  5. Application of epithermal neutron activation analysis to investigate accumulation and adsorption of mercury by Spirulina platensis biomass

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Kirkesali, E.I.; Aksenova, N.G.

    2004-01-01

    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations ∼100 μg/1

  6. Epithermal Neutron Activation Analysis of Spirulina platensis Biomass, of the C-Phycocianin and of DNA Extracted from It

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Kirkesali, E I; Khizanishvili, A I; Pomyakushina, E V

    2002-01-01

    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration 27 macro-, micro- and trace elements ranging from 10^{-3} up to 10^{4} ppm were determined. It was found that the biomass of spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole spirulina biomass with that of a refined C-phycocianin preparation was made.

  7. Use of rotifers for the maintenance of monoalgal mass cultures of Spirulina

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, S.A.; Richmond, A.

    1987-01-01

    Zooplankton was successfully used for the biological control of unicellular algal contaminants in Spirulina mass cultures even under conditions adverse to the growth of Spirulina (maximal winter daily temperature of approximately 10 degrees C and very low bicarbonate concentration). Brachionus plicatilis (Rotifera) was the most successful species of zooplankton used. The interrelationships between Spirulina, green unicellular contaminant, and B. plicatilis were studied under various conditions. Two species of unicellular contaminant were used; Monoraphidium minutum was isolated from local cultures and Chlorella vulgaris, obtained from contaminated Spirulina cultures in Israel. The rotifer B. plicatilis successfully controlled the population size of both contaminants whether they were introduced in a single addition or as a daily dose. The biological control of the unicellular contaminants allows Spirulina to be cultured in a medium low in bicarbonate, thereby reducing the cost of the medium and increasing the quantity of CO2 that may be freely absorbed from the atmosphere at the optimal pH for Spirulina cultivation. (Refs. 9).

  8. Optimization of formulation and processing of Moringa oleifera and spirulina complex tablets.

    Science.gov (United States)

    Zheng, Yi; Zhu, Fan; Lin, Dan; Wu, Jun; Zhou, Yichao; Mark, Bohn

    2017-01-01

    Objective: To prepare a more comprehensive nutrition, more balanced proportion of natural nutritional supplement tablets with Moringa oleifera leaves and spirulina the two nutrients which have complementary natural food ingredients. Method: On the basis of research M. oleifera leaves with spirulina nutrient composition was determined on M. oleifera leaves and spirulina ratio of raw materials, and the choice of microcrystalline cellulose, sodium salt of caboxy methyl cellulose(CMC),magnesium stearate excipient, through single factor and orthogonal experiment, selecting the best formula tablets prepared by powder direct compression technology, for preparation of M. oleifera and spirulina complex tablets. Results: The best ratio of raw material for the M. oleifera leaves powder: spirulina powder was 7:3, the best raw materials for the tablet formulation was 88.5%, 8.0% microcrystalline cellulose, CMC 2.0%, stearin magnesium 1.5%, the optimum parameters for the raw material crushing 200-300 mesh particle size, moisture content of 7%, tableting pressure 40 kN. Conclusion: Through formulation and process optimization, we can prepare more comprehensive and balanced nutrition M. oleifera and spirulina complex tablets, its sheet-shaped appearance, piece weight variation, hardness, friability, disintegration and other indicators have reached the appropriate quality requirements.

  9. Spirulina chitosan gel induction on healing process of Cavia cobaya post extraction socket

    Directory of Open Access Journals (Sweden)

    Rostiny Rostiny

    2014-03-01

    Full Text Available Background: Prominent residual ridge is necessary to gain retention and stabilility for succesful prosthodontic treatment such as removable, fixed or implant. Spirulina is a natural substance that can help tissue healing and chitosan also a natural substance that reported to have the ability to help bone remodelling. The combination gel of spirulina and chitosan could be considered as an alternative material to maintain residual ridge height after tooth extraction. Purpose: The aim of study was to examine the effect of combination gel of Spirulina and chitosan on healing process of Cavia cobaya post tooth extraction socket by counting the amount of osteoclast, osteoblast and colagen as an indicator. Methods: Twenty eight cavia cobaya were divided into 4 groups. Insisive mandible extraction was done and the sockets were filled with 3% CMCNa for control groups, 3% spirulina chitosan 200 mg for group 1, 6% spirulina chitosan 200 mg for group 2, 12% spirulina chitosan 200 mg for group 3. After 30 days, histopathology examination was done by using microscope to count the amount of osteoclast, osteoblast and collagen. Results: Data was analyzed by using Anova and Tukey HSD. For osteoclast, there was no significant different between every groups, while for osteoblast and collagen there was significant different between groups. The results showed that induction of combination gel spirulina chitosan was able to accumulate collagen fiber and resulting faster wound healing. Conclusion: Combination 12% gel spirulina chitosan 200 mg could be used as an alternative material for better bone remodeling after tooth extraction.Latar belakang: Residual ridge yang prominen sangat dibutuhkan untuk mendapatkan retensi dan stabilitas untuk menunjang keberhasilan perawatan di bidang prostodonsia seperti pada kasus removable, fixed atau implant. Tindakan pencabutan gigi dapat merusak jaringan periodontal, sementum dan tulang alveolar yang mengakibatkan resorbsi ridge

  10. Diurnal changes of photosynthesis and growth of Arthrospira platensis cultured in a thin-layer cascade and an open pond

    Czech Academy of Sciences Publication Activity Database

    Benavides, A.M.S.; Ranglová, Karolína; Malapascua, José R.; Masojídek, Jiří; Torzillo, G.

    2017-01-01

    Roč. 28, DEC (2017), s. 48-56 ISSN 2211-9264 R&D Projects: GA MŠk(CZ) LO1416; GA MŠk EE2.3.30.0059 Grant - others:AV ČR(CZ) CNR-16-29 Program:Bilaterální spolupráce Institutional support: RVO:61388971 Keywords : Arthrospira platensis * Pond * Thin-layer cascade Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.994, year: 2016

  11. Cyanobacteria facilitate parasite epidemics in Daphnia.

    Science.gov (United States)

    Tellenbach, C; Tardent, N; Pomati, F; Keller, B; Hairston, N G; Wolinska, J; Spaak, P

    2016-12-01

    The seasonal dominance of cyanobacteria in the phytoplankton community of lake ecosystems can have severe implications for higher trophic levels. For herbivorous zooplankton such as Daphnia, cyanobacteria have poor nutritional value and some species can produce toxins affecting zooplankton survival and reproduction. Here we present another, hitherto largely unexplored aspect of cyanobacteria, namely that they can increase Daphnia susceptibility to parasites. In a 12-yr monthly time-series analysis of the Daphnia community in Greifensee (Switzerland), we observed that cyanobacteria density correlated significantly with the epidemics of a common gut parasite of Daphnia, Caullerya mesnili, regardless of what cyanobacteria species was present or whether it was colonial or filamentous. The temperature from the previous month also affected the occurrence of Caullerya epidemics, either directly or indirectly by the promotion of cyanobacterial growth. A laboratory experiment confirmed that cyanobacteria increase the susceptibility of Daphnia to Caullerya, and suggested a possible involvement of cyanotoxins or other chemical traits of cyanobacteria in this process. These findings expand our understanding of the consequences of toxic cyanobacterial blooms for lake ecosystems and might be relevant for epidemics experienced by other aquatic species. © 2016 by the Ecological Society of America.

  12. Versatility of hydrocarbon production in cyanobacteria.

    Science.gov (United States)

    Xie, Min; Wang, Weihua; Zhang, Weiwen; Chen, Lei; Lu, Xuefeng

    2017-02-01

    Cyanobacteria are photosynthetic microorganisms using solar energy, H 2 O, and CO 2 as the primary inputs. Compared to plants and eukaryotic microalgae, cyanobacteria are easier to be genetically engineered and possess higher growth rate. Extensive genomic information and well-established genetic platform make cyanobacteria good candidates to build efficient biosynthetic pathways for biofuels and chemicals by genetic engineering. Hydrocarbons are a family of compounds consisting entirely of hydrogen and carbon. Structural diversity of the hydrocarbon family is enabled by variation in chain length, degree of saturation, and rearrangements of the carbon skeleton. The diversified hydrocarbons can be used as valuable chemicals in the field of food, fuels, pharmaceuticals, nutrition, and cosmetics. Hydrocarbon biosynthesis is ubiquitous in bacteria, yeasts, fungi, plants, and insects. A wide variety of pathways for the hydrocarbon biosynthesis have been identified in recent years. Cyanobacteria may be superior chassis for hydrocabon production in a photosynthetic manner. A diversity of hydrocarbons including ethylene, alkanes, alkenes, and terpenes can be produced by cyanobacteria. Metabolic engineering and synthetic biology strategies can be employed to improve hydrocarbon production in cyanobacteria. This review mainly summarizes versatility and perspectives of hydrocarbon production in cyanobacteria.

  13. Engineering cyanobacteria as photosynthetic feedstock factories.

    Science.gov (United States)

    Hays, Stephanie G; Ducat, Daniel C

    2015-03-01

    Carbohydrate feedstocks are at the root of bioindustrial production and are needed in greater quantities than ever due to increased prioritization of renewable fuels with reduced carbon footprints. Cyanobacteria possess a number of features that make them well suited as an alternative feedstock crop in comparison to traditional terrestrial plant species. Recent advances in genetic engineering, as well as promising preliminary investigations of cyanobacteria in a number of distinct production regimes have illustrated the potential of these aquatic phototrophs as biosynthetic chassis. Further improvements in strain productivities and design, along with enhanced understanding of photosynthetic metabolism in cyanobacteria may pave the way to translate cyanobacterial theoretical potential into realized application.

  14. Harnessing transcription for bioproduction in cyanobacteria

    DEFF Research Database (Denmark)

    Stensjö, Karin; Vavitsas, Konstantinos; Tyystjärvi, Taina

    2018-01-01

    Sustainable production of biofuels and other valuable compounds is one of our future challenges. One tempting possibility is to use photosynthetic cyanobacteria as production factories. Currently, tools for genetic engineering of cyanobacteria are yet not good enough to exploit the full potential...... of cyanobacteria. A wide variety of expression systems will be required to adjust both the expression of heterologous enzyme(s) and metabolic routes to the best possible balance, allowing the optimal production of a particular substance. In bacteria, transcription, especially the initiation of transcription, has...

  15. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis

    DEFF Research Database (Denmark)

    Pedersen, Morten Løbner; Walsted, Anette; Larsen, Rune

    2008-01-01

    The effect of consumption of Immulina, a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis, on adaptive immune responses was investigated by evaluation of changes in leukocyte responsiveness to two foreign recall antigens, Candida albicans (CA) and tetanus...

  16. Fresh pasta production enriched with Spirulina platensis biomass

    Directory of Open Access Journals (Sweden)

    Ailton Cesar Lemes

    2012-10-01

    Full Text Available The aim of this work was to study the enrichment of Spirulina platensis in wheat flour to prepare fresh pasta to evaluate the green color and nutritional enrichment in addition to functional properties due to the presence of the bioactive compounds in the cyanobacterium. The pastas were evaluated for the centesimal composition, microbiological contamination, sensorial acceptance and technological characteristics such as cooking time, water absorption, volume displacement and loss of solids. The superior protein contents and the satisfactory technological and sensorial attributes compared with the control with no cyanobacterium showed the usefulness of incorporating S. platensis biomass in the fresh pastas. The microbiological quality was in compliance with the legislation in force. The sensorial quality was considered satisfactory (“liked very much” and purchase intention high (“probably would buy”.

  17. Equilibrium and thermodynamics of azo dyes biosorption onto Spirulina platensis

    Directory of Open Access Journals (Sweden)

    G. L. Dotto

    2013-03-01

    Full Text Available The equilibrium and thermodynamics of azo dye (tartrazine and allura red biosorption onto Spirulina platensis biomass were investigated. The equilibrium curves were obtained at 298, 308, 318 and 328 K, and four isotherm models were fitted the experimental data. Biosorption thermodynamic parameters (ΔG, ΔH and ΔS were estimated. The results showed that the biosorption was favored by a temperature decrease. For both dyes, the Sips model was the best to represent the equilibrium experimental data (R²>0.99 and ARE<5.0% and the maximum biosorption capacities were 363.2 and 468.7 mg g-1 for tartrazine and allura red, respectively, obtained at 298 K. The negative values of ΔG and ΔH showed that the biosorption of both dyes was spontaneous, favorable and exothermic. The positive values of ΔS suggested that the system disorder increases during the biosorption process.

  18. Photomixotrophic chemical production in cyanobacteria.

    Science.gov (United States)

    Matson, Morgan M; Atsumi, Shota

    2018-04-01

    The current global dependence on fossil fuels for both energy and chemical production has spurred concerns regarding long-term resource security and environmental detriments resulting from increased CO 2 levels. Through the installation of exogenous metabolic pathways, engineered cyanobacteria strains can directly fix CO 2 into industrially relevant chemicals currently produced from petroleum. This review highlights some of the studies that have successfully implemented photomixotrophic conditions to increase cyanobacterial chemical production. Supplementation with fixed carbon sources provides additional carbon building blocks and energy to enhance production and occasionally aid in growth. Photomixotrophic production has increased titers up to 5-fold over traditional autotrophic conditions, demonstrating promising applications for future commercialization. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Liberation of ammonia by cyanobacteria

    International Nuclear Information System (INIS)

    Newton, J.W.

    1986-01-01

    Photoheterotrophic nitrogen-fixing cyanobacteria release ammonia when treated with methionine sulfoximine (MSX) to inhibit nitrogen incorporation into protein. This released ammonia can be derived from recently fixed nitrogen (nitrogen atmosphere) or endogenous reserves (argon atmosphere). Anaerobic ammonia release requires light and is stimulated by the photosystem II herbicides DCMU and Atrazine, regardless of the source of ammonia. As much as one quarter of the total cellular nitrogen can be released as ammonia by cyanbacteria treated with MSX and DCMU under argon in light. Chromatography of cell extracts indicates that virtually all cellular proteins are degraded. DCMU and Atrazine, at very low concentration, inhibit sustained uptake of the ammonia analog 14 C methylamine. These data indicate that the herbicides interrupt ammonia uptake and retention by the cells, and support a role for photosystem II in ammonia metabolism

  20. Liberation of ammonia by cyanobacteria

    Energy Technology Data Exchange (ETDEWEB)

    Newton, J.W.

    1986-04-01

    Photoheterotrophic nitrogen-fixing cyanobacteria release ammonia when treated with methionine sulfoximine (MSX) to inhibit nitrogen incorporation into protein. This released ammonia can be derived from recently fixed nitrogen (nitrogen atmosphere) or endogenous reserves (argon atmosphere). Anaerobic ammonia release requires light and is stimulated by the photosystem II herbicides DCMU and Atrazine, regardless of the source of ammonia. As much as one quarter of the total cellular nitrogen can be released as ammonia by cyanbacteria treated with MSX and DCMU under argon in light. Chromatography of cell extracts indicates that virtually all cellular proteins are degraded. DCMU and Atrazine, at very low concentration, inhibit sustained uptake of the ammonia analog /sup 14/C methylamine. These data indicate that the herbicides interrupt ammonia uptake and retention by the cells, and support a role for photosystem II in ammonia metabolism.

  1. Influence of Spirulina platensis powder on the microflora of yoghurt and acidophilus milk

    Directory of Open Access Journals (Sweden)

    Metin Guldas

    2010-12-01

    Full Text Available The main purpose of this research was to monitor the influence of the powdered Cyanobacterium Spirulina platensis addition to plain yoghurt and the yoghurt containing Lactobacillus acidophiluson survival of the microbiota during the refrigerated storage. The cell viability of yoghurt starter cultures (Lactobacillus delbrueckii subsp. bulgaricus and Streptococcus thermophilus and Lactobacillus acidophilus under refrigeration conditions in yoghurts prepared with (0.5 or 1.0 (w/w % and without the addition of Spirulina powder was investigated. The yoghurts were prepared under hygienic laboratory conditions and their pH and acidity were controlled during the process. The samples of yoghurts were stored at 4 °C and investigated on days 1, 5, 10, 15, 20, 25 and 30. Viable counts of the lactic acid bacteria were above 6 cfu g-1of all “spirulina powder” added samples whereas control yoghurt samples contained lower lactic acid bacteria count at the end of the storage period. Addition of 1 % Spirulina platensis powder into the yoghurts did not cause significant differences on the viable lactic acid bacteria (p≤0.05. The results showed the positive effect of S. platensis powder on the survival of the lactic acid bacteria during storage of yoghurt (P≤0.05. The sensory analysis was also performed for the yoghurt samples. Sensory scores of 0.5 % spirulina powder added yoghurt samples were better than 1 % spirulina powder added ones. It was determined that spirulina powder added yoghurt is a good medium of lactic acid bacteria during the 30 days of refrigerated storage.

  2. Diel infection of cyanobacteria by cyanophages

    Directory of Open Access Journals (Sweden)

    Tianchi eNi

    2016-01-01

    Full Text Available Cyanobacteria exhibit biological rhythms as an adaptation to the daily light-dark (diel cycle. Light is also crucial for bacteriophages (cyanophages that infect cyanobacteria. As the first step of infection, the adsorption of some cyanophages to their host cells is light-dependent. Moreover, cyanophage replication is affected by light intensity and possibly the host cell cycle. Photosynthesis and carbon metabolism genes have been found in cyanophage genomes. With these genes, cyanophages may affect the host metabolic rhythm. Field studies suggest that cyanophage infection of cyanobacteria in aquatic environments is synchronized directly or indirectly to the light-dark cycle. These discoveries are beginning to reveal how the daily light-dark cycle shapes the interaction of cyanophages and cyanobacteria, which eventually influences matter and energy transformation in aquatic environments.

  3. Cyanofuels: biofuels from cyanobacteria. Reality and perspectives.

    Science.gov (United States)

    Sarsekeyeva, Fariza; Zayadan, Bolatkhan K; Usserbaeva, Aizhan; Bedbenov, Vladimir S; Sinetova, Maria A; Los, Dmitry A

    2015-08-01

    Cyanobacteria are represented by a diverse group of microorganisms that, by virtue of being a part of marine and freshwater phytoplankton, significantly contribute to the fixation of atmospheric carbon via photosynthesis. It is assumed that ancient cyanobacteria participated in the formation of earth's oil deposits. Biomass of modern cyanobacteria may be converted into bio-oil by pyrolysis. Modern cyanobacteria grow fast; they do not compete for agricultural lands and resources; they efficiently convert excessive amounts of CO2 into biomass, thus participating in both carbon fixation and organic chemical production. Many cyanobacterial species are easier to genetically manipulate than eukaryotic algae and other photosynthetic organisms. Thus, the cyanobacterial photosynthesis may be directed to produce carbohydrates, fatty acids, or alcohols as renewable sources of biofuels. Here we review the recent achievements in the developments and production of cyanofuels-biofuels produced from cyanobacterial biomass.

  4. Engineering cyanobacteria for fuels and chemicals production.

    Science.gov (United States)

    Zhou, Jie; Li, Yin

    2010-03-01

    The world's energy and global warming crises call for sustainable, renewable, carbon-neutral alternatives to replace fossil fuel resources. Currently, most biofuels are produced from agricultural crops and residues, which lead to concerns about food security and land shortage. Compared to the current biofuel production system, cyanobacteria, as autotrophic prokaryotes, do not require arable land and can grow to high densities by efficiently using solar energy, CO(2), water, and inorganic nutrients. Moreover, powerful genetic techniques of cyanobacteria have been developed. For these reasons, cyanobacteria, which carry out oxygenic photosynthesis, are attractive hosts for production of fuels and chemicals. Recently, several chemicals including ethanol, isobutanol and isoprene have been produced by engineered cyanobacteria directly using solar energy, CO(2), and water. Cyanobacterium is therefore a potential novel cell factory for fuels and chemicals production to address global energy security and climate change issues.

  5. Degradation of crude oil by marine cyanobacteria

    Digital Repository Service at National Institute of Oceanography (India)

    Raghukumar, C.; Vipparty, V.; David, J.J.; Chandramohan, D.

    The marine cyanobacteria Oscillatoria salina Biswas, Plectonema terebrans Bornet et Flanhault and Aphanocapsa sp. degraded Bombay High crude oil when grown in artificial seawater nutrients as well as in plain natural seawater. Oil removals...

  6. Human health effects and remotely sensed cyanobacteria

    Science.gov (United States)

    Cyanobacteria blooms (HAB) pose a potential health risk to beachgoers, including HAB-associated gastrointestinal, respiratory and dermal illness. We conducted a prospective study of beachgoers at a Great Lakes beach during July – September, 2003. We recorded each participan...

  7. Measuring N2 Pressure Using Cyanobacteria

    Science.gov (United States)

    Silverman, S. N.; Kopf, S.; Gordon, R.; Bebout, B.; Som, S.

    2017-11-01

    We have shown that cyanobacteria can record information about N2 partial pressure both morphologically and isotopically, and thus may serve as useful geobarometers to help us better understand Earth's ancient atmosphere.

  8. Recent developments in therapeutic applications of Cyanobacteria.

    Science.gov (United States)

    Raja, Rathinam; Hemaiswarya, Shanmugam; Ganesan, Venkatesan; Carvalho, Isabel S

    2016-05-01

    The cyanobacteria (blue-green algae) are photosynthetic prokaryotes having applications in human health with numerous biological activities and as a dietary supplement. It is used as a food supplement because of its richness in nutrients and digestibility. Many cyanobacteria (Microcystis sp, Anabaena sp, Nostoc sp, Oscillatoria sp., etc.) produce a great variety of secondary metabolites with potent biological activities. Cyanobacteria produce biologically active and chemically diverse compounds belonging to cyclic peptides, lipopeptides, fatty acid amides, alkaloids and saccharides. More than 50% of the marine cyanobacteria are potentially exploitable for extracting bioactive substances which are effective in killing cancer cells by inducing apoptotic death. Their role as anti-viral, anti-tumor, antimicrobial, anti-HIV and a food additive have also been well established. However, such products are at different stages of clinical trials and only a few compounds have reached to the market.

  9. Agencies collaborate, develop a cyanobacteria assessment network

    Science.gov (United States)

    Schaeffer, Blake A.; Loftin, Keith A.; Stumpf, Richard P.; Werdell, P. Jeremy

    2015-01-01

    Cyanobacteria are a genetically diverse group of photosynthetic microorganisms that occupy a broad range of habitats on land and water all over the world. They release toxins that can cause lung and skin irritation, alter the taste and odor of potable water, and cause human and animal illness. Cyanobacteria blooms occur worldwide, and climate change may increase the frequency, duration, and extent of these bloom events.

  10. Degradation of textile dyes by cyanobacteria.

    Science.gov (United States)

    Dellamatrice, Priscila Maria; Silva-Stenico, Maria Estela; Moraes, Luiz Alberto Beraldo de; Fiore, Marli Fátima; Monteiro, Regina Teresa Rosim

    Dyes are recalcitrant compounds that resist conventional biological treatments. The degradation of three textile dyes (Indigo, RBBR and Sulphur Black), and the dye-containing liquid effluent and solid waste from the Municipal Treatment Station, Americana, São Paulo, Brazil, by the cyanobacteria Anabaena flos-aquae UTCC64, Phormidium autumnale UTEX1580 and Synechococcus sp. PCC7942 was evaluated. The dye degradation efficiency of the cyanobacteria was compared with anaerobic and anaerobic-aerobic systems in terms of discolouration and toxicity evaluations. The discoloration was evaluated by absorption spectroscopy. Toxicity was measured using the organisms Hydra attenuata, the alga Selenastrum capricornutum and lettuce seeds. The three cyanobacteria showed the potential to remediate textile effluent by removing the colour and reducing the toxicity. However, the growth of cyanobacteria on sludge was slow and discoloration was not efficient. The cyanobacteria P. autumnale UTEX1580 was the only strain that completely degraded the indigo dye. An evaluation of the mutagenicity potential was performed by use of the micronucleus assay using Allium sp. No mutagenicity was observed after the treatment. Two metabolites were produced during the degradation, anthranilic acid and isatin, but toxicity did not increase after the treatment. The cyanobacteria showed the ability to degrade the dyes present in a textile effluent; therefore, they can be used in a tertiary treatment of effluents with recalcitrant compounds. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  11. Improving oxidative stability of olive oil: Incorporation of Spirulina and evaluation of its synergism with citric acid

    International Nuclear Information System (INIS)

    Alavi, N.; Golmakani, M.T.

    2017-01-01

    The effects of different Spirulina concentrations used alone and in combination with citric acid on the oxidative stability of olive oil were assessed. The amounts of primary and secondary oxidation products produced in Spirulina samples were lower than that of the control. The improved oxidative stability indices of Spirulina samples with and without citric acid were in the range of 85.20–94.47% and 258.10–260.21%, respectively. In comparison with the control, Spirulina samples manifested significantly higher carotenoid and chlorophyll contents at the beginning and end of the storage period. The presence of these bioactive compounds results from the presence of Spirulina in the medium and can thus retard the oxidation of olive oil. A higher oxidative stability was reached using BHT in comparison with Spirulina samples. Furthermore, no synergistic action was observed in possible connections between citric acid and Spirulina. In conclusion, Spirulina can enhance oxidative stability and improve the shelf life of olive oil. [es

  12. JST Thesaurus Headwords and Synonyms: Spirulina platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Spirulina platensis 名詞 一般 * * * *... スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Spirulina platensis

  13. Comunidad de cianobacterias durante el ciclo de cultivo de arroz: Oriza sativa L. Cyanobacteria during a rice (Oriza sativa L. crop cycle

    Directory of Open Access Journals (Sweden)

    Cecilia Isabel Sánchez

    2007-07-01

    Full Text Available El desarrollo de las cianobacterias en el cultivo de arroz se ve afectado por diferentes factores abióticos entre ellos la temperatura. El objetivo de nuestro trabajo fue analizar la evolución de la comunidad de cianobacterias durante el ciclo del cultivo de arroz en sitios con diferentes temperaturas del agua de inundación. El cultivo fue regado con agua subterránea. Se compararon dos ubicaciones respecto de la entrada del agua al lote. En macollaje, a los tres días desde la inundación, los recuentos de cianobacterias totales fueron similares en los dos sitios, pero difirieron en los muestreos de panoja embuchada y madurez fisiológica. Los géneros encontrados durante todo el ciclo fueron: Chroococcus, Aphanocapsa y Gloeocapsa (unicelulares, Oscillatoria, Lyngbya y Arthrospira (filamentosas no heterocísticas, Anabaena, Nostoc,Cylindrospermunm y Gloeotrichia (filamentosas heterocísticas. Las cianobacterias filamentosas heterocísticas no superaron el 45% y, en la mayoría de los muestreos, osciló alrededor del 25%. En la zona de mayor temperatura, la proporción de cianobacterias unicelulares fue mayor, y menor la de filamentosas no heterocísticas, la cual fue menor al 2% durante todo el ciclo. Los valores de diversidad de Simpson fueron mayores en la zona de mayor temperatura en cada uno de los momentos de muestreo. Los géneros dominantes fueron unicelulares (Chroococcus y Gloeocapsa en cinco de los seis muestreos. En ambos sitios, el género Chroococcus siempre estuvo presente. Gloeocapsa y Nostoc aparecieron a partir de panoja embuchada y los géneros Cylindrospermum y Gloeotrichia en madurez fisiológica.Abiotic factors as temperature affect cyanobacterial growth in rice crop fields. The aim of our study was to evaluate cyanobacteria during rice crop development in two crop areas with different water temperature. We worked in a rice crop flooded with subterraneous water. We sampled two sites that differed in the distance from the

  14. Nutritional comparison of Spirulina sp powder by solid-state fermentation using Aspergillus sp (FNCL 6088) and Lactobacillus plantarum (FNCL 0127)

    Science.gov (United States)

    Dewi, E. N.; Amalia, U.

    2018-01-01

    The Spirulina sp powder contains high levels of protein and Solid-State Fermentation (SSF) improved protein level. The aims of the study was to find the proximate contents in Spirulina sp’s powder fermentation. The experiments were conducted by SSF of Spirulina sp’s powder using fungi Aspergillus sp (FNCL 6088) and lactic acid bacteria Lactobacillus plantarum (FNCL 0127). SSF was carried out for 10 days at 35% moisture level. The protein contents of Spirulina sp’s powder fermented by L. plantarum were consistently lower (p fermentation. The Spirulina sp fermented products contained the highest level of protein after 6 days.

  15. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals.

    Science.gov (United States)

    Chu, Wan-Loy; Lim, Yen-Wei; Radhakrishnan, Ammu Kutty; Lim, Phaik-Eem

    2010-09-21

    Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3) cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control) at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH) or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS). The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls). Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL). The extract reduced significantly (p assay, the radical scavenging activity of the extract was higher than phycocyanin and was at least 50% of vitamin C and vitamin E. Based on the ABTS assay, the antioxidant activity of the extract at 50 μmug/mL was as good as vitamin C and vitamin E. The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  16. Epithermal neutron activation analysis of blue-green algae Spirulina Platensis as a matrix for selenium-containing pharmaceuticals

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Gundorina, S.F.; Oprea, C.D.

    2000-01-01

    To evaluate the potentiality of the blue-green algae Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals, the background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina Platensis biomass were determined by means of epithermal neutron activation analysis. The possibility of the purpose-oriented incorporation of Se into Spirulina Platensis biomass was demonstrated. The polynomial dependence of the Se accumulation on nutritional medium loading was revealed. The employed analytical technique allows one to reliably control the amount of toxic elements in algae Spirulina Platensis. Based on this study, a conclusion of the possibility to use Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals was drawn

  17. Spirulina improves antioxidant status by reducing oxidative stress in rabbits fed a high-cholesterol diet.

    Science.gov (United States)

    Kim, Mi Yeon; Cheong, Sun Hee; Lee, Jeung Hee; Kim, Min Ji; Sok, Dai-Eun; Kim, Mee Ree

    2010-04-01

    The beneficial effect of Spirulina (Spirulina platensis) on tissue lipid peroxidation and oxidative DNA damage was tested in the hypercholesterolemic New Zealand White rabbit model. After hypercholesterolemia was induced by feeding a high cholesterol (0.5%) diet (HCD) for 4 weeks, then HCD supplemented with 1% or 5% Spirulina (SP1 or SP5, respectively) was provided for an additional 8 weeks. Spirulina supplementation significantly reduced the increased lipid peroxidation level in HCD-fed rabbits, and levels recovered to control values. Oxidative stress biomarkers such as glutathione, glutathione peroxidase, glutathione reductase, and glutathione S-transferase were significantly improved in the liver and red blood cells of rabbits fed SP1. Furthermore, SP5 induced antioxidant enzyme activity by 3.1-fold for glutathione, 2.5-fold for glutathione peroxidase, 2.7-fold for glutathione reductase, and 2.3-fold for glutathione S-transferase in liver, compared to the HCD group. DNA damage in lymphocytes was significantly reduced in both the SP1 and SP5 groups, based on the comet assay. Findings from the present study suggest that dietary supplementation with Spirulina may be useful to protect the cells from lipid peroxidation and oxidative DNA damage.

  18. Spirulina exhibits hepatoprotective effects against lead induced oxidative injury in newborn rats.

    Science.gov (United States)

    Gargouri, M; Ben Saad, H; Ben Amara, I; Magné, C; El Feki, A

    2016-08-31

    Lead is a toxic metal that induces a wide range of biochemical and physiological effects. The present investigation was designed at evaluating the toxic effects of a prenatal exposure to lead of mothers on hepatic tissue of newborn rats, and potent protective effects of spirulina. Female rats were randomly divided into 4 groups which were given a normal diet (control),a diet enriched with spirulina (S), lead acetate administered through drinking water (Pb), or a diet enriched with spirulina and lead contaminated water (S Pb), respectively. The duration of treatments was from the 5th day of gestation to 14 days postpartum. Lead toxicity was assessed by measuring body and liver weights, blood and stomach lead levels, hepatic DNA, RNA and protein amounts, blood enzyme activities (AST and ALT), as well as lipid peroxidation level and activities of antioxidant enzymes in hepatic tissues of neonates. Lead intoxication of mothers caused reduction of liver weight as well as of hepatic DNA, mRNA and protein levels in newborns. Moreover, oxidative stress and changes in antioxidant enzyme activities were recorded. Conversely, supplementation of mothers with spirulina mitigated these effects induced by lead. These results substantiated the potential hepatoprotective and antioxidant activity of spirulina.

  19. Development of a Spirulina Extract/Alginate-Imbedded PCL Nanofibrous Cosmetic Patch.

    Science.gov (United States)

    Byeon, Seon Yeong; Cho, Myung Kwon; Shim, Kyou Hee; Kim, Hye Jin; Song, Hyeon Gi; Shin, Hwa Sung

    2017-09-28

    Cosmetic patches have recently been developed as skin products for personal care owing to rapid advances in the technology of delivery of active ingredients, moisture, and adhesiveness to skin. Alginate and Spirulina are typical marine resources used in cosmetic products. This research involved the development of a Spirulina extract-impregnated alginate nanofiber cosmetic patch supported by a polycaprolactone (PCL) nanofiber cover ( Spi /Alg-PCL NF patch). In addition to the ability of alginate to affect moisture and adhesiveness to skin, the impregnation of Spirulina extract strengthened those abilities as well as its own bioactive effectiveness. All fabrication processing steps were undertaken in aqueous solution. The three components (alginate, Spirulina extract, and PCL) had no detected cytotoxicity in human keratinocyte cell-based examination. In addition, wetting the pre-dried patch on the skin resulted in the Spirulina extract being released within 30 min. The results indicate the excellence of the Spi /Alg-PCL NF patch as a skin-care cosmetic device.

  20. Investigation of the interaction of chrome compounds with blue-green microalgae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Frontas'eva, M.V.; Pavlov, S.S.; Aksenova, N.G.

    2002-01-01

    The interaction of CrIII with the cells of blue-green microalgae Spirulina platensis in course of cultivation in a nutrient medium loaded with corresponding chrome compounds is studied. It is shown that the rate of absorption of CrVI ions by spirulina biomass from the nutrient medium is approximately two orders of magnitude lower as compared to that of CrIII ions. At the same time the presence of CrVI in a nutrient medium is accompanied by a significant decrease in the cell growth rate and by deteriorating the quality of spirulina biomass. It is established that at endogenous insertion of CrIII into the biocomplex of spirulina no change in the valence state of chromium in the nutrient medium is observed and the natural properties of the biomass do not change. On the basis of the obtained concentration dependences, the recommended doses of CrIII in the preparation 'Cr-Spirulina' within the ranges of 30-100 μg/g as a food addition, and 200-250 μg/g for a medical preventive treatment are determined. (author)

  1. Effect of Spirulina addition on the physicochemical and structural properties of extruded snacks

    Directory of Open Access Journals (Sweden)

    Bárbara Franco LUCAS

    Full Text Available Abstract Nowadays the demand for practical food like snacks increases worldwide, however the nutritional value in most these formulations is reduced. Due to its chemical composition with high protein concentration, the microalga Spirulina has been used on the production of enriched foods. The present study aimed to evaluate the effects of Spirulina sp. LEB 18 addition on snacks formulations and extrusion conditions on the physicochemical and structural properties of snacks. Protein concentration and physical properties such as expansion index, bulk density, hardness, water absorption index, water solubility index and color were determined. The results showed that the addition of Spirulina sp. LEB 18, temperature in the last zone of the extruder and feed moisture influenced the product responses. The increase in feed moisture increased the hardness, bulk density and water absorption index of the snacks. Higher concentrations of microalga produced snacks with higher protein content, total color difference (ΔE and compact structure. The addition of 2.6% Spirulina produced snacks with up to 11.3% protein and with adequate physical and structural properties for consumption. Thus, snacks containing Spirulina are an alternative to the demand for healthy food of practical consumption.

  2. Effect of Spirulina platensis Supplementation by Different Concentration in Diet on Red Color Intensity of Kohaku Koi (Cyprinus carpio L.

    Directory of Open Access Journals (Sweden)

    N.B.P Utomo

    2007-01-01

    Full Text Available Kohaku koi (Cyprinus carpio is one of the fancy koi that has a high price.  Red color intensity of kohaku determines its market price.  This study was performed to verify the effect of Spirulina platensis supplementation in diet  with different dosages (1, 3 and 5% on red color intensity of kohaku koi.  The result of study show that inclusion of Spirulina platensis in the diet increased intensity of koi color.  Feeding with  1% of Spirulina platensis enriched paste diet for 5 weeks resulted in  a brighter red color compared to other treatments and control.   Alteration of red color intensity has not been followed by its patch length.  No effect of Spirulina supplementation on koi growth by weight and length were observed. Keywords: Spirulina platensis, color, kohaku, koi, Cyprinus carpio   ABSTRAK Ikan koi kohaku (Cyprinus carpio L merupakan salah satu jenis ikan koi yang memiliki harga tinggi.  Kecerahan warna merah ikan koi kohaku menentukan harga jualnya.  Penelitian ini untuk mengetahui pengaruh penambahan Spirulina platensis in the diet dengan dosis berbeda (1, 3 dan 5% terhadap kualitas warna merah koi kohaku.  Hasil penelitian ini menunjukkan bahwa penambahan Spirulina platensis melalui pakan dapat meningkatkan kualitas warna pada ikan koi. Pemberian pakan berupa pasta yang diperkaya dengan Spirulina platensis sebanyak 1% selama 5 minggu menghasilkan warna merah lebih cerah dibandingkan perlakuan lainnya dan kontrol. Perubahan warna yang terjadi tidak diikuti oleh perubahan panjang bercak warnanya. Penambahan Spirulina pada pakan tidak berpengaruh pada pertumbuhan berat dan panjang ikan koi. Kata kunci: Spirulina platensis, warna, kohaku, koi, Cyprinus carpio

  3. Forecasting cyanobacteria dominance in Canadian temperate lakes.

    Science.gov (United States)

    Persaud, Anurani D; Paterson, Andrew M; Dillon, Peter J; Winter, Jennifer G; Palmer, Michelle; Somers, Keith M

    2015-03-15

    Predictive models based on broad scale, spatial surveys typically identify nutrients and climate as the most important predictors of cyanobacteria abundance; however these models generally have low predictive power because at smaller geographic scales numerous other factors may be equally or more important. At the lake level, for example, the ability to forecast cyanobacteria dominance is of tremendous value to lake managers as they can use such models to communicate exposure risks associated with recreational and drinking water use, and possible exposure to algal toxins, in advance of bloom occurrence. We used detailed algal, limnological and meteorological data from two temperate lakes in south-central Ontario, Canada to determine the factors that are closely linked to cyanobacteria dominance, and to develop easy to use models to forecast cyanobacteria biovolume. For Brandy Lake (BL), the strongest and most parsimonious model for forecasting % cyanobacteria biovolume (% CB) included water column stability, hypolimnetic TP, and % cyanobacteria biovolume two weeks prior. For Three Mile Lake (TML), the best model for forecasting % CB included water column stability, hypolimnetic TP concentration, and 7-d mean wind speed. The models for forecasting % CB in BL and TML are fundamentally different in their lag periods (BL = lag 1 model and TML = lag 2 model) and in some predictor variables despite the close proximity of the study lakes. We speculate that three main factors (nutrient concentrations, water transparency and lake morphometry) may have contributed to differences in the models developed, and may account for variation observed in models derived from large spatial surveys. Our results illustrate that while forecast models can be developed to determine when cyanobacteria will dominate within two temperate lakes, the models require detailed, lake-specific calibration to be effective as risk-management tools. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Use of extracts from oyster shell and soil for cultivation of Spirulina maxima.

    Science.gov (United States)

    Jung, Joo-Young; Kim, Sunmin; Lee, Hansol; Kim, Kyochan; Kim, Woong; Park, Min S; Kwon, Jong-Hee; Yang, Ji-Won

    2014-12-01

    Calcium ion and trace metals play important roles in various metabolisms of photosynthetic organisms. In this study, simple methods were developed to extract calcium ion and micronutrients from oyster shell and common soil, and the prepared extracts were tested as a replacement of the corresponding chemicals that are essential for growth of microalgae. The oyster shell and soil were treated with 0.1 M sodium hydroxide or with 10 % hydrogen peroxide, respectively. The potential application of these natural sources to cultivation was investigated with Spirulina maxima. When compared to standard Zarrouk medium, the Spirulina maxima cultivated in a modified Zarrouk media with elements from oyster shell and soil extract exhibited increases in biomass, chlorophyll, and phycocyanin by 17, 16, and 64 %, respectively. These results indicate that the extracts of oyster shell and soil provide sufficient amounts of calcium and trace metals for successful cultivation of Spirulina maxima.

  5. Microbiological decontamination of Spirulina Platensis and green coffee using accelerated electron beams

    International Nuclear Information System (INIS)

    Nemtanu, Monica R.; Brasoveanu, Mirela; Minea, R.; Mitru, Ecaterina; Grecu, Maria Nicoleta; Albulescu, Mihaela

    2006-01-01

    Biological raw materials can be contaminated with microorganisms and to make them suitable for commercialization, the quality relative to microbial content is necessary to be achieved. Irradiation is a decontamination method for numerous foodstuffs, being a feasible, very effective and environment friendly procedure. The aim of the paper is to evaluate the possibility to apply the electron beam treatment on Spirulina Platensis and green coffee for biological decontamination. The cyanobacterium Spirulina and green coffee have been irradiated with electron beams up to 40 kGy. To determine the microbial load, antioxidant activity, and rheological behaviour the techniques of electron paramagnetic resonance (EPR) and absorption spectroscopy have been applied. The results showed that accelerated electron beams could be efficient to decontaminate Spirulina as well as green coffee without significant changes in their properties. (authors)

  6. Bacterias halotolerantes/alcalofilas productoras de acido indol acético (AIA asociadas a Arthrospira platensis (Cyanophyceae

    Directory of Open Access Journals (Sweden)

    Liliana Cecilia Gómez Gómez

    2012-07-01

    Full Text Available Título en ingles: Halotolerant alkalophilic and indolacetic acid producing acid producing bacteria associated with Arthrospira platensis (Cyanophyceae Resumen: Este trabajo tuvo como propósito contribuir al conocimiento de la interacción entre la cianobacteria alcalófila Arthrospira platensis y las bacterias que crecen asociadas a su mucilago. Se desarrolló un  medio de cultivo heterotrófico en el cual se aislaron cinco cepas bacterianas asociadas a un monocultivo de A. platensis. Se determinó la capacidad de estas cinco cepas para producir ácido 3- indol acético (AIA. La tipificación molecular de los aislamientos bacterianos permitió identificarlos como Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str.  Kh10-101, Indibacter alkaliphilus, type str. LW1T; todas las cepas bacterianas obtenidas  son halotolerantes, alcalófilas y productoras de AIA. Los resultados aportan evidencia para sugerir una interacción benéfica entre A. platensis y sus bacterias asociadas,  quizá como estrategia evolutiva  de cooperación para desarrollarse en  un ambiente hipersalino.    Palabras claves: Bacillus okhensis, Exiguobacterium aurantiacum, Halomonas sp., Indibacter alkaliphilus. Xanthomonas sp. Abstract: The aim of this study was contribute to knowledge over alkalophilic cianobacteryum  Arthrospira platensis  and their  interaction with some associated bacteria growing in their mucilage. Heterotrophic culture medium was designed, in this medium were isolated five bacterial strains associated to single culture of A. platensis. It was measured the 3-indol acetic acid (IAA production by these bacterial strains. Molecular typing allowed identify these bacterial strains like Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str. Kh10-101, Indibacter alkaliphilus, type str. LW1T; all these bacteria are halotolerant

  7. Antioxidant effects of Spirulina supplement against lead acetate-induced hepatic injury in rats

    Directory of Open Access Journals (Sweden)

    Walid Hamdy El-Tantawy

    2016-10-01

    Full Text Available Lead is a toxic metal that induces a wide range of behavioral, biochemical and physiological effects in humans. Oxidative damage has been proposed as a possible mechanism involved in lead toxicity. The current study was carried out to evaluate the antioxidant activities of Spirulina supplement against lead acetate -induced hepatic injury in rats. Five groups of rats were used in this study, Control, Lead acetate (100 mg/kg, Lead acetate (100 mg/kg + 0.5 g/kg Spirulina, Lead acetate (100 mg/kg + 1 g/kg Spirulina and Lead acetate + 25 mg/100 g Vitamin C (reference drug. All experimental groups received the oral treatment by stomach tube once daily for 4 weeks. Lead intoxication resulted in a significant increase in serum alanine transaminae (ALT, aspartate transaminae (AST activities, liver homogenate tumor necrosis factor-α (TNF-α, caspase-3, malondialdehyde (MDA, nitric oxide (NO levels and a significant decline of total serum protein, liver homogenate reduced glutathione (GSH level and superoxide dismutase (SOD activity. Both doses of Spirulina supplement as well as Vitamin C succeeded to improve the biochemical parameters of serum and liver and prevented the lead acetate-induced significant changes on plasma and antioxidant status of the liver. Both doses of Spirulina supplement had the same anti-apoptotic activity and high dose exhibited more antioxidant activity than that of low dose. In conclusion, the results of the present work revealed that Spirulina supplement had protective, antioxidant and anti-apoptotic effects on lead acetate-induced hepatic damage.

  8. The origin of multicellularity in cyanobacteria

    Science.gov (United States)

    2011-01-01

    Background Cyanobacteria are one of the oldest and morphologically most diverse prokaryotic phyla on our planet. The early development of an oxygen-containing atmosphere approximately 2.45 - 2.22 billion years ago is attributed to the photosynthetic activity of cyanobacteria. Furthermore, they are one of the few prokaryotic phyla where multicellularity has evolved. Understanding when and how multicellularity evolved in these ancient organisms would provide fundamental information on the early history of life and further our knowledge of complex life forms. Results We conducted and compared phylogenetic analyses of 16S rDNA sequences from a large sample of taxa representing the morphological and genetic diversity of cyanobacteria. We reconstructed ancestral character states on 10,000 phylogenetic trees. The results suggest that the majority of extant cyanobacteria descend from multicellular ancestors. Reversals to unicellularity occurred at least 5 times. Multicellularity was established again at least once within a single-celled clade. Comparison to the fossil record supports an early origin of multicellularity, possibly as early as the "Great Oxygenation Event" that occurred 2.45 - 2.22 billion years ago. Conclusions The results indicate that a multicellular morphotype evolved early in the cyanobacterial lineage and was regained at least once after a previous loss. Most of the morphological diversity exhibited in cyanobacteria today —including the majority of single-celled species— arose from ancient multicellular lineages. Multicellularity could have conferred a considerable advantage for exploring new niches and hence facilitated the diversification of new lineages. PMID:21320320

  9. Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae.

    NARCIS (Netherlands)

    Wijffels, R.H.; Kruse, O.; Hellingwerf, K.J.

    2013-01-01

    Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments. Cyanobacteria are promising host organisms

  10. Cyanobacteria as Cell Factories to Produce Plant Secondary Metabolites

    OpenAIRE

    Xue, Yong; He, Qingfang

    2015-01-01

    Cyanobacteria represent a promising platform for the production of plant secondary metabolites. Their capacity to express plant P450 proteins, which have essential functions in the biosynthesis of many plant secondary metabolites, makes cyanobacteria ideal for this purpose, and their photosynthetic capability allows cyanobacteria to grow with simple nutrient inputs. This review summarizes the advantages of using cyanobacteria to transgenically produce plant secondary metabolites. Some techniq...

  11. Cultivation of Spirulina maxima in medium supplemented with sugarcane vinasse.

    Science.gov (United States)

    Dos Santos, Raquel Rezende; Araújo, Ofélia de Queiroz Fernandes; de Medeiros, José Luiz; Chaloub, Ricardo Moreira

    2016-03-01

    The feasibility of sugarcane vinasse as supplement in growth medium of Spirulina maxima was investigated. The cell was cultivated under autotrophic (no vinasse, 70 μmol photons m(-2) s(-1)), heterotrophic (no light, culture medium supplemented with vinasse at 0.1% v/v and 1.0% v/v) and mixotrophic conditions (70 μmol photons m(-2) s(-1), vinasse at 0.1% v/v and 1.0% v/v). These preliminary results suggested a cyclic two-stage cultivation - CTSC, with autotrophic condition during light phase of the photoperiod (12 h, 70-200 μmol photons m(-2) s(-1)) and heterotrophic condition during dark phase (12h, 3.0% v/v vinasse). The adopted CTSC strategy consisted in three cycles with 75% withdrawal of suspension and reposition of medium containing 3.0% v/v vinasse, separated by autotrophic rest periods of few days between cycles. Results show an increase of biomass concentration between 0.495 g L(-1) and 0.609 g L(-1) at the 7th day of each cycle and high protein content (between 74.3% and 77.3% w/w). Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Medical Application of Spirulina platensis Derived C-Phycocyanin

    Directory of Open Access Journals (Sweden)

    Qian Liu

    2016-01-01

    Full Text Available Along with the development of marine biological pharmaceutical research, high-effective and low-toxic drugs and functional foods isolated from marine organisms have become a new field of pharmacy and bromatology. The pharmacological actions, such as anti-inflammation, antioxidation, antitumor, immunological enhancement, and hepatorenal protection of C-phycocyanin (C-PC from Spirulina platensis, have been reported, and C-PC has important value of development and utilization either as drug or as functional food. There are many researches about the various pharmacological actions and mechanisms of C-PC, but related reports are only to some extent integrated deeply and accurately enough, which put some limitations to the further application of C-PC in medicine. Particularly, with the improvement of living standards and attention to health issues, C-PC being a functional food is preferred by more and more people. C-PC is easy to get, safe, and nontoxic; thus, it has a great potential of research and development as a drug or functional food. Here, the separation and purification, physicochemical properties, physiological and pharmacological activities, safety, and some applications are reviewed to provide relevant basis for the development of natural medicine and applied products.

  13. Can Spirulina maxima reduce the mutagenic potential of sibutramine?

    Science.gov (United States)

    Araldi, R P; Santos, N P; Mendes, T B; Carvalho, L B; Ito, E T; de-Sá-Júnior, P L; Souza, E B

    2015-12-28

    The worldwide obesity pandemic requires the use of anti-obesity drugs. Sibutramine is an anti-obesity drug that has been used worldwide but is indiscriminately consumed in Brazil. Several studies have demonstrated that sibutramine promotes weight loss and weight maintenance, but several side effects have been associated with its systematic consumption. For this reason, sibutramine was withdrawn from the European and American markets, but still remains legal for use in Brazil. Studies have shown that a 5-10% reduction in body weight results in outstanding health benefits for obese patients. However, in order to promote significant weight loss, it is necessary to use sibutramine for at least 2 years. This long-term exposure has carcinogenic potential, as sibutramine causes DNA damage. Thus, this study evaluated the in vivo mutagenic potential of sibutramine alone (5, 7, 10, 15, and 20 mg/kg) and in association with Spirulina maxima (150 and 300 mg/kg), a cyanobacterium with antioxidant potential, using the polychromatic erythrocyte micronucleus test. Our results reinforced the mutagenic potential of sibutramine alone, which showed a time-dependent action. Combinatory treatments with S. maxima were not able to reduce the genotoxicity of sibutramine. These results were confirmed in vitro with the cytokinesis-blocked micronucleus test. In conclusion, our data showed that new alternative anti-obesity treatments are needed since the consumption of sibutramine can increase the risk of cancer in overweight patients.

  14. Terpenoids and Their Biosynthesis in Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Bagmi Pattanaik

    2015-01-01

    Full Text Available Terpenoids, or isoprenoids, are a family of compounds with great structural diversity which are essential for all living organisms. In cyanobacteria, they are synthesized from the methylerythritol-phosphate (MEP pathway, using glyceraldehyde 3-phosphate and pyruvate produced by photosynthesis as substrates. The products of the MEP pathway are the isomeric five-carbon compounds isopentenyl diphosphate and dimethylallyl diphosphate, which in turn form the basic building blocks for formation of all terpenoids. Many terpenoid compounds have useful properties and are of interest in the fields of pharmaceuticals and nutrition, and even potentially as future biofuels. The MEP pathway, its function and regulation, and the subsequent formation of terpenoids have not been fully elucidated in cyanobacteria, despite its relevance for biotechnological applications. In this review, we summarize the present knowledge about cyanobacterial terpenoid biosynthesis, both regarding the native metabolism and regarding metabolic engineering of cyanobacteria for heterologous production of non-native terpenoids.

  15. Terpenoids and Their Biosynthesis in Cyanobacteria

    Science.gov (United States)

    Pattanaik, Bagmi; Lindberg, Pia

    2015-01-01

    Terpenoids, or isoprenoids, are a family of compounds with great structural diversity which are essential for all living organisms. In cyanobacteria, they are synthesized from the methylerythritol-phosphate (MEP) pathway, using glyceraldehyde 3-phosphate and pyruvate produced by photosynthesis as substrates. The products of the MEP pathway are the isomeric five-carbon compounds isopentenyl diphosphate and dimethylallyl diphosphate, which in turn form the basic building blocks for formation of all terpenoids. Many terpenoid compounds have useful properties and are of interest in the fields of pharmaceuticals and nutrition, and even potentially as future biofuels. The MEP pathway, its function and regulation, and the subsequent formation of terpenoids have not been fully elucidated in cyanobacteria, despite its relevance for biotechnological applications. In this review, we summarize the present knowledge about cyanobacterial terpenoid biosynthesis, both regarding the native metabolism and regarding metabolic engineering of cyanobacteria for heterologous production of non-native terpenoids. PMID:25615610

  16. Color of cyanobacteria: some methodological aspects

    International Nuclear Information System (INIS)

    Prieto, Beatriz; Sanmartin, Patricia; Aira, Noelia; Silva, Benita

    2010-01-01

    Although the color of cyanobacteria is a very informative characteristic, no standardized protocol has, so far, been established for defining the color in an objective way, and, therefore, direct comparison of experimental results obtained by different research groups is not possible. In the present study, we used colorimetric measurements and conventional statistical tools to determine the effects on the measurement of the color of cyanobacteria, of the concentration of the microorganisms and their moisture content, as well as of the size of the target area and the minimum number of measurements. It was concluded that the color measurement is affected by every factor studied, but that this can be controlled for by making at least 10 consecutive measurements/9.62 cm 2 at different randomly selected points on the surface of filters completely covered by films of cyanobacteria in which the moisture contents are higher than 50%.

  17. Cyanobacteria: Promising biocatalysts for sustainable chemical production.

    Science.gov (United States)

    Knoot, Cory J; Ungerer, Justin; Wangikar, Pramod P; Pakrasi, Himadri B

    2018-04-06

    Cyanobacteria are photosynthetic prokaryotes showing great promise as biocatalysts for the direct conversion of CO 2 into fuels, chemicals, and other value-added products. Introduction of just a few heterologous genes can endow cyanobacteria with the ability to transform specific central metabolites into many end products. Recent engineering efforts have centered around harnessing the potential of these microbial biofactories for sustainable production of chemicals conventionally produced from fossil fuels. Here, we present an overview of the unique chemistry that cyanobacteria have been co-opted to perform. We highlight key lessons learned from these engineering efforts and discuss advantages and disadvantages of various approaches. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.

  18. Spirulina Protects against Hepatic Inflammation in Aging: An Effect Related to the Modulation of the Gut Microbiota?

    Directory of Open Access Journals (Sweden)

    Audrey M. Neyrinck

    2017-06-01

    Full Text Available Aging predisposes to hepatic dysfunction and inflammation that can contribute to the development of non-alcoholic fatty liver disease. Spirulina, a cyanobacterium used as a food additive or food supplement, has been shown to impact immune function. We have tested the potential hepatoprotective effect of a Spirulina in aged mice and to determine whether these effects can be related to a modulation of the gut microbiota. Old mice have been fed a standard diet supplemented with or without 5% Spirulina for six weeks. Among several changes of gut microbiota composition, an increase in Roseburia and Lactobacillus proportions occurs upon Spirulina treatment. Interestingly, parameters related to the innate immunity are upregulated in the small intestine of Spirulina-treated mice. Furthermore, the supplementation with Spirulina reduces several hepatic inflammatory and oxidative stress markers that are upregulated in old mice versus young mice. We conclude that the oral administration of a Spirulina is able to modulate the gut microbiota and to activate the immune system in the gut, a mechanism that may be involved in the improvement of the hepatic inflammation in aged mice. Those data open the way to new therapeutic tools in the management of immune alterations in aging, based on gut microbe-host interactions.

  19. Occurrence of cyanobacteria genera in the Vaal Dam: implications ...

    African Journals Online (AJOL)

    The occurrence of cyanobacteria genera in the Vaal Dam was analysed and the factors that influence its dominance in the particular reservoir were also investigated. The study was motivated by the effects of the secondary metabolites of cyanobacteria genera on potable water production. Cyanobacteria genera have been ...

  20. Recruitment of bloom-forming cyanobacteria and its driving factors ...

    African Journals Online (AJOL)

    Based on most of the literature, this paper reviewed the progress made in following aspects: cognition to cyanobacteria recruitment, various traps for studying cyanobacteria recruitment in lakes, recruitment patterns of some species of cyanobacteria, and the driving factors for recruitment. Additionally, perspective studies of ...

  1. Convergent Evolution of Ergothioneine Biosynthesis in Cyanobacteria.

    Science.gov (United States)

    Liao, Cangsong; Seebeck, Florian P

    2017-11-02

    Biosynthesis of N-α-trimethyl-2-thiohistidine (ergothioneine) is a frequent trait in cyanobacteria. This sulfur compound may provide essential relief from oxidative stress related to oxygenic photosynthesis. The central steps in ergothioneine biosynthesis are catalyzed by a histidine methyltransferase and an iron-dependent sulfoxide synthase. In this report, we present evidence that some cyanobacteria recruited and adapted a sulfoxide synthase from a different biosynthetic pathway to make ergothioneine. The discovery of a second origin of ergothioneine production underscores the physiological importance of this metabolite and highlights the evolutionary malleability of the thiohistidine biosynthetic machinery. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. 14CO2 fixation pattern of cyanobacteria

    International Nuclear Information System (INIS)

    Erdmann, N.; Schiewer, U.

    1985-01-01

    The 14 CO 2 fixation pattern of three cyanobacteria in the light and dark were studied. Two different chromatographic methods widely used for separating labelled photosynthetic intermediates were compared. After ethanolic extraction, a rather uniform fixation pattern reflecting mainly the β-carboxylation pathway is obtained for all 3 species. Of the intermediates, glucosylglycerol is specific and high citrulline and low malate contents are fairly specific to cyanobacteria. The composition of the 14 CO 2 fixation pattern is hardly affected by changes in temperature or light intensity, but it is severely affected by changes in the water potential of the medium. (author)

  3. Optical researches for cyanobacteria bloom monitoring in Curonian Lagoon

    Science.gov (United States)

    Shirshin, Evgeny A.; Budylin, Gleb B.; Yakimov, Boris P.; Voloshina, Olga V.; Karabashev, Genrik S.; Evdoshenko, Marina A.; Fadeev, Victor V.

    2016-04-01

    Cyanobacteria bloom is a great ecological problem of Curonian Lagoon and Baltic Sea. The development of novel methods for the on-line control of cyanobacteria concentration and, moreover, for prediction of bloom spreading is of interest for monitoring the state of ecosystem. Here, we report the results of the joint application of hyperspectral measurements and remote sensing of Curonian Lagoon in July 2015 aimed at the assessment of cyanobacteria communities. We show that hyperspectral data allow on-line detection and qualitative estimation of cyanobacteria concentration, while the remote sensing data indicate the possibility of cyanobacteria bloom detection using the spectral features of upwelling irradiation.

  4. Prebiotic competence of spirulina on the production performance of broiler chickens

    Directory of Open Access Journals (Sweden)

    A.B.M. Rawshon Jamil

    2015-09-01

    Full Text Available The study was conducted to evaluate the prebiotic effects of Spirulina as a growth and immunity promoter for broiler chickens. Birds (n=100 were randomly and equally distributed into four groups (T0, T1, T2 and T3 and fed on a diet containing 0, 2, 4 and 8 g Spirulina/kg feed respectively for 4 weeks. The body weight was significantly (P<0.05 increased in the treatment groups fed with Spirulina diet from 7th days to 28th days old. FCR was also significantly (P<0.05 decreased among the treatment groups. Hematological parameters were significantly (P<0.05 increased except ESR which was decreased significantly (P<0.05 in the treatment group. Aspartate aminotransferase (ALT and alanine aminotransferase (AST level were significantly (P<0.05 decreased in all the treatment groups. The study suggests that, Spirulina is a good natural feed additive which has a tremendous effect to improve the broiler production and thereby may reduce the production cost. [J Adv Vet Anim Res 2015; 2(3.000: 304-309

  5. Synthesis of gold nanoparticles by blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Kalabegishvili, T.; Kirkesali, E.; Rcheulishvili, A.

    2012-01-01

    The synthesis of gold nanoparticles by one of the many popular microorganisms - blue-green algae Spirulina platensis was studied. The complex of optical and analytical methods was applied for investigation of experimental samples after exposure to chloroaurate (HAuCl 4 ) solution at different doses and for different time intervals. To characterize formed gold nanoparticles UV-vis, TEM, SEM, EDAX, and XRD were used. It was shown that after 1.5-2 days of exposure the extracellular formation of nanoparticles of spherical form and the distribution peak within the interval of 20-30 nm took place. To determine gold concentrations in the Spirulina platensis biomass, neutron activation analysis (NAA) and atomic absorption spectrometry (AAS) were applied. The results obtained evidence that the concentration of gold accumulated by Spirulina biomass is rapidly growing in the beginning, followed by some increase for the next few days. The obtained substance of Spirulina biomass with gold nanoparticles may be used for medical, pharmaceutical, and technological purposes

  6. Summer heatwaves promote blooms of harmful cyanobacteria

    NARCIS (Netherlands)

    K.D Joehnk; J. Huisman; J. Sharples; B.P. Sommeijer (Ben); P.M. Visser (Petra); J.M. Stroom

    2008-01-01

    htmlabstractDense surface blooms of toxic cyanobacteria in eutrophic lakes may lead to mass mortalities of fish and birds, and provide a serious health threat for cattle, pets, and humans. It has been argued that global warming may increase the incidence of harmful algal blooms. Here, we report on a

  7. Summer heatwaves promote blooms of harmful cyanobacteria

    NARCIS (Netherlands)

    Jöhnk, K.D.; Huisman, J.; Sharples, J.; Sommeijer, B.; Visser, P.M.; Stroom, J.M.

    2008-01-01

    Dense surface blooms of toxic cyanobacteria in eutrophic lakes may lead to mass mortalities of fish and birds, and provide a serious health threat for cattle, pets, and humans. It has been argued that global warming may increase the incidence of harmful algal blooms. Here, we report on a lake

  8. Cyanobacteria of Greece: an annotated checklist

    Science.gov (United States)

    Ourailidis, Iordanis; Panou, Manthos; Pappas, Nikos

    2016-01-01

    Abstract Background The checklist of Greek Cyanobacteria was created in the framework of the Greek Taxon Information System (GTIS), an initiative of the LifeWatchGreece Research Infrastructure (ESFRI) that has resumed efforts to compile a complete checklist of species reported from Greece. This list was created from exhaustive search of the scientific literature of the last 60 years. All records of taxa known to occur in Greece were taxonomically updated. New information The checklist of Greek Cyanobacteria comprises 543 species, classified in 130 genera, 41 families, and 8 orders. The orders Synechococcales and Oscillatoriales have the highest number of species (158 and 153 species, respectively), whereas these two orders along with Nostocales and Chroococcales cover 93% of the known Greek cyanobacteria species. It is worth mentioning that 18 species have been initially described from Greek habitats. The marine epilithic Ammatoidea aegea described from Saronikos Gulf is considered endemic to this area. Our bibliographic review shows that Greece hosts a high diversity of cyanobacteria, suggesting that the Mediterranean area is also a hot spot for microbes. PMID:27956851

  9. Cyanobacteria of Greece: an annotated checklist.

    Science.gov (United States)

    Gkelis, Spyros; Ourailidis, Iordanis; Panou, Manthos; Pappas, Nikos

    2016-01-01

    The checklist of Greek Cyanobacteria was created in the framework of the Greek Taxon Information System (GTIS), an initiative of the LifeWatchGreece Research Infrastructure (ESFRI) that has resumed efforts to compile a complete checklist of species reported from Greece. This list was created from exhaustive search of the scientific literature of the last 60 years. All records of taxa known to occur in Greece were taxonomically updated. The checklist of Greek Cyanobacteria comprises 543 species, classified in 130 genera, 41 families, and 8 orders. The orders Synechococcales and Oscillatoriales have the highest number of species (158 and 153 species, respectively), whereas these two orders along with Nostocales and Chroococcales cover 93% of the known Greek cyanobacteria species. It is worth mentioning that 18 species have been initially described from Greek habitats. The marine epilithic Ammatoidea aegea described from Saronikos Gulf is considered endemic to this area. Our bibliographic review shows that Greece hosts a high diversity of cyanobacteria, suggesting that the Mediterranean area is also a hot spot for microbes.

  10. Determination of the Glycogen Content in Cyanobacteria.

    Science.gov (United States)

    De Porcellinis, Alice; Frigaard, Niels-Ulrik; Sakuragi, Yumiko

    2017-07-17

    Cyanobacteria accumulate glycogen as a major intracellular carbon and energy storage during photosynthesis. Recent developments in research have highlighted complex mechanisms of glycogen metabolism, including the diel cycle of biosynthesis and catabolism, redox regulation, and the involvement of non-coding RNA. At the same time, efforts are being made to redirect carbon from glycogen to desirable products in genetically engineered cyanobacteria to enhance product yields. Several methods are used to determine the glycogen contents in cyanobacteria, with variable accuracies and technical complexities. Here, we provide a detailed protocol for the reliable determination of the glycogen content in cyanobacteria that can be performed in a standard life science laboratory. The protocol entails the selective precipitation of glycogen from the cell lysate and the enzymatic depolymerization of glycogen to generate glucose monomers, which are detected by a glucose oxidase-peroxidase (GOD-POD) enzyme coupled assay. The method has been applied to Synechocystis sp. PCC 6803 and Synechococcus sp. PCC 7002, two model cyanobacterial species that are widely used in metabolic engineering. Moreover, the method successfully showed differences in the glycogen contents between the wildtype and mutants defective in regulatory elements or glycogen biosynthetic genes.

  11. Spirulina platensis Extract Supplementation Attenuates Diabetic Complication in Gamma Irradiated Rats

    International Nuclear Information System (INIS)

    Ibrahim, R.M.; Sherif, N.H

    2014-01-01

    Diabetes mellitus, a metabolic disorder, is becoming a major health problem. Although there are a number of drugs available on the market, long time use may cause a number of side effects. Spirulina is a microscopic and filamentous cyanobacterium that contains essential amino acids, essential fatty acids, vitamins, minerals and anti-oxidative components. The objective of this study was to analyze the possible hypo glycemic and hypolipidaemic effects of Spirulina intake against streptozotocin and/or radiation induced diabetes in male albino rats. In the experiment, a total of 60 rats were used and the rats were divided into six groups of ten rats each: group I, normal untreated rats (control) ; group II, animals of this group received only Spirulina (15 mg/kg) for 30 consecutive days; group III, animals were injected intraperitoneally with a freshly prepared solution of streptozotocin(STZ) (45 mg/kg i.p.) in 0.1 M citrate buffer, ph 4.5 for 30 consecutive days ; group IV, as group II then given Spirulina for 30 days , group V, same as group III then exposed to 6 Gy gamma radiation as a single dose shot ; and group VI, Spirulina + diabetic irradiated group, rats were given orally Spirulina (15 mg/kg) then injected in - traperitoneally with (STZ) followed by irradiation at a dose level of 6 Gy as a single dose shot. The results revealed that animal treated with STZ or/and exposed to gamma radiation showed an increase in fasting blood sugar (FBS), glycosylated haemoglobin (HbA1c), total cholesterol (TC), triglyceride (Tg), low density lipoprotein (LDL), plasma insulin and C- peptide in compared to control. Also, a marked increase in the liver tissue of thiobarbituric acid reactive substance (TBARS) and a decrease in glutathione (GSH) and catalase (CAT) was observed. Oral pretreatment of rats with aqueous extract of Spirulina (SPE) counteracted STZ or/and radiation induced lipid peroxidation and encouraging hypoglycemic and hypolipidaemic properties of the treated

  12. Iron-Tolerant Cyanobacteria: Ecophysiology and Fingerprinting

    Science.gov (United States)

    Brown, I. I.; Mummey, D.; Lindsey, J.; McKay, D. S.

    2006-01-01

    Although the iron-dependent physiology of marine and freshwater cyanobacterial strains has been the focus of extensive study, very few studies dedicated to the physiology and diversity of cyanobacteria inhabiting iron-depositing hot springs have been conducted. One of the few studies that have been conducted [B. Pierson, 1999] found that cyanobacterial members of iron depositing bacterial mat communities might increase the rate of iron oxidation in situ and that ferrous iron concentrations up to 1 mM significantly stimulated light dependent consumption of bicarbonate, suggesting a specific role for elevated iron in photosynthesis of cyanobacteria inhabiting iron-depositing hot springs. Our recent studies pertaining to the diversity and physiology of cyanobacteria populating iron-depositing hot springs in Great Yellowstone area (Western USA) indicated a number of different isolates exhibiting elevated tolerance to Fe(3+) (up to 1 mM). Moreover, stimulation of growth was observed with increased Fe(3+) (0.02-0.4 mM). Molecular fingerprinting of unialgal isolates revealed a new cyanobacterial genus and species Chroogloeocystis siderophila, an unicellular cyanobacterium with significant EPS sheath harboring colloidal Fe(3+) from iron enriched media. Our preliminary data suggest that some filamentous species of iron-tolerant cyanobacteria are capable of exocytosis of iron precipitated in cytoplasm. Prior to 2.4 Ga global oceans were likely significantly enriched in soluble iron [Lindsay et al, 2003], conditions which are not conducive to growth of most contemporary oxygenic cyanobacteria. Thus, iron-tolerant CB may have played important physiological and evolutionary roles in Earths history.

  13. Grazing livestock are exposed to terrestrial cyanobacteria.

    Science.gov (United States)

    McGorum, Bruce C; Pirie, R Scott; Glendinning, Laura; McLachlan, Gerry; Metcalf, James S; Banack, Sandra A; Cox, Paul A; Codd, Geoffrey A

    2015-02-25

    While toxins from aquatic cyanobacteria are a well-recognised cause of disease in birds and animals, exposure of grazing livestock to terrestrial cyanobacteria has not been described. This study identified terrestrial cyanobacteria, predominantly Phormidium spp., in the biofilm of plants from most livestock fields investigated. Lower numbers of other cyanobacteria, microalgae and fungi were present on many plants. Cyanobacterial 16S rDNA, predominantly from Phormidium spp., was detected in all samples tested, including 6 plant washings, 1 soil sample and ileal contents from 2 grazing horses. Further work was performed to test the hypothesis that ingestion of cyanotoxins contributes to the pathogenesis of some currently unexplained diseases of grazing horses, including equine grass sickness (EGS), equine motor neuron disease (EMND) and hepatopathy. Phormidium population density was significantly higher on EGS fields than on control fields. The cyanobacterial neurotoxic amino acid 2,4-diaminobutyric acid (DAB) was detected in plant washings from EGS fields, but worst case scenario estimations suggested the dose would be insufficient to cause disease. Neither DAB nor the cyanobacterial neurotoxins β-N-methylamino-L-alanine and N-(2-aminoethyl) glycine were detected in neural tissue from 6 EGS horses, 2 EMND horses and 7 control horses. Phormidium was present in low numbers on plants where horses had unexplained hepatopathy. This study did not yield evidence linking known cyanotoxins with disease in grazing horses. However, further study is warranted to identify and quantify toxins produced by cyanobacteria on livestock fields, and determine whether, under appropriate conditions, known or unknown cyanotoxins contribute to currently unexplained diseases in grazing livestock.

  14. TAHLAB (SPIRULINA) AND FEW OTHER MEDICINAL PLANTS HAVING ANTI-OXIDANT & IMMUNOMODULATORY PROPERTIES DESCRIBED IN UNANI MEDICINE - A REVIEW

    OpenAIRE

    Md. Anzar Alam*, Nafis Haider , Shamim Ahmed , Md. Tanwir Alam and Abdul Azeez

    2013-01-01

    : Antioxidants are substances that may protect cells from the damage caused by unstable molecules known as free radicals; free radicals damage may lead to cancer and other diseases. Some of the example of antioxidants are like β-carotene, lycopene, Vit. C, E & A and other substances which are found in variety of fruits, vegetables, algae (spirulina) & other medicinal plants. Spirulina (Blue green algae) is a microscopic single cell alga which grows in fresh water and has a simple structure bu...

  15. Pão sem gluten enriquecido com a microalga Spirulina platensis Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Felipe da Silva Figueira

    2011-12-01

    Full Text Available Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha. Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães não sofreram alteração com a adição de até 4% da alga, porem mostraram redução de 22% nos valores de volume e aumento de 113% na dureza quando se adicionou-se 5% (em base de farinha. Quando comparados ao pão não enriquecido, a adição de Spiriulina platensis provocou uma melhoria da qualidade nutricional dos pães, confirmada pelo aumento significativo de 39,04% do conteúdo protéico, alem de vários aminoácidos essenciais (treonina, metionina, isoleucina e leucina. Com relação a cor, os pães com Spirulina apresentaram redução de luminosidade com o aumento de adição de microalga, sendo também observada tendência de aumento de tonalidade verde. Na avaliação sensorial, não se verificou diferença significativa quanto a preferência entre os pães adicionados com 3% e 5% de Spirulina na formulação.With the objective of offering a product for people with celiac disease, due to their gluten intolerance, gluten-free bread made with rice flour was elaborated, in substitution of the wheat flour. To increase the protein content of the bread, dried Spirulina platensis, a microalga, was added to the products in the range from 2 to 5% (flour basis. The bread samples were evaluated according to their specific volume (V/W, crumb hardness, measured with a texturometer, and the crumb color. It was shown that the specific volume and crumb hardness were not affected by the addition of up to 4% of alga, but a decrease of 22% in the

  16. Energy values and chemical composition of spirulina (Spirulina platensis evaluated with broilers Valores energéticos e composição química da espirulina (Spirulina platensis avaliada com frangos de corte

    Directory of Open Access Journals (Sweden)

    Renata Ribeiro Alvarenga

    2011-05-01

    Full Text Available The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis, the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME and the apparent metabolizable energy corrected for nitrogen balance (AMEn in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metabolic cages for 10 days, distributed in a completely randomized design, with three treatments and six repetitions with five birds each. Diets consisted on a reference-ration based on corn and soybean meal and two test diets, one containing spirulina (30% and the other one with soybean meal (30%. Spiruline was superior to soybean meal for contents of dry matter (DM, gross energy (9.60%, crude protein (26.56%, ether extract (54.45%, mineral matter (42.77%, calcium (100% and total phosphorus (130.77% and also for most amino acids, except lysine, glutamate, histidine and proline. Nevertheless, spiruline presented lower values of gross fiber (83.95%, acid detergent fiber (85.12% and neutral detergent fiber (6.15. The AME and AMEn values (kcal/kg of DM were, respectively, 2,906 and 2,502 for the spirulina and 2,646 and 2,340 for the soybean meal and AMEn of spirulina was 6.92% higher than soybean meal.Objetivou-se determinar a composição química e energética da espirulina (Spirulina platensis, os coeficientes de metabolizabilidade dos nutrientes e os valores de energia metabolizável aparente (EMA e aparente corrigida pelo balanço de nitrogênio (EMAn em frangos de corte. Realizou-se um ensaio de digestibilidade utilizando-se a metodologia de coleta total de excretas com 90 pintos machos da linhagem Cobb 500, com peso inicial de 256 ± 5 g aos 11 dias de idade. As aves foram alojadas em gaiolas de metabolismo durante dez dias, distribuídas em delineamento

  17. Electricity generation from digitally printed cyanobacteria.

    Science.gov (United States)

    Sawa, Marin; Fantuzzi, Andrea; Bombelli, Paolo; Howe, Christopher J; Hellgardt, Klaus; Nixon, Peter J

    2017-11-06

    Microbial biophotovoltaic cells exploit the ability of cyanobacteria and microalgae to convert light energy into electrical current using water as the source of electrons. Such bioelectrochemical systems have a clear advantage over more conventional microbial fuel cells which require the input of organic carbon for microbial growth. However, innovative approaches are needed to address scale-up issues associated with the fabrication of the inorganic (electrodes) and biological (microbe) parts of the biophotovoltaic device. Here we demonstrate the feasibility of using a simple commercial inkjet printer to fabricate a thin-film paper-based biophotovoltaic cell consisting of a layer of cyanobacterial cells on top of a carbon nanotube conducting surface. We show that these printed cyanobacteria are capable of generating a sustained electrical current both in the dark (as a 'solar bio-battery') and in response to light (as a 'bio-solar-panel') with potential applications in low-power devices.

  18. Pathological effects of cyanobacteria on sea fans in southeast Florida.

    Science.gov (United States)

    Kiryu, Y; Landsberg, J H; Peters, E C; Tichenor, E; Burleson, C; Perry, N

    2015-07-01

    In early August 2008, observations by divers indicated that sea fans, particularly Gorgonia ventalina, Gorgonia flabellum, and Iciligorgia schrammi, were being covered by benthic filamentous cyanobacteria. From August 2008 through January 2009 and again in April 2009, tissue samples from a targeted G. ventalina colony affected by cyanobacteria and from a nearby, apparently healthy (without cyanobacteria) control colony, were collected monthly for histopathological examination. The primary cellular response of the sea fan to overgrowth by cyanobacteria was an increase in the number of acidophilic amoebocytes (with their granular contents dispersed) that were scattered throughout the coenenchyme tissue. Necrosis of scleroblasts and zooxanthellae and infiltration of degranulated amoebocytes were observed in the sea fan surface tissues at sites overgrown with cyanobacteria. Fungal hyphae in the axial skeleton were qualitatively more prominent in cyanobacteria-affected sea fans than in controls. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Ionizing radiation and photosynthetic ability of cyanobacteria

    International Nuclear Information System (INIS)

    Agarwal, Rachna; Sainis, Jayashree K.

    2006-01-01

    Unicellular photoautotrophic cyanobacteria, Anacystis nidulans when exposed to lethal dose of 1.5 kGy of 60 Co γ- radiation (D 10 = 257.32 Gy) were as effective photosynthetical as unirradiated controls immediately after irradiation although level of ROS was higher by several magnitudes in these irradiated cells. The results suggested the preservation of the functional integrity of thylakoids even after exposure to lethal dose of ionizing radiation. (author)

  20. Light-dependent electrogenic activity of cyanobacteria.

    Directory of Open Access Journals (Sweden)

    John M Pisciotta

    2010-05-01

    Full Text Available Cyanobacteria account for 20-30% of Earth's primary photosynthetic productivity and convert solar energy into biomass-stored chemical energy at the rate of approximately 450 TW [1]. These single-cell microorganisms are resilient predecessors of all higher oxygenic phototrophs and can be found in self-sustaining, nitrogen-fixing communities the world over, from Antarctic glaciers to the Sahara desert [2].Here we show that diverse genera of cyanobacteria including biofilm-forming and pelagic strains have a conserved light-dependent electrogenic activity, i.e. the ability to transfer electrons to their surroundings in response to illumination. Naturally-growing biofilm-forming photosynthetic consortia also displayed light-dependent electrogenic activity, demonstrating that this phenomenon is not limited to individual cultures. Treatment with site-specific inhibitors revealed the electrons originate at the photosynthetic electron transfer chain (P-ETC. Moreover, electrogenic activity was observed upon illumination only with blue or red but not green light confirming that P-ETC is the source of electrons. The yield of electrons harvested by extracellular electron acceptor to photons available for photosynthesis ranged from 0.05% to 0.3%, although the efficiency of electron harvesting likely varies depending on terminal electron acceptor.The current study illustrates that cyanobacterial electrogenic activity is an important microbiological conduit of solar energy into the biosphere. The mechanism responsible for electrogenic activity in cyanobacteria appears to be fundamentally different from the one exploited in previously discovered electrogenic bacteria, such as Geobacter, where electrons are derived from oxidation of organic compounds and transported via a respiratory electron transfer chain (R-ETC [3], [4]. The electrogenic pathway of cyanobacteria might be exploited to develop light-sensitive devices or future technologies that convert solar

  1. Adventures with cyanobacteria: a personal perspective

    Directory of Open Access Journals (Sweden)

    Govindjee e

    2011-07-01

    Full Text Available Cyanobacteria, or the blue-green algae as they used to be called until 1974, are the oldest oxygenic photosynthesizers. We summarize here adventures with them since the early 1960s. This includes studies on light absorption by cyanobacteria, excitation energy transfer at room temperature down to liquid helium temperature, fluorescence (kinetics as well as spectra and its relationship to photosynthesis, and afterglow (or thermoluminescence from them. Further, we summarize experiments on their two-light reaction - two-pigment system, as well as the unique role of bicarbonate (hydrogen carbonate on the electron acceptor side of their photosystem II, PSII. This review, in addition, includes a discussion on the regulation of changes in phycobilins (mostly in PSII and chlorophyll a (Chl a; mostly in photosystem I, PSI under oscillating light, on the relationship of the slow fluorescence increase (the so-called S to M rise, especially in the presence of diuron in minute time scale with the so-called state-changes, and on the possibility of limited oxygen evolution in mixotrophic PSI (minus mutants, up to 30 minutes, in the presence of glucose. We end this review with a brief discussion on the position of cyanobacteria in the evolution of photosynthetic systems.

  2. Cyanobacteria and cyanotoxins in freshwaters of Uruguay

    Directory of Open Access Journals (Sweden)

    Sylvia Bonilla

    2015-12-01

    Full Text Available Cyanobacterial blooms are a worldwide environmental problem. This phenomenon is typically associated with eutrophication (nutrient enrichment and changes in hydrology. In this study we analysed the distribution of planktonic cyanobacteria in Uruguay and their toxins (microcystin, saxitoxin and cylindrospermopsin, working with an interagency team (OSE, DINAMA, IM, University of the Republic and IIBCE. An historical data base (n = 3061 for 64 ecosystems, years 1980-2014 was generated. Differences between lotic and lentic ecosystems were found in terms of chlorophyll a and nutrient concentrations, usually indicating eutrophication. Two geo-referenced maps for the country were generated with cyanobacteria biomass indicators and the most relevant toxin (microcystin, according to risk levels suggested by the World Health Organization for recreational waters. The areas of greatest risk of exposure were the reservoirs of large rivers (Uruguay and Río Negro and Río de la Plata beaches. In the second part of the study, up to 20 mg L-1of microcystin was quantified in bloom (scum samples, as well as the presence of genes that suggest more microcystin varieties, potentially with greater toxicity. This study provides basic information about the distribution of cyanobacteria in Uruguayan freshwaters that will be useful for national monitoring programs and scientific research.

  3. Genetic engineering of cyanobacteria as biodiesel feedstock.

    Energy Technology Data Exchange (ETDEWEB)

    Ruffing, Anne.; Trahan, Christine Alexandra; Jones, Howland D. T.

    2013-01-01

    Algal biofuels are a renewable energy source with the potential to replace conventional petroleum-based fuels, while simultaneously reducing greenhouse gas emissions. The economic feasibility of commercial algal fuel production, however, is limited by low productivity of the natural algal strains. The project described in this SAND report addresses this low algal productivity by genetically engineering cyanobacteria (i.e. blue-green algae) to produce free fatty acids as fuel precursors. The engineered strains were characterized using Sandias unique imaging capabilities along with cutting-edge RNA-seq technology. These tools are applied to identify additional genetic targets for improving fuel production in cyanobacteria. This proof-of-concept study demonstrates successful fuel production from engineered cyanobacteria, identifies potential limitations, and investigates several strategies to overcome these limitations. This project was funded from FY10-FY13 through the President Harry S. Truman Fellowship in National Security Science and Engineering, a program sponsored by the LDRD office at Sandia National Laboratories.

  4. Metabolic engineering tools in model cyanobacteria.

    Science.gov (United States)

    Carroll, Austin L; Case, Anna E; Zhang, Angela; Atsumi, Shota

    2018-03-26

    Developing sustainable routes for producing chemicals and fuels is one of the most important challenges in metabolic engineering. Photoautotrophic hosts are particularly attractive because of their potential to utilize light as an energy source and CO 2 as a carbon substrate through photosynthesis. Cyanobacteria are unicellular organisms capable of photosynthesis and CO 2 fixation. While engineering in heterotrophs, such as Escherichia coli, has result in a plethora of tools for strain development and hosts capable of producing valuable chemicals efficiently, these techniques are not always directly transferable to cyanobacteria. However, recent efforts have led to an increase in the scope and scale of chemicals that cyanobacteria can produce. Adaptations of important metabolic engineering tools have also been optimized to function in photoautotrophic hosts, which include Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)-Cas9, 13 C Metabolic Flux Analysis (MFA), and Genome-Scale Modeling (GSM). This review explores innovations in cyanobacterial metabolic engineering, and highlights how photoautotrophic metabolism has shaped their development. Copyright © 2018 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  5. Advances in Metabolic Engineering of Cyanobacteria for Photosynthetic Biochemical Production

    OpenAIRE

    Lai, Martin C.; Lan, Ethan I.

    2015-01-01

    Engineering cyanobacteria into photosynthetic microbial cell factories for the production of biochemicals and biofuels is a promising approach toward sustainability. Cyanobacteria naturally grow on light and carbon dioxide, bypassing the need of fermentable plant biomass and arable land. By tapping into the central metabolism and rerouting carbon flux towards desirable compound production, cyanobacteria are engineered to directly convert CO2 into various chemicals. This review discusses the d...

  6. Teores de β-caroteno em suplementos e biomassa de Spirulina Contents of β-carotene in supplements and biomass of Spirulina

    Directory of Open Access Journals (Sweden)

    Daniel Barroso de Alencar

    2011-04-01

    Full Text Available A cianobactéria Spirulina tem sido utilizada há séculos, tendo em vista suas propriedades nutricionais e medicinais. Neste trabalho, objetivou-se analisar os teores de β-caroteno tanto em suplementos alimentares a base de Spirulina comercializados em estabelecimentos de produtos naturais no mercado varejista, quanto em S. platensis cultivada em laboratório. Alguns pigmentos carotenóides possuem atividade de vitamina A e, dentre eles, o β-caroteno é o que apresenta maior atividade biológica. A extração de β-caroteno foi feita com metanol:água (90:10 v/v, seguida de saponificação e partição em n-hexano. As análises cromatográficas foram realizadas em coluna Waters Spherisorb S5 ODS 2 (4,6 x 250 mm, usando metanol:tetrahidrofurano (90:10, v/v bombeado a 2 mL min-1, com registro dos cromatogramas em 450 nm. Os suplementos alimentares a base de Spirulina apresentaram baixos teores de β-caroteno. A maior concentração foi encontrada em S. platensis cultivada a 24º C com fotoperíodo de 16 h claro e 8 h escuro. Considerando sua atividade provitamínica, os teores de retinol equivalente (RE nas microalgas analisadas no presente trabalho foram calculados a partir do β-caroteno para classificá-las como fonte excelente ou fonte útil de vitamina A.Spirulina is a cyanobacterium that has been used for several centuries due to its nutritional and medicinal properties. This work has evaluated the contents of β-carotene both in Spirulina commercialized as food supplement, purchased from natural product shops, and in S. platensis reared under laboratory conditions. Some carotenoids exhibit pro-vitamin A activity, and β-carotene presents the greatest biological activity. β-Carotene of microalgae was extracted in 90% aqueous methanol. These extracts were saponified and partitioned in n-hexane. Chromatographic analyses were carried out in a Spherisorb column S5 ODS 2 (4.6 x 250 mm, with a mobile phase of methanol:tetrahydrofuran (90:10, v

  7. A Review Study on Macrolides Isolated from Cyanobacteria.

    Science.gov (United States)

    Wang, Mengchuan; Zhang, Jinrong; He, Shan; Yan, Xiaojun

    2017-04-26

    Cyanobacteria are rich sources of structurally-diverse molecules with promising pharmacological activities. Marine cyanobacteria have been proven to be true producers of some significant bioactive metabolites from marine invertebrates. Macrolides are a class of bioactive compounds isolated from marine organisms, including marine microorganisms in particular. The structural characteristics of macrolides from cyanobacteria mainly manifest in the diversity of carbon skeletons, complexes of chlorinated thiazole-containing molecules and complex spatial configuration. In the present work, we systematically reviewed the structures and pharmacological activities of macrolides from cyanobacteria. Our data would help establish an effective support system for the discovery and development of cyanobacterium-derived macrolides.

  8. Proteomic analysis of post translational modifications in cyanobacteria.

    Science.gov (United States)

    Xiong, Qian; Chen, Zhuo; Ge, Feng

    2016-02-16

    Cyanobacteria are a diverse group of Gram-negative bacteria and the only prokaryotes capable of oxygenic photosynthesis. Recently, cyanobacteria have attracted great interest due to their crucial roles in global carbon and nitrogen cycles and their ability to produce clean and renewable biofuels. To survive in various environmental conditions, cyanobacteria have developed a complex signal transduction network to sense environmental signals and implement adaptive changes. The post-translational modifications (PTMs) systems play important regulatory roles in the signaling networks of cyanobacteria. The systematic investigation of PTMs could contribute to the comprehensive description of protein species and to elucidate potential biological roles of each protein species in cyanobacteria. Although the proteomic studies of PTMs carried out in cyanobacteria were limited, these data have provided clues to elucidate their sophisticated sensing mechanisms that contribute to their evolutionary and ecological success. This review aims to summarize the current status of PTM studies and recent publications regarding PTM proteomics in cyanobacteria, and discuss the novel developments and applications for the analysis of PTMs in cyanobacteria. Challenges, opportunities and future perspectives in the proteomics studies of PTMs in cyanobacteria are also discussed. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Optical propagation analysis in photobioreactor measurements on cyanobacteria

    Science.gov (United States)

    Fanjul-Vélez, F.; Arce-Diego, J. L.

    2017-12-01

    Biotechnology applications are nowadays increasing in many areas, from agriculture to biochemistry, or even biomedicine. Knowledge on biological processes is becoming essential in order to be able to adequately estimate and control the production of these elements. Cyanobacteria present the capability of producing oxygen and biomass, from CO2 and light irradiation. Therefore, they could be fundamental for human subsistence in adverse environments, as basic needs of breathing and food would be guaranteed. Cyanobacteria cultivation, as other microorganisms, is carried out in photo-bioreactors. The adequate design of photobioreactors greatly influences elements production throughput. This design includes optical illumination and optical measurement of cyanobacteria growth. In this work an analysis of optical measurement of cyanobacteria growth in a photobioreactor is made. As cyanobacteria are inhomogeneous elements, the influence of light scattering is significant. Several types of cyanobacteria are considered, as long as several spatial profiles and irradiances of the incident light. Depending on cyanobacteria optical properties, optical distribution of transmitted light can be estimated. These results allow an appropriate consideration, in the optical design, of the relationship between detected light and cyanobacteria growth. As a consequence, the most adequate conditions of elements production from cyanobacteria could be estimated.

  10. Cyanobacteria toxins in the Salton Sea.

    Science.gov (United States)

    Carmichael, Wayne W; Li, RenHui

    2006-04-19

    The Salton Sea (SS) is the largest inland body of water in California: surface area 980 km2, volume 7.3 million acre-feet, 58 km long, 14-22 km wide, maximum depth 15 m. Located in the southeastern Sonoran desert of California, it is 85 m below sea level at its lowest point. It was formed between 1905 and 1907 from heavy river flows of the Colorado River. Since its formation, it has attracted both people and wildlife, including flocks of migratory birds that have made the Salton Sea a critical stopover on the Pacific flyway. Over the past 15 years wintering populations of eared grebe (Podiceps nigricollis) at the Salton Sea, have experienced over 200,000 mortalities. The cause of these large die-offs remains unknown. The unique environmental conditions of the Salton Sea, including salinities from brackish freshwater at river inlets to hypersaline conditions, extreme daily summer temperatures (>38 degrees C), and high nutrient loading from rivers and agricultural drainage favor eutrophic conditions that encourage algal blooms throughout the year. A significant component of these algal blooms are the prokaryotic group - the Cyanophyta or blue-green algae (also called Cyanobacteria). Since many Cyanobacteria produce toxins (the cyanotoxins) it became important to evaluate their presence and to determine if they are a contributing factor in eared-grebe mortalities at the Salton Sea. From November 1999 to April 2001, 247 water and sediment samples were received for phytoplankton identification and cyanotoxin analyses. Immunoassay (ELISA) screening of these samples found that eighty five percent of all water samples contained low but detectable levels of the potent cyclic peptide liver toxin called microcystins. Isolation and identification of cyanobacteria isolates showed that the picoplanktonic Synechococcus and the benthic filamentous Oscillatoria were dominant. Both organisms were found to produce microcystins dominated by microcystin-LR and YR. A laboratory strain

  11. Biomass of Spirulina maxima enriched by biosorption process as a new feed supplement for swine.

    Science.gov (United States)

    Saeid, A; Chojnacka, K; Korczyński, M; Korniewicz, D; Dobrzański, Z

    2013-04-01

    This paper deals with the new mineral feed additives with Cu produced in a biosorption process from a semi-technical scale. The natural biomass of edible microalga Spirulina sp. was enriched with Cu(II) and then used as a mineral supplement in feeding experiments on swine to assess its nutrition properties. A total of 24 piglets divided into two groups (control and experimental) were used to determine the bioavailability of a new generation of mineral feed additives based on Spirulina maxima . The control group was feed using traditional inorganic supplements of microelements, while the experimental group was fed with the feed containing the biomass of S. maxima enriched with Cu by biosorption. The apparent absorption was 30 % ( P  maxima -is a promising alternative to currently used inorganic salts as the source of nutritionally important microelements.

  12. Production of Generation-2 Mekong giant catfish (Pangasinodon gigas cultured with Spirulina sp.

    Directory of Open Access Journals (Sweden)

    Kriangsak Meng-umphan

    2008-11-01

    Full Text Available The purpose of this study is to evaluate the treatment of Spirulina-supplemented pellet feed to 5-year-old F1 groups of Mekong giant catfish (Pangasinodon gigas from the brood stock and intended for use as breeders. The effects on their growth and maturation when cultured in an earthen pond were observed. Results revealed that, compared to control, there was more gain in weight while the feed conversion ratio was lower. The number of red blood cells was also higher while that of white blood cells was lower, compared to control. Out of 18 treated fish (9 males and 9 females, 6 males and 2 females gave sperms and eggs while none from control group did. It was concluded that Spirulina supplemented in pellet feed can improve growth and maturation performance to the brood stock of Mekong giant catfish.

  13. Growth performance and nutrition value of Spirulina sp. under different photoperiod

    Directory of Open Access Journals (Sweden)

    Tatag Budiardi

    2010-07-01

    Full Text Available This study was conducted to analyze the production of freshwater Spirulina sp. cultured with photoperiod manipulation treatment. In this study, photoperiod manipulation treatment performed on cultured spirulina using fiber tanks (100 L. Spirulina was grown with different photoperiod (bright/T and dark/G that are six hours per day (6T-18G, 12 hours per day (12T-12G, 18 hours per day (18T-6G, and 24 hours per day (24L-0G. The parameters were observed include dry biomass, population density (N, specific growth rate (SGR, doubling time (G, proximate analysis, and water quality. The results of this study showed that the optimum population density was achieved on day-3 days of cultured, and manipulation photoperiod showed no significant effect to the dry biomass harvest and population density, but significantly affect the specific growth rate and doubling time. Treatment of lighting 12, 18 and 24 hours per day to produce the maximum specific growth rate (0,345 to 0,366 per day and a maximum doubling time (1,89 to 2,01 days were not significantly different, whereas the old treatment six hours per day lighting showed the lowest maximum growth rate (0,323 per day and highest doubling time (2,15 days. At treatment of lighting 12 hours per day, relatively higher protein content (39,73% than others. In conclusion, the lighting 12 hours per day resulted in optimum production efficiency than other treatments.Keywords: Spirulina sp., photoperiod, density, biomass, growth, nutrition value. ABSTRAKPenelitian ini dilakukan untuk menganalisis produksi spirulina Spirulina sp. air tawar yang dikultur dengan manipulasi fotoperiode.  Dalam penelitian ini, spirulina dikultur dalam wadah fiber 100 L dengan perlakuan fotoperiode (terang/T dan gelap/G berbeda, yaitu enam jam per hari (6T-18G, 12 jam per hari (12T-12G, 18 jam per hari (18T-6G, dan 24 jam per hari (24T-0G. Parameter yang diamati meliputi biomassa kering, kepadatan populasi (N, laju pertumbuhan spesifik

  14. The Role of Gamma Irradiation on Growth and Some Metabolic Activities of Spirulina platensis

    International Nuclear Information System (INIS)

    Moussa, H.R.; El-Shaer, E.A.; Ismaiel, M.M.S.; Shabana, E.F.; Gabr, M.A.

    2015-01-01

    Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same trend for phycobiliproteins fractions. The photosynthetic activity and total carbohydrate content of the irradiated Spirulina cells increased with elevating the doses of gamma irradiation and reached a maximum value at a dose of 2.0 kGy as compared to the control. The activity of ribulose-1,5-bisphosphate-carboxylase/oxygenase (RUBISCO) was increased up to irradiation dose of 2.0 kGy. whereas, the maximum activity of the phosphoenol pyruvate carboxylase (PEPCASE) was recorded at the irradiation dose of 1.0 kGy Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same

  15. Evaluation of anaerobic digestates from different feedstocks as growth media for Tetradesmus obliquus, Botryococcus braunii, Phaeodactylum tricornutum and Arthrospira maxima.

    Science.gov (United States)

    Massa, Marina; Buono, Silvia; Langellotti, Antonio Luca; Castaldo, Luigi; Martello, Anna; Paduano, Antonello; Sacchi, Raffaele; Fogliano, Vincenzo

    2017-05-25

    In this paper, two freshwater microalgae (Tetradesmus obliquus and Botryococcus braunii), a marine diatom (Phaeodactylum tricornutum) and a photosynthetic cyanobacterium (Arthrospira maxima) were investigated for their ability to grow on liquid digestates (LDs). Three LDs were obtained from anaerobic digestion of different organic wastes: zootechnical (ZW LD), vegetable biomass (VW LD) and the organic fraction of municipal solid wastes (MW LD). All the strains showed the same growth performance on VW LD as on the respective standard media (SM), while ZW LD was efficient only for growth of T. obliquus and B. braunii. MW LD was the poorest growth medium for all the strains. Data on nutrient removal efficiency showed that A. maxima and T. obliquus made the best use of NH 4 + -N with removal values ranging between 98.9-99.8%, while P. tricornutum and B. braunii showed values of 79.0 and 88.5% respectively. Applying repeated batch cultivation in photobioreactors, the biochemical composition of A. maxima and T. obliquus biomass grown on ZW LD and VW LD, showed an increase of lipid, carbohydrates and ash in both microalgae. Biomass biochemical profiles suggest possible applications in feed, chemicals and energy sectors. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Evaluation of the integrated hydrothermal carbonization-algal cultivation process for enhanced nitrogen utilization in Arthrospira platensis production.

    Science.gov (United States)

    Yao, Changhong; Wu, Peichun; Pan, Yanfei; Lu, Hongbin; Chi, Lei; Meng, Yingying; Cao, Xupeng; Xue, Song; Yang, Xiaoyi

    2016-09-01

    Sustainable microalgal cultivation at commercial scale requires nitrogen recycling. This study applied hydrothermal carbonization to recover N of hot-water extracted Arthrospira platensis biomass residue into aqueous phase (AP) under different operation conditions and evaluated the N utilization, biomass yield and quality of A. platensis cultures using AP as the sole N source. With the increase of temperature at 190-210°C or reaction time of 2-3h, the N recovery rate decreased under nitrogen-repletion (+N) cultivation, while contrarily increased under nitrogen-limitation (-N) cultivation. Under +N biomass accumulation in the cultures with AP under 190°C was enhanced by 41-67% compared with that in NaNO3, and the highest protein content of 51.5%DW achieved under 200°C-2h was also 22% higher. Carbohydrate content of 71.4%DW under -N cultivation achieved under 210°C-3h was 14% higher than that in NaNO3. HTC-algal cultivation strategy under -N mode could save 60% of conventional N. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Influence of Spirulina platensis exudates on the endocrine and nervous systems of a mammalian model

    OpenAIRE

    Samah M.M. Fathy; Ashraf M.M. Essa

    2015-01-01

    Objective: To investigate the effect of intra-peritoneal injection of purified exudates of axenic Spirulina platensis on the mammalian endocrine and nervous systems. Methods: The intra-peritoneal injection of the cyanobacterial exudates in mice was applied. Sex hormonal levels of testosterone and progesterone were measured using radioimmunoassay while the follicular stimulating hormone and luteinizing hormone were evaluated by direct chemiluminescence. In addition, superoxide dismutase, ca...

  18. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    OpenAIRE

    Liliana CEPOI; Ludmila RUDI; Vera MISCU; Angela COJOCARI; Tatiana CHIRIAC; Daniela SADOVNIC

    2009-01-01

    The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC), radical-scavenging activity by DPPH ...

  19. Spirulina sp. LEB-18 culture using effluent from the anaerobic digestion

    Directory of Open Access Journals (Sweden)

    J. A. Borges

    2013-06-01

    Full Text Available The carbon source is the most expensive nutrient for Spirulina production; effluents from anaerobic digestion contain this nutrient in the form of HCO3-. The aim of this study was to assess the growth kinetics, composition and fatty acid profile of Spirulina sp. LEB-18 grown in standard Zarrouk medium (NaHCO3 16.8 g L-1 and in Zarrouk medium replaced with 20% (v/v effluent with reduced concentrations of NaHCO3 (5.3 and 2.8 g L-1. The use of effluent and lower concentrations of HCO3 was found to be an alternative to reduce the costs of Spirulina production, because there were no significant differences in growth parameters (µmax 0.324 - 0.354 d-1; Pmax 0.280 - 0.297 g L-1 d-1, in the different culture medium used. Lipids ranged between 4.9 and 5.0%; the media with effluent had higher levels of linoleic acid compared to the standard medium.

  20. Protective Role of Spirulina on Gamma Rays Induced Haematological and Biochemical Disorders in Mice

    International Nuclear Information System (INIS)

    Ibrahim, R.M.; Kamal El-Dein, E.M.

    2014-01-01

    The present study reports the haematological and biochemical protective effect of Salipriina on Swiss albino mice exposed to gamma radiation. Swiss albino mice (8 weeks old) were administered intraperitoneally Sanepil (800 mg/kg b.wt.) prior to whole body gamma-irradiation (7.5 Gy). Radiation exposure resulted in a significant decline in different bone marrow cells (pro-and normoblasts) and blood constituents (erythrocytes, leukocytes, differential leukocyte count, haematocrit,haemoglobin and erythrocyte sedimentation rate). Pro- and normoblasts, erythrocytes, leukocytes, haematocrit and haemoglobin values showed a significant (p<0.05) decline during the first 3 days, followed by a gradual recovery starting from day 7, but normal values were not recorded until 14 days post-exposure. Treatment of mice with Spirulina also caused a significant decrease in malondialdehyde (MDA) formation in the liver, suggesting its role in protection against radiation induced membrane and cellular damage. Similarly, pretreatment of mice with Spirulina caused a significant increase in serum glutathione (GSH) level in comparison with that of irradiated animals. Results suggest that Spirulina modulate the radiation induced hematological and biochemical alterations in Swiss albino mice

  1. Spirulina platensis feeding inhibited the anemia- and leucopenia-induced lead and cadmium in rats

    Energy Technology Data Exchange (ETDEWEB)

    Simsek, Nejdet [University of Atatuerk, Faculty of Veterinary Medicine, Department of Histology and Embryology, 25700 Erzurum (Turkey); Karadeniz, Ali, E-mail: karadenizali@gmail.com [University of Atatuerk, Faculty of Veterinary Medicine, Department of Physiology, 25700 Erzurum (Turkey); Kalkan, Yildiray; Keles, Osman N.; Unal, Buenyami [University of Atatuerk, Faculty of Medicine, Department of Histology and Embryology, 25240 Erzurum (Turkey)

    2009-05-30

    In the present investigation, the effect of Spirulina platensis (Sp) was undertaken on rats fed with lead and cadmium including diet by using physiological, enzymehistochemical and stereological methods. For this aim, 50 rats were equally divided into five groups as control (C), lead (Pb), Spirulina + lead (Sp + Pb), cadmium (Cd), and Spirulina + cadmium (Sp + Cd). Red blood cell (RBC) and white blood cell (WBC) counts, packed cell volume (PCV), and haemoglobine (Hb) concentrations were determined by haemocytometric methods in blood samples collected on 30th day. Population of T lymphocyte was counted by the {alpha}-naphthyl acetate esterase (ANAE) staining method, and reticulocytes were counted by stereological method. The counts of RBC, WBC, and ANAE positive T lymphocyte, and the values of Hb, PCV, and MCHC were decreased in the Pb and Cd groups compared to control group. Also, the number of reticulocytes (polychromatofilic erythrocyte) increased in the Pb groups, whereas it decreased in the Cd group. On the other hand, these values were ceased by S. platensis in the treated groups. These results suggest that S. platensis supplementation may be useful in adjuvant treatment of leukemia and anemia caused by lead and cadmium toxication.

  2. Biosorption of Microelements by Spirulina: Towards Technology of Mineral Feed Supplements

    Science.gov (United States)

    Chojnacka, Katarzyna

    2014-01-01

    Surface characterization and metal ion adsorption properties of Spirulina sp. and Spirulina maxima were verified by various instrumental techniques. FTIR spectroscopy and potentiometric titration were used for qualitative and quantitative determination of metal ion-binding groups. Comparative FTIR spectra of natural and Cu(II)-treated biomass proved involvement of both phosphoryl and sulfone groups in metal ions sorption. The potentiometric titration data analysis provided the best fit with the model assuming the presence of three types of surface functional groups and the carboxyl group as the major binding site. The mechanism of metal ions biosorption was investigated by comparing the results from multielemental analyses by ICP-OES and SEM-EDX. Biosorption of Cu(II), Mn(II), Zn(II), and Co(II) ions by lyophilized Spirulina sp. was performed to determine the metal affinity relationships for single- and multicomponent systems. Obtained results showed the replacement of naturally bound ions: Na(I), K(I), or Ca(II) with sorbed metal ions in a descending order of Mn(II) > Cu(II) > Zn(II) > Co(II) for single- and Cu(II) > Mn(II) > Co(II) > Zn(II) for multicomponent systems, respectively. Surface elemental composition of natural and metal-loaded material was determined both by ICP-OES and SEM-EDX analysis, showing relatively high value of correlation coefficient between the concentration of Na(I) ions in algal biomass. PMID:25386594

  3. Biosorption characteristics of Spirulina and Chlorella cells to accumulate heavy metals

    Directory of Open Access Journals (Sweden)

    Kőnig-Péter Anikó

    2015-01-01

    Full Text Available The heavy metal biosorption of dried Chlorella vulgaris and Spirulina platensis-Spirulina maxima cells was studied under various experimental conditions. The effect of biosorbent dosage, pH, adsorption time, temperature, initial metal concentration on biosorption was studied. Biosorption process can be divided into two parts: the first part follows zero-order, the second part pseudo second-order kinetics. Characterization of biosorption equilibrium was evaluated with Langmuir and Dubinin-Radushkevich models using non-linear regression. The optimum pH range was found to be 5.0 − 6.0 for Pb(II and 4.0 − 6.0 for Cu(II and Cd(II adsorption. The maximum adsorption capacities for Pb(II, Cd(II and Cu(II were 144, 161 and 138 mg g-1 by Chlorella cells and 370, 201 and 165 by Spirulina cells, based on the experimental data. The same values for activated carbon were 86, 134 and 43 mg g-1, respectively.

  4. Endosymbiotic heterocystous cyanobacteria synthesize different heterocyst glycolipids than free-living heterocystous cyanobacteria

    NARCIS (Netherlands)

    Schouten, S.; Villareal, T.A.; Hopmans, E.C.; Mets, A.; Swanson, K.M.; Sinninghe Damsté, J.S.

    2013-01-01

    The heterocysts of limnetic nitrogen-fixing filamentous cyanobacteria contain unique glycolipids in their cell wall that create the distinctive gas impermeability of the heterocyst cell wall as well as serve as biomarker lipids for these microbes. It has been assumed that marine free-living and

  5. Oxygen and temperature in relation to nitrogen fixation in cyanobacteria: In the daily life of cyanobacteria

    NARCIS (Netherlands)

    Compaoré, J.

    2010-01-01

    The results described in this thesis reveal that unicellular diazotrophic cyanobacteria are unable to fix N2 under fully aerobic conditions. This suggests that in their natural environment these organisms must be exposed to O2 concentrations well below air saturation at least during the periods that

  6. Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae

    NARCIS (Netherlands)

    Wijffels, R.H.; Kruse, O.; Hellingwerf, K.J.

    2013-01-01

    Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments.Cyanobacteria are promising host organisms for

  7. Diversity and dynamics of potentially toxic cyanobacteria and their ...

    African Journals Online (AJOL)

    Bloom–forming freshwater cyanobacteria pose human and livestock health problems due to their ability to produce toxins and other bioactive compounds. Some non-toxic cyanobacteria accumulate as buoyant surface dwelling scums and thick mats which affect the benthic fauna by degrading aquatic habitats and giving ...

  8. Baltic cyanobacteria- A source of biologically active compounds

    Digital Repository Service at National Institute of Oceanography (India)

    Mazur-Marzec, H.; Błaszczyk, A.; Felczykowska, A.; Hohlfeld, N.; Kobos, J.; Toruńska-Sitarz, A.; PrabhaDevi; Montalva`o, S.; DeSouza, L.; Tammela, P.; Mikosik, A.; Bloch, S.; Nejman-Faleńczyk, B.; Węgrzyn, G.

    cyanobacteria, enzyme activity, enzyme inhibitors, immunological activity, natural products, nonribosomal peptides, plant growth regulators 2 INTRODUCTION Cyanobacteria are Gram-negative bacteria which are widely distributed in many water bodies..., immunological, 4 antimicrobial and plant growth tests. The overall aim of the experiments was to identify strains showing the most promising biological activity for potential biotechnological application. MATERIALS AND METHODS Isolation, culture...

  9. Human Health and Toxic Cyanobacteria – What do we know?

    Science.gov (United States)

    Human Health and Toxic Cyanobacteria – What do we know?Elizabeth D. HilbornWarm, eutrophic surface water systems support the development of toxic cyanobacteria blooms in North Carolina and worldwide. These conditions are increasing with expanding human populations and clima...

  10. Association of non-heterocystous cyanobacteria with crop plants

    NARCIS (Netherlands)

    Ahmed, M.; Stal, L.J.; Hasnain, S.

    2010-01-01

    Cyanobacteria have the ability to form associations with organisms from all domains of life, notably with plants, which they provide with fixed nitrogen, among other substances. This study was aimed at developing artificial associations between non-heterocystous cyanobacteria and selected crop

  11. Light scattering influence in cyanobacteria suspensions inside a photobioreactor

    Science.gov (United States)

    Fanjul-Vélez, F.; Arce-Diego, J. L.

    2018-02-01

    The application of biotechnology is increasing in areas such as agriculture, biochemistry or biomedicine. Growing bacteria or algae could be beneficial for supplying fuel, drugs, food or oxygen, among other products. An adequate knowledge of biological processes is becoming essential to estimate and control products production. Cyanobacteria are particularly appropriate for producing oxygen and biomass, by consuming mainly carbon dioxide and light irradiation. These capacities could be employed to provide human subsistence in adverse environments, as basic breathing and food needs would be satisfied. Cyanobacteria growing is carried out in bioreactors. As light irradiation is quite relevant for their behavior, photobioreactors are needed. Photobioreactors are designed to supply and control the amounts of elements they need, in order to maximize growth. The adequate design of photobioreactors greatly influences production throughput. This design includes, on the optical side, optical illumination and optical measurement of cyanobacteria growth. The influence of optical scattering is fundamental for maximizing cyanobacteria growing, as long as for adequately measure this growth. In this work, optical scattering in cyanobacteria suspensions is analyzed. Optical properties of cyanobacteria and its relationship with concentration is taken into account. Several types of cyanobacteria are considered. The influence of different beam spatial profiles and irradiances is studied by a Monte Carlo approach. The results would allow the consideration of the influence of optical scattering in the detected optical signal employed for growth monitoring, as a function of cyanobacteria type and optical beam parameters.

  12. Cyanobacteria species identified in the Weija and Kpong reservoirs ...

    African Journals Online (AJOL)

    The Kpong and Weija reservoirs supply drinking water to Accra, Ghana. This study was conducted to identify the cyanobacteria present in these reservoirs and to ascertain whether current treatment processes remove whole cyanobacteria cells from the drinking water produced. Cyanotoxins are mostly cell bound and could ...

  13. Genes, Genomes, and Assemblages of Modern Anoxygenic Photosynthetic Cyanobacteria as Proxies for Ancient Cyanobacteria

    Science.gov (United States)

    Grim, S. L.; Dick, G.

    2015-12-01

    Oxygenic photosynthetic (OP) cyanobacteria were responsible for the production of O2 during the Proterozoic. However, the extent and degree of oxygenation of the atmosphere and oceans varied for over 2 Ga after OP cyanobacteria first appeared in the geologic record. Cyanobacteria capable of anoxygenic photosynthesis (AP) may have altered the trajectory of oxygenation, yet the scope of their role in the Proterozoic is not well known. Modern cyanobacterial populations from Middle Island Sinkhole (MIS), Michigan and a handful of cultured cyanobacterial strains, are capable of OP and AP. With their metabolic versatility, these microbes may approximate ancient cyanobacterial assemblages that mediated Earth's oxygenation. To better characterize the taxonomic and genetic signatures of these modern AP/OP cyanobacteria, we sequenced 16S rRNA genes and conducted 'omics analyses on cultured strains, lab mesocosms, and MIS cyanobacterial mat samples collected over multiple years from May to September. Diversity in the MIS cyanobacterial mat is low, with one member of Oscillatoriales dominating at all times. However, Planktothrix members are more abundant in the cyanobacterial community in late summer and fall. The shift in cyanobacterial community composition may be linked to seasonally changing light intensity. In lab mesocosms of MIS microbial mat, we observed a shift in dominant cyanobacterial groups as well as the emergence of Chlorobium, bacteria that specialize in AP. These shifts in microbial community composition and metabolism are likely in response to changing environmental parameters such as the availability of light and sulfide. Further research is needed to understand the impacts of the changing photosynthetic community on oxygen production and the entire microbial consortium. Our study connects genes and genomes of AP cyanobacteria to their environment, and improves understanding of cyanobacterial metabolic strategies that may have shaped Earth's redox evolution.

  14. Cyanobacteria as a platform for biofuel production

    Directory of Open Access Journals (Sweden)

    Nicole E Nozzi

    2013-09-01

    Full Text Available Cyanobacteria have great potential as a platform for biofuel production because of their fast growth, ability to fix carbon dioxide gas, and their genetic tractability. Furthermore they do not require fermentable sugars or arable land for growth and so competition with cropland would be greatly reduced. In this perspective we discuss the challenges and areas for improvement most pertinent for advancing cyanobacterial fuel production, including: improving genetic parts, carbon fixation, metabolic flux, nutrient requirements on a large scale, and photosynthetic efficiency using natural light.

  15. Natural Product Biosynthetic Diversity and Comparative Genomics of the Cyanobacteria.

    Science.gov (United States)

    Dittmann, Elke; Gugger, Muriel; Sivonen, Kaarina; Fewer, David P

    2015-10-01

    Cyanobacteria are an ancient lineage of slow-growing photosynthetic bacteria and a prolific source of natural products with intricate chemical structures and potent biological activities. The bulk of these natural products are known from just a handful of genera. Recent efforts have elucidated the mechanisms underpinning the biosynthesis of a diverse array of natural products from cyanobacteria. Many of the biosynthetic mechanisms are unique to cyanobacteria or rarely described from other organisms. Advances in genome sequence technology have precipitated a deluge of genome sequences for cyanobacteria. This makes it possible to link known natural products to biosynthetic gene clusters but also accelerates the discovery of new natural products through genome mining. These studies demonstrate that cyanobacteria encode a huge variety of cryptic gene clusters for the production of natural products, and the known chemical diversity is likely to be just a fraction of the true biosynthetic capabilities of this fascinating and ancient group of organisms. Copyright © 2015. Published by Elsevier Ltd.

  16. Photobioreactor cultivation strategies for microalgae and cyanobacteria.

    Science.gov (United States)

    Johnson, Tylor J; Katuwal, Sarmila; Anderson, Gary A; Gu, Liping; Zhou, Ruanbao; Gibbons, William R

    2018-03-08

    The current burden on fossil-derived chemicals and fuels combined with the rapidly increasing global population has led to a crucial need to develop renewable and sustainable sources of chemicals and biofuels. Photoautotrophic microorganisms, including cyanobacteria and microalgae, have garnered a great deal of attention for their capability to produce these chemicals from carbon dioxide, mineralized water, and solar energy. While there have been substantial amounts of research directed at scaling-up production from these microorganisms, several factors have proven difficult to overcome, including high costs associated with cultivation, photobioreactor construction, and artificial lighting. Decreasing these costs will substantially increase the economic feasibility of these production processes. Thus, the purpose of this review is to describe various photobioreactor designs, and then provide an overview on lighting systems, mixing, gas transfer, and the hydrodynamics of bubbles. These factors must be considered when the goal of a production process is economic feasibility. Targets for improving microalgae and cyanobacteria cultivation media, including water reduction strategies will also be described. As fossil fuel reserves continue to be depleted and the world population continues to increase, it is imperative that renewable chemical and biofuel production processes be developed toward becoming economically feasible. Thus, it is essential that future research is directed toward improving these processes. © 2018 American Institute of Chemical Engineers Biotechnol. Prog., 2018. © 2018 American Institute of Chemical Engineers.

  17. Effect of Supercritical Carbon Dioxide Extraction Parameters on the Biological Activities and Metabolites Present in Extracts from Arthrospira platensis.

    Science.gov (United States)

    Esquivel-Hernández, Diego A; Rodríguez-Rodríguez, José; Cuéllar-Bermúdez, Sara P; García-Pérez, J Saúl; Mancera-Andrade, Elena I; Núñez-Echevarría, Jade E; Ontiveros-Valencia, Aura; Rostro-Alanis, Magdalena; García-García, Rebeca M; Torres, J Antonio; Chen, Wei Ning; Parra-Saldívar, Roberto

    2017-06-12

    Arthrospira platensis was used to obtain functional extracts through supercritical carbon dioxide extraction (SFE-CO₂). Pressure (P), temperature (T), co-solvent (CX), static extraction (SX), dispersant (Di) and dynamic extraction (DX) were evaluated as process parameters through a Plackett-Burman design. The maximum extract yield obtained was 7.48 ± 0.15% w/w. The maximum contents of bioactive metabolites in extracts were 0.69 ± 0.09 µg/g of riboflavin, 5.49 ± 0.10 µg/g of α-tocopherol, 524.46 ± 0.10 µg/g of β-carotene, 1.44 ± 0.10 µg/g of lutein and 32.11 ± 0.12 mg/g of fatty acids with 39.38% of palmitic acid, 20.63% of linoleic acid and 30.27% of γ-linolenic acid. A. platensis extracts had an antioxidant activity of 76.47 ± 0.71 µg GAE/g by Folin-Ciocalteu assay, 0.52 ± 0.02, 0.40 ± 0.01 and 1.47 ± 0.02 µmol TE/g by DPPH, FRAP and TEAC assays, respectively. These extracts showed antimicrobial activity against Staphylococcus aureus ATCC 25923, Pseudomonas aeruginosa ATCC 27853, Escherichia coli ATCC 25922 and Candida albicans ATCC 10231. Overall, co-solvent was the most significant factor for all measured effects ( p extraction parameters P: 450 bar, CX: 11 g/min, SX: 15 min, DX: 25 min, T: 60 °C and Di: 35 g.

  18. Effect of spirulina food supplement on blood morphological parameters, biochemical composition and on the immune function of sportsmen

    Directory of Open Access Journals (Sweden)

    K Milasius

    2009-07-01

    Full Text Available Of highest biological value are natural concentrates of optimally combined substances produced by nature. One of food supplements of this kind is dietary Spirulina produced by the Tianshi firm (China. It is a most rationally balanced food supplement of a high biological value; it satisfies the needs of the whole body, including its immune system. The aim of the current work was to assess the effect of the multicomponent natural food supplement Spirulina on the physical development, blood morphological, biochemical picture and immune function of sportsmen. Materials and Methods: The study cohort comprised 12 high performance sportsmen (age 20-22 years. They were using tablets of Spirulina, a dietary product for 14 days. Physical development was determined with the aid of standard methods. The general blood picture was analyzed with the aid of a Micros-60 hematological analyzer (company ABX DIAGNOSTICS, France. Lymphocytes and their subsets were analysed by flow cytometery (FACSCalibur, Becton Dickinson Immunocytometry Systems (BDIS, USA and the absolute and percentage values were calculated. To evaluate immune function lymphocyte blasttransformation response to mitogens was studied. Results: Investigations carried out on endurance-training sportsmen showed that a 14-d administration of Spirulina exerted a positive effect on blood morphological composition indices and its biochemical changes. The results of our study confirm the positive effect of Spirulina food supplement on the quantitative parameters of immune system. Part of the study cohort after weeks showed a tendency of normalizing CD3 , CD3 CD4 lympocite count: positive changes were still present two weeks following the interruption of Spirulina intake

  19. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases.

    Directory of Open Access Journals (Sweden)

    Antonella Marangoni

    Full Text Available The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli, in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml, against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.

  20. BISCOITOS DE CHOCOLATE ENRIQUECIDOS COM Spirulina platensis: CARACTERÍSTICAS FÍSICOQUÍMICAS, SENSORIAIS E DIGESTIBILIDADE

    Directory of Open Access Journals (Sweden)

    M. G. MORAIS

    2009-01-01

    Full Text Available

    As microalgas, como Spirulina, podem ser fonte de proteínas para alimentação humana, com a possibilidade de obter outros produtos como biopigmentos, vitaminas e lipídios. A biomassa obtida pode ser introduzida diretamente na dieta podendo auxiliar em casos de desnutrição. O objetivo deste trabalho foi avaliar as características físico-química, sensorial e digestibilidade de biscoitos de chocolate enriquecidos com a microalga Spirulina platensis. Foram elaborados quatro biscoitos de chocolate: controle (sem Spirulina e biscoitos contendo 1,0; 3,0 e 5,0% de Spirulina platensis. O biscoito com adição de 5,0% de Spirulina platensis apresentou o conteúdo protéico 7,7% maior que o controle. Os biscoitos com adição de 1,0% de S. platensis apresentaram maior digestibilidade (86,9% que os demais. Volume específico, espessura e fator de expansão não foram alterados pela adição de Spirulina. Não houve diferença significativa entre o biscoito controle e os biscoitos com adição de 5,0% nos atributos cor, crocância, mastigabilidade e maciez. Na avaliação questionamento de intenção de compra, comparando os biscoitos com adição de S. platensis, a amostra com maior aceitação pelos julgadores foi com 1,0% de S. platensis.

  1. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases.

    Science.gov (United States)

    Marangoni, Antonella; Foschi, Claudio; Micucci, Matteo; Nahui Palomino, Rogers Alberto; Gallina Toschi, Tullia; Vitali, Beatrice; Camarda, Luca; Mandrioli, Mara; De Giorgio, Marta; Aldini, Rita; Corazza, Ivan; Chiarini, Alberto; Cevenini, Roberto; Budriesi, Roberta

    2017-01-01

    The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli), in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml), against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.

  2. Compostos fenólicos totais, atividade antioxidante e antifúngica demultimisturas enriquecidas com a microalga Spirulina platensis

    OpenAIRE

    Bierhals, Vânia da Silva; Machado, Vanessa Goulart; Echevenguá, Walesca Oliveira; Costa, Jorge Alberto Vieira; Furlong, Eliana Badiale

    2009-01-01

    Com o objetivo de avaliar o conteúdo fenólico e as atividades antioxidantes e antifúngicas de multimisturas enriquecidas com Spirulina platensis, foram formuladas quatro multimisturas com farelo de arroz ou trigo, duas contendo Spirulina platensis e duas com sementes de girassol. Os compostos fenólicos foram estimados pela técnica de Folin-Ciocalteau. A atividade antioxidante foi avaliada por meio de inibição do radical livre DPPH e a atividade antifúngica foi analisada por meio de ensaio de ...

  3. Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae.

    Science.gov (United States)

    Wijffels, René H; Kruse, Olaf; Hellingwerf, Klaas J

    2013-06-01

    Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments. Cyanobacteria are promising host organisms for the production of small molecules that can be secreted such as ethanol, butanol, fatty acids and other organic acids. Eukaryotic microalgae are interesting for products for which cellular storage is important such as proteins, lipids, starch and alkanes. For the development of new and promising lines of production, strains of both cyanobacteria and eukaryotic microalgae have to be improved. Transformation systems have been much better developed in cyanobacteria. However, several products would be preferably produced with eukaryotic microalgae. In the case of cyanobacteria a synthetic-systems biology approach has a great potential to exploit cyanobacteria as cell factories. For eukaryotic microalgae transformation systems need to be further developed. A promising strategy is transformation of heterologous (prokaryotic and eukaryotic) genes in established eukaryotic hosts such as Chlamydomonas reinhardtii. Experimental outdoor pilots under containment for the production of genetically modified cyanobacteria and microalgae are in progress. For full scale production risks of release of genetically modified organisms need to be assessed. Copyright © 2013. Published by Elsevier Ltd.

  4. Geographical patterns in cyanobacteria distribution: climate influence at regional scale.

    Science.gov (United States)

    Pitois, Frédéric; Thoraval, Isabelle; Baurès, Estelle; Thomas, Olivier

    2014-01-28

    Cyanobacteria are a component of public health hazards in freshwater environments because of their potential as toxin producers. Eutrophication has long been considered the main cause of cyanobacteria outbreak and proliferation, whereas many studies emphasized the effect of abiotic parameters (mainly temperature and light) on cell growth rate or toxin production. In view of the growing concerns of global change consequences on public health parameters, this study attempts to enlighten climate influence on cyanobacteria at regional scale in Brittany (NW France). The results show that homogeneous cyanobacteria groups are associated with climatic domains related to temperature, global radiation and pluviometry, whereas microcystins (MCs) occurrences are only correlated to local cyanobacteria species composition. As the regional climatic gradient amplitude is similar to the projected climate evolution on a 30-year timespan, a comparison between the present NW and SE situations was used to extrapolate the evolution of geographical cyanobacteria distribution in Brittany. Cyanobacteria composition should shift toward species associated with more frequent Microcystins occurrences along a NW/SE axis whereas lakes situated along a SW/NE axis should transition to species (mainly Nostocales) associated with lower MCs detection frequencies.

  5. Microcystin production in epiphytic cyanobacteria on submerged macrophytes.

    Science.gov (United States)

    Mohamed, Zakaria A; Al Shehri, Abdulrahman M

    2010-06-15

    Cyanotoxins have been largely studied in planktonic and benthic cyanobacteria, but microcystin (MCYST) production in epiphytic cyanobacteria has not been reported yet. The present study reports for the first time the MCYST production in epiphytic cyanobacteria on submerged macrophytes. During this study, four common submerged macrophytes in eutrophic pond in Saudi Arabia were surveyed for the presence of toxic epiphytic cyanobacteria. The results showed that chlorophyll-a and total biovolume of epiphytic cyanobacteria differed significantly among submerged plants with highest values obtained in Stratiotes aloides and lowest in Elodea canadensis. Epiphytic materials collected from Ceratophyllum demersum and S. aloides had higher species diversities than materials collected from E. canadensis and Myriophyllum verticillatum. The cyanobacteria, Merismopedia tenuissima and Leptolyngbya boryana were recorded with a high abundance in epiphytic materials collected from all submerged macrohpytes. Based on Enzyme-linked immunosorbent assay (ELISA), these two species were found to produce MCYSTs (MCYSTs) with concentrations of 1438 and 630 microg g(-1) dry weight, respectively. HPLC analysis of the methanolic extracts of the two species showed that M. tenuissima extract contained MCYST-RR and -LR/demethyl LR plus 3 minor unidentified MCYSTs, while L. boryana extract contained MCYST-YR, -LR/demethyl LR, and 2 minor unidentified MCYSTs. This study suggests that epiphytic species should be considered during monitoring of toxic cyanobacteria in water sources. 2010 Elsevier Ltd. All rights reserved.

  6. Cyanobacteria as a Source for Novel Anti-Leukemic Compounds.

    Science.gov (United States)

    Humisto, Anu; Herfindal, Lars; Jokela, Jouni; Karkman, Antti; Bjørnstad, Ronja; Choudhury, Romi R; Sivonen, Kaarina

    2016-01-01

    Cyanobacteria are an inspiring source of bioactive secondary metabolites. These bioactive agents are a diverse group of compounds which are varying in their bioactive targets, the mechanisms of action, and chemical structures. Cyanobacteria from various environments, especially marine benthic cyanobacteria, are found to be rich sources for the search for novel bioactive compounds. Several compounds with anticancer activities have been discovered from cyanobacteria and some of these have succeeded to enter the clinical trials. Varying anticancer agents are needed to overcome increasing challenges in cancer treatments. Different search methods are used to reveal anticancer compounds from natural products, but cell based methods are the most common. Cyanobacterial bioactive compounds as agents against acute myeloid leukemia are not well studied. Here we examined our new results combined with previous studies of anti-leukemic compounds from cyanobacteria with emphasis to reveal common features in strains producing such activity. We report that cyanobacteria harbor specific anti-leukemic compounds since several studied strains induced apoptosis against AML cells but were inactive against non-malignant cells like hepatocytes. We noted that particularly benthic strains from the Baltic Sea, such as Anabaena sp., were especially potential AML apoptosis inducers. Taken together, this review and re-analysis of data demonstrates the power of maintaining large culture collections for the search for novel bioactivities, and also how anti-AML activity in cyanobacteria can be revealed by relatively simple and low-cost assays.

  7. Estimating Cyanobacteria Community Dynamics and its Relationship with Environmental Factors

    Science.gov (United States)

    Luo, Wenhuai; Chen, Huirong; Lei, Anping; Lu, Jun; Hu, Zhangli

    2014-01-01

    The cyanobacteria community dynamics in two eutrophic freshwater bodies (Tiegang Reservoir and Shiyan Reservoir) was studied with both a traditional microscopic counting method and a PCR-DGGE genotyping method. Results showed that cyanobacterium Phormidium tenue was the predominant species; twenty-six cyanobacteria species were identified in water samples collected from the two reservoirs, among which fourteen were identified with the morphological method and sixteen with the PCR-DGGE method. The cyanobacteria community composition analysis showed a seasonal fluctuation from July to December. The cyanobacteria population peaked in August in both reservoirs, with cell abundances of 3.78 × 108 cells L-1 and 1.92 × 108 cells L-1 in the Tiegang and Shiyan reservoirs, respectively. Canonical Correspondence Analysis (CCA) was applied to further investigate the correlation between cyanobacteria community dynamics and environmental factors. The result indicated that the cyanobacteria community dynamics was mostly correlated with pH, temperature and total nitrogen. This study demonstrated that data obtained from PCR-DGGE combined with a traditional morphological method could reflect cyanobacteria community dynamics and its correlation with environmental factors in eutrophic freshwater bodies. PMID:24448632

  8. Ammonium photo-production by heterocytous cyanobacteria: potentials and constraints.

    Science.gov (United States)

    Grizeau, Dominique; Bui, Lan Anh; Dupré, Catherine; Legrand, Jack

    2016-08-01

    Over the last decades, production of microalgae and cyanobacteria has been developed for several applications, including novel foods, cosmetic ingredients and more recently biofuel. The sustainability of these promising developments can be hindered by some constraints, such as water and nutrient footprints. This review surveys data on N2-fixing cyanobacteria for biomass production and ways to induce and improve the excretion of ammonium within cultures under aerobic conditions. The nitrogenase complex is oxygen sensitive. Nevertheless, nitrogen fixation occurs under oxic conditions due to cyanobacteria-specific characteristics. For instance, in some cyanobacteria, the vegetative cell differentiation in heterocyts provides a well-adapted anaerobic microenvironment for nitrogenase protection. Therefore, cell cultures of oxygenic cyanobacteria have been grown in laboratory and pilot photobioreactors (Dasgupta et al., 2010; Fontes et al., 1987; Moreno et al., 2003; Nayak & Das, 2013). Biomass production under diazotrophic conditions has been shown to be controlled by environmental factors such as light intensity, temperature, aeration rate, and inorganic carbon concentration, also, more specifically, by the concentration of dissolved oxygen in the culture medium. Currently, there is little information regarding the production of extracellular ammonium by heterocytous cyanobacteria. This review compares the available data on maximum ammonium concentrations and analyses the specific rate production in cultures grown as free or immobilized filamentous cyanobacteria. Extracellular production of ammonium could be coupled, as suggested by recent research on non-diazotrophic cyanobacteria, to that of other high value metabolites. There is little information available regarding the possibility for using diazotrophic cyanobacteria as cellular factories may be in regard of the constraints due to nitrogen fixation.

  9. Spirulina does not decrease muscle damage nor oxdidative stress in cycling athletes with adequate nutritional status

    Directory of Open Access Journals (Sweden)

    G.A.M. Franca

    2010-12-01

    Full Text Available The objective of this study was to assess the effect of Spirulina maxima on oxidative stress and muscle damage in cycling athletes subjected to high volume and intensity of training. Eighteen male athletes were randomly divided into an experimental group (n=11 with age 27.8±3.5 and placebo (n=7 with age 34.3±2.3 in a double-blind fashion. They carried out a protocol of Spirulina dietary supplementation (7.5 g/day of placebo for four weeks and maintained their trainings during this period. A nutritional anamnesis was performed and blood tests were done to determine pre and post levels of creatine kinase (CK, lactic dehydrogenase (LHD, superoxide dismutase (SOD and malondialdehyde (MDA. The supplemented and placebo groups performed the same volume training, has adequate macronutrients and antioxidant vitamins ingestion before study, as well as initial CK, LDH, SOD and MDA levels. Supplementation did not promote a significant alteration in CK levels on supplemented group (158.4±16.3 for 140.0±16.6 U/l, p>0.05, LDH (420±13.2 for 394.9±27.9 UI/l, p>0.05, MDA (2.8±0.2 for 2.9±0.4 nmol/ml, p>0.05, nor an increase in the SOD (7.3±0.6 for 7.0±0.6 U/mg Hb, p>0.05. We conclude that administration of Spirulina does not interfere in the magnitude of muscle damage nor in antioxidant status of cycling athletes that practice intense training.

  10. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates

    OpenAIRE

    Nur Maulida Safitri; Endang Yuli Herawati; Jue Liang Hsu

    2017-01-01

    The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl) assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51) was identified and synthetized, w...

  11. Inspiration fuels space research in Congo. Combating malnutrition with Spirulina, the green protein source

    International Nuclear Information System (INIS)

    2016-01-01

    In Congo, around 43% of all children under the age of five suffer from chronic malnutrition. The result is a high infant mortality rate./ Researchers from the Belgian Nuclear research Center SCK•CEN started working on the cultivation of spirulina, a type of algae rich in vitamins and minerals that are essential for combating chronic malnutrition in children. This Inspiration project is the first in a series and signals the ambition of SCK•CEN to contribute towards a balanced and sustainable world.

  12. Phyocyanin extraction from microalgae Spirulina platensis assisted by ultrasound irradiation: effect of time and temperature

    Directory of Open Access Journals (Sweden)

    Hadiyanto

    2016-08-01

    Full Text Available This research was aimed to extract phycocyanin from microalgae Spirulina platensis using an extraction assisted by ultrasound irradiation. The extraction was conducted by using variable of extraction time, temperature and ultrasound frequency, while ethanol was used as solvent. The results show that the yield of phycocyanin extract was 15.97% at constant frequency of 42 kHz and 11.24% at constant frequency of 28 kHz, while the soxhlet extraction method obtained yield at 11.13%. The ultrasound could reduce the extraction time from 4 hrs (conventional to 20 minutes, while the optimum temperature of extraction was found at 55°C.

  13. Microbial Profiling Of Cyanobacteria From VIT Lake

    Directory of Open Access Journals (Sweden)

    Swati Singh

    2015-08-01

    Full Text Available The application of molecular biological methods to study the diversity and ecology of micro-organisms in natural environments has been practice in mid-1980. The aim of our research is to access the diversity composition and functioning of complex microbial community found in VIT Lake. Molecular ecology is a new field in which microbes can be recognized and their function can be understood at the DNA or RNA level which is useful for constructing genetically modified microbes by recombinant DNA technology for reputed use in the environment. In this research first we will isolate cyanobacteria in lab using conventional methods like broth culture and spread plate method then we will analyze their morphology using various staining methods and DNA and protein composition using electrophoresis method. The applications of community profiling approaches will advance our understanding of the functional role of microbial diversity in VIT Lake controls on microbial community composition.

  14. Dynamics of photosynthetic activity of cyanobacteria after gut ...

    African Journals Online (AJOL)

    African Journal of Biotechnology ... carp and goldfish, whereas there was a significant stimulation of photosynthetic activity of diatom and green algae following the depressed cyanobacteria during cultivation. The mainly stimulated eukaryotic algae species were Fragilariaceae and Scenedesmus obliquus by microscopy.

  15. Metabolic engineering of cyanobacteria for the synthesis of commodity products

    NARCIS (Netherlands)

    Angermayr, S.A.; Gorchs Rovira, A.; Hellingwerf, K.J.

    2015-01-01

    Through metabolic engineering cyanobacteria can be employed in biotechnology. Combining the capacity for oxygenic photosynthesis and carbon fixation with an engineered metabolic pathway allows carbon-based product formation from CO2, light, and water directly. Such cyanobacterial 'cell factories'

  16. Cyanobacteria as photosynthetic biocatalysts: a systems biology perspective.

    Science.gov (United States)

    Gudmundsson, Steinn; Nogales, Juan

    2015-01-01

    The increasing need to replace oil-based products and to address global climate change concerns has triggered considerable interest in photosynthetic microorganisms. Cyanobacteria, in particular, have great potential as biocatalysts for fuels and fine-chemicals. During the last few years the biotechnological applications of cyanobacteria have experienced an unprecedented increase and the use of these photosynthetic organisms for chemical production is becoming a tangible reality. However, the field is still immature and many concerns about the economic feasibility of the biotechnological potential of cyanobacteria remain. In this review we describe recent successes in biofuel and fine-chemical production using cyanobacteria. We discuss the role of the photosynthetic metabolism and highlight the need for systems-level metabolic optimization in order to achieve the true potential of cyanobacterial biocatalysts.

  17. Cyanobacteria and cyanotoxins at the river-estuarine transition.

    Science.gov (United States)

    Bukaveckas, Paul A; Franklin, Rima; Tassone, Spencer; Trache, Brendan; Egerton, Todd

    2018-06-01

    We examined seasonal and longitudinal patterns in the occurrence of toxic cyanobacteria in the James River Estuary (Virginia). Highest chlorophyll and cyanobacteria levels were observed in the tidal freshwater segment, particularly during dry summers when freshwater replacement time was long. Cyanobacteria accounted for a small proportion of phytoplankton biomass (7-15%), and Microcystis comprised a small proportion of the cyanobacteria (85% of samples in July, August and September), fish tissues (87% of planktivorous fishes) and shellfish (83% of individuals). Generic indicators of algal blooms (chlorophyll and algal biomass) had limited utility for predicting microcystin concentrations. However, chlorophyll was found to be a useful predictor for the probability of exceeding specific toxin thresholds. Tissue microcystin concentrations were highest in fish and shellfish collected from the tidal fresh segment, but were detectable in biota collected from the oligohaline at distances 50 km seaward. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Nitrogen fixation by cyanobacteria stimulates production in Baltic food webs.

    Science.gov (United States)

    Karlson, Agnes M L; Duberg, Jon; Motwani, Nisha H; Hogfors, Hedvig; Klawonn, Isabell; Ploug, Helle; Barthel Svedén, Jennie; Garbaras, Andrius; Sundelin, Brita; Hajdu, Susanna; Larsson, Ulf; Elmgren, Ragnar; Gorokhova, Elena

    2015-06-01

    Filamentous, nitrogen-fixing cyanobacteria form extensive summer blooms in the Baltic Sea. Their ability to fix dissolved N2 allows cyanobacteria to circumvent the general summer nitrogen limitation, while also generating a supply of novel bioavailable nitrogen for the food web. However, the fate of the nitrogen fixed by cyanobacteria remains unresolved, as does its importance for secondary production in the Baltic Sea. Here, we synthesize recent experimental and field studies providing strong empirical evidence that cyanobacterial nitrogen is efficiently assimilated and transferred in Baltic food webs via two major pathways: directly by grazing on fresh or decaying cyanobacteria and indirectly through the uptake by other phytoplankton and microbes of bioavailable nitrogen exuded from cyanobacterial cells. This information is an essential step toward guiding nutrient management to minimize noxious blooms without overly reducing secondary production, and ultimately most probably fish production in the Baltic Sea.

  19. Cyanobacteria Occurrence and Nitrogen Fixation Rates in the ...

    African Journals Online (AJOL)

    Keywords: Cyanobacteria, Nitrogen Fixation, Seagrass, Seaweed Farming. Abstract—The .... during every sampling period, using a mercury thermometer and a ..... Capone, D.G. (1993) Determination of nitrogenase activity in aquatic samples ...

  20. Human Health Effects Associated with Exposure to Toxic Cyanobacteria

    Science.gov (United States)

    Reports of toxic cyanobacteria blooms are increasing worldwide. Warming and eutrophic surface water systems support the development of blooms. We examine the evidence for adverse human health effects associated with exposure to toxic blooms in drinking water, recreational water a...

  1. Design of magnetic akaganeite-cyanobacteria hybrid biofilms

    International Nuclear Information System (INIS)

    Dahoumane, Si Amar; Djediat, Chakib; Yepremian, Claude; Coute, Alain; Fievet, Fernand; Brayner, Roberta

    2010-01-01

    Common Anabaena cyanobacteria are shown to form intra-cellularly akaganeite β-FeOOH nanorods of well-controlled size and unusual morphology at room temperature. High-resolution transmission electron microscopy showed that these nanorods present a complex arrangement of pores forming a spongelike structure. These hybrid akaganeite-cyanobacteria were used to form 'one-pot' hybrid biofilms. The hybrid biofilm presents higher coercivity (H c = 44.6 kA m -1 (560 Oe)) when compared to lyophilized akaganeite-cyanobacteria powder (H c = 0.8 kA m -1 (10 Oe)) due to the quasi-assembly of the cells on the glass substrate compared to the lyophilized randomly akaganeite-cyanobacteria powder.

  2. Nutritional quality of two cyanobacteria : How rich is 'poor' food?

    DEFF Research Database (Denmark)

    Schmidt, K.; Jonasdottir, Sigrun

    1997-01-01

    Cyanobacteria have often been described to be nutritionally inadequate and to interfere with zooplankton feeding. In laboratory experiments we offered 2 cyanobacteria, a unicellular Microcystis aeruginosa strain and the filamentous Nodularia sprumigena, to the calanoid copepod Acartia tonsa...... as the sole diet and in food mixtures with the nutritious diatom Thalassiosira weissflogii. Egg production was used as criterion of food quality. The use of cyanobacteria alone was an insufficient diet. However, with increasing additions of M. aeruginosa and N. spumigena to the diatom, different effects were...... observed. Large additions of cyanobacteria resulted in lower egg production and often in elevated mortality of the females, but small additions of M. aeruginosa caused an increase of about 25 % in egg production compared to a pure diatom diet. The influence of similar low concentrations of N. spumigena...

  3. Cyanobactins from Cyanobacteria: Current Genetic and Chemical State of Knowledge.

    Science.gov (United States)

    Martins, Joana; Vasconcelos, Vitor

    2015-11-13

    Cyanobacteria are considered to be one of the most promising sources of new, natural products. Apart from non-ribosomal peptides and polyketides, ribosomally synthesized and post-translationally modified peptides (RiPPs) are one of the leading groups of bioactive compounds produced by cyanobacteria. Among these, cyanobactins have sparked attention due to their interesting bioactivities and for their potential to be prospective candidates in the development of drugs. It is assumed that the primary source of cyanobactins is cyanobacteria, although these compounds have also been isolated from marine animals such as ascidians, sponges and mollusks. The aim of this review is to update the current knowledge of cyanobactins, recognized as being produced by cyanobacteria, and to emphasize their genetic clusters and chemical structures as well as their bioactivities, ecological roles and biotechnological potential.

  4. Antibacterial and antifungal activities of selected microalgae and cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Najdenski, H. M.; Gigova, L. G.; Iliev, I. I.; Pilarski, P. S.; Lukavský, Jaromír; Tsvetkova, I. V.; Ninova, M. S.; Kussovski, V. K.

    2013-01-01

    Roč. 48, č. 7 (2013), s. 1533-1540 ISSN 0950-5423 Institutional support: RVO:67985939 Keywords : antimicrobial activity * cyanobacteria * microalgae Subject RIV: EF - Botanics Impact factor: 1.354, year: 2013

  5. Looking at the stability of life-support microorganisms in space : the MELGEN activity highlights the cyanobacterium Arthrospira sp. PCC8005

    Science.gov (United States)

    Morin, Nicolas

    The MELGEN activity (MELiSSA Genetic Stability Study) mainly covers the molecular aspects of the regenerative life-support system MELiSSA (Micro-Ecological Life Support System Alternative) of the European Space Agency (ESA). The general objective of MELGEN is to establish and validate methods and the related hardware in order to detect genetic instability and microbial contaminants in the MELISSA compartments. This includes (1) a genetic description of the MELISSA strains, (2) studies of microbial behavior and genetic stability in bioreactors and (3) the detection of chemical, genetical and biological contamination and their effect on microbial metabolism. Selected as oxygen producer and complementary food source, the cyanobacterium Arthrospira sp. PCC8005 plays a major role within the MELiSSA loop. As the genomic information on this organism was insufficient, sequencing of its genome was proposed at the French National Sequencing Center, Genoscope, as a joint effort between ESA and different laboratories. So far, a preliminary assembly of 16 contigs representing circa 6.3 million basepairs was obtained. Even though the finishing of the genome is on its way, automatic annotation of the contigs has already been performed on the MaGe annotation platform, and curation of the sequence is currently being carried out, with a special focus on biosynthesis pathways, photosynthesis, and maintenance processes of the cell. According to the index of repetitiveness described by Haubold and Wiehe (2006), we discovered that the genome of Arthrospira sp. is among the 50 most repeated bacterial genomes sequenced to date. Thanks to the sequencing project, we have identified and catalogued mobile genetics elements (MGEs) dispersed throughout the unique chromosome of this cyanobacterium. They represent a quite large proportion of the genome, as genes identified as putative transposases are indeed found in circa 5 Results : We currently have a first draft of the complete genome of

  6. Morphology and elemental composition of recent and fossil cyanobacteria

    Science.gov (United States)

    St. Amand, Ann; Hoover, Richard B.; Jerman, Gregory A.; Coston, James; Rozanov, Alexei Y.

    2005-09-01

    Cyanobacteria (cyanophyta, cyanoprokaryota, and blue-green algae) are an ancient, diverse and abundant group of photosynthetic oxygenic microorganisms. Together with other bacteria and archaea, the cyanobacteria have been the dominant life forms on Earth for over 3.5 billion years. Cyanobacteria occur in some of our planets most extreme environments - hot springs and geysers, hypersaline and alkaline lakes, hot and cold deserts, and the polar ice caps. They occur in a wide variety of morphologies. Unlike archaea and other bacteria, which are typically classified in pure culture by their physiological, biochemical and phylogenetic properties, the cyanobacteria have historically been classified based upon their size and morphological characteristics. These include the presence or absence of heterocysts, sheath, uniseriate or multiseriate trichomes, true or false branching, arrangement of thylakoids, reproduction by akinetes, binary fission, hormogonia, fragmentation, presence/absence of motility etc. Their antiquity, distribution, structural and chemical differentiation, diversity, morphological complexity and large size compared to most other bacteria, makes the cyanobacteria ideal candidates for morphological biomarkers in returned Astromaterials. We have obtained optical (nomarski and phase contrast)/fluorescent (blue and green excitation) microscopy images using an Olympus BX60 compound microscope and Field Emission Scanning Electron Microscopy images and EDAX elemental compositions of living and fossil cyanobacteria. The S-4000 Hitachi Field Emission Scanning Electron Microscope (FESEM) has been used to investigate microfossils in freshly fractured interior surfaces of terrestrial rocks and the cells, hormogonia, sheaths and trichomes of recent filamentous cyanobacteria. We present Fluorescent and FESEM Secondary and Backscattered Electron images and associated EDAX elemental analyses of recent and fossil cyanobacteria, concentrating on representatives of the

  7. CyanoBase: the cyanobacteria genome database update 2010.

    Science.gov (United States)

    Nakao, Mitsuteru; Okamoto, Shinobu; Kohara, Mitsuyo; Fujishiro, Tsunakazu; Fujisawa, Takatomo; Sato, Shusei; Tabata, Satoshi; Kaneko, Takakazu; Nakamura, Yasukazu

    2010-01-01

    CyanoBase (http://genome.kazusa.or.jp/cyanobase) is the genome database for cyanobacteria, which are model organisms for photosynthesis. The database houses cyanobacteria species information, complete genome sequences, genome-scale experiment data, gene information, gene annotations and mutant information. In this version, we updated these datasets and improved the navigation and the visual display of the data views. In addition, a web service API now enables users to retrieve the data in various formats with other tools, seamlessly.

  8. CyanoBase: the cyanobacteria genome database update 2010

    OpenAIRE

    Nakao, Mitsuteru; Okamoto, Shinobu; Kohara, Mitsuyo; Fujishiro, Tsunakazu; Fujisawa, Takatomo; Sato, Shusei; Tabata, Satoshi; Kaneko, Takakazu; Nakamura, Yasukazu

    2009-01-01

    CyanoBase (http://genome.kazusa.or.jp/cyanobase) is the genome database for cyanobacteria, which are model organisms for photosynthesis. The database houses cyanobacteria species information, complete genome sequences, genome-scale experiment data, gene information, gene annotations and mutant information. In this version, we updated these datasets and improved the navigation and the visual display of the data views. In addition, a web service API now enables users to retrieve the data in var...

  9. Changes of the delayed fluorescence characteristics in Spirulina, Anabaena and Chlorella in response to chromatic adaptation and irradiance

    International Nuclear Information System (INIS)

    Znak, N.Y.; Morgun, V.N.

    1995-01-01

    Efficiency of the energy transformation for CO2 fixation (E), and kinetics of the initial O-2-mediated electron transport of Spirulina platensis (Gem. ) Geitl, and Chlorella vulgaris Beijerinck cells were measured after adaptation to various growth irradiances (I) by means of the delayed fluorescence (DF) induction curves. Maxima of the membrane potential expenses during induction period were observed at I half saturating oxygen evolution; they were shifted according to growth I remaining higher in Spirulina than in Chlorella. The alterations of absorbance and fluorescence spectra at 25 degrees C after adaptation to I demonstrated changes in composition of pigments of algae, created to compensate for the imbalance in radiation absorption between the two photosystems. For Spirulina cells, the value of E was higher after growing under low I, or under blue radiation absorbed mainly by photosystem (PS) 1 (400-500 nm) with excitation by yellow (570 nm) radiation. For Chlorella cells, it was also higher after growing under low I. Under such conditions the half-rise time for DP-phase of DF induction curve decreased, which reflected an acceleration of kinetics of the initial electron transport between photosystems. An opposite situation was observed with Spirulina cells grown under high I or yellow radiation, and Chlorella cells from high I. Enhancement of effective PS2/PS1 ratio associated with decrease of reaction centre (RC) 2/RC1 stoichiometry may because of the increase of E and high membrane energization under saturating I in algae adapted to low I

  10. Anti-cancer effects of blue-green alga Spirulina platensis, a natural source of bilirubin-like tetrapyrrolic compounds

    Czech Academy of Sciences Publication Activity Database

    Koníčková, R.; Vaňková, K.; Vaníková, J.; Váňová, K.; Muchová, L.; Subhanová, I.; Zadinová, M.; Zelenka, Jaroslav; Dvořák, Aleš; Kolář, Michal; Strnad, Hynek; Rimpelová, S.; Ruml, T.; Wong, R.J.; Vítek, L.

    2014-01-01

    Roč. 13, č. 2 (2014), s. 273-283 ISSN 1665-2681 Institutional support: RVO:67985823 ; RVO:68378050 Keywords : bilirubin * chlorophyll * heme oxygenase * phycocyanin * phycocyanobilin * Spirulina platensis * tetrapyrroles Subject RIV: FD - Oncology ; Hematology Impact factor: 2.065, year: 2014

  11. Spirulina platensis versus silymarin in the treatment of chronic hepatitis C virus infection. A pilot randomized, comparative clinical trial

    Directory of Open Access Journals (Sweden)

    Yakoot Mostafa

    2012-04-01

    Full Text Available Abstract Background Spirulina platensis, a cynobacterium used frequently as a dietary supplement had been found to exhibit many immune-stimulating and antiviral activities. It had been found to activate macrophages, NK cells, T cells, B cells, and to stimulate the production of Interferon gamma (IFN-γ and other cytokines. Natural substances isolated from Spirulina platensis had been found to be potent inhibitors against several enveloped viruses by blocking viral absorption/penetration and some replication stages of progeny viruses after penetration into cells. We aimed to study whether this dietary supplement possesses any therapeutically feasible activity worthy of further larger controlled clinical evaluation. Methods Sixty six patients with chronic hepatitis C virus infection and eligible for inclusion had been randomized to either Spirulina or Silymarin treated groups for a period of six months treatment. The two groups were followed up and blindly compared for early (after 3 months and end of 6 months treatment virological response. The effects of both treatments on each of alanine aminotransferase (ALT, Chronic Liver Disease Questionnaire scores (CLDQ, Arizona Sexual Experience Scale scores (ASEX and the occurrence of any attributable adverse events were also compared. Results Among the 30 patients who had been treated with Spirulina and completed the 6 months protocol, 4 patients (13.3% had a complete end of treatment virological response and 2 patients (6.7% had a partial end of treatment response defined as significant decrease of virus load of at least 2-logs10. Though the proportion of responders in Spirulina group was greater than in the Silymarin group, the difference was not statistically significant at the end of both 6 months (p = 0.12 and 3 months treatment (p = 0.22 by Exact test. Alanine aminotransferase as well as CLDQ and ASEX scores were found to be more significantly improved in Spirulina than in Silymarin treated group

  12. Spirulina platensis effects on the levels of total cholesterol, HDL and triacylglycerols in rabbits fed with a hypercholesterolemic diet

    Directory of Open Access Journals (Sweden)

    Luciane Maria Colla

    2008-04-01

    Full Text Available In this work, hypercholesterolemia was induced in rabbits by feeding them a high cholesterol diet (CD, 350 mg/d and the effects of supplementing this diet with 0.5 g/d Spirulina platensis was evaluated by measuring the levels of serum total-cholesterol (TC, triacylglycerols (TAG and high-density lipoprotein (HDL-cholesterol at the start of the experiment and after 30 d and 60 d. It was found that the levels of serum cholesterol decreased from 1,054±101 mg.dL-1 in the rabbits fed a CD without S. platensis to 516±163 mg.dL-1 to those fed with a high cholesterol diet supplemented with S. platensis (significant at p A microalga Spirulina é cultivada e comercializada no mundo devido a suas características nutricionais (elevada concentração de proteínas, em torno de 65%, vitaminas e sais minerais e ao seu potencial terapêutico no tratamento de inúmeras doenças, inclusive a hipercolesterolemia. Neste trabalho foi avaliada a inibição da hipercolesterolemia induzida em coelhos por uma dieta adicionada de colesterol (350 mg.d-1, pela suplementação de 0,5 g.dia-1 de biomassa de Spirulina platensis, sendo avaliados os níveis de colesterol total, triglicerídeos e HDL nos tempos de 0 d, 30 d e 60 d de tratamento. Os resultados indicaram que a adição de Spirulina platensis na dieta ocasionou decréscimo nos níveis de colesterol total de 1054±101 mg.dL-1 para 516±163 mg.dL-1 (p<0,0001, para os coelhos alimentados com a dieta colesterolêmica em comparação com os que receberam a dieta adicionada de Spirulina platensis. A adição de Spirulina a dieta colesterolêmica não ocasionou decréscimo significativo nos níveis de triglicerídios dos coelhos. Os valores de HDL aumentaram de 73±31 mg.dL-1 para 91,0±15,7 mg.dL-1, comparando-se os coelhos alimentados com a dieta colesterolêmica e os alimentados com a dieta adicionada de Spirulina, estatisticamente diferentes a um nível de significância maior que 0,1533.

  13. Anaerobic digestion of the microalga Spirulina at extreme alkaline conditions: biogas production, metagenome, and metatranscriptome

    Science.gov (United States)

    Nolla-Ardèvol, Vímac; Strous, Marc; Tegetmeyer, Halina E.

    2015-01-01

    A haloalkaline anaerobic microbial community obtained from soda lake sediments was used to inoculate anaerobic reactors for the production of methane rich biogas. The microalga Spirulina was successfully digested by the haloalkaline microbial consortium at alkaline conditions (pH 10, 2.0 M Na+). Continuous biogas production was observed and the obtained biogas was rich in methane, up to 96%. Alkaline medium acted as a CO2 scrubber which resulted in low amounts of CO2 and no traces of H2S in the produced biogas. A hydraulic retention time (HRT) of 15 days and 0.25 g Spirulina L−1 day−1 organic loading rate (OLR) were identified as the optimal operational parameters. Metagenomic and metatranscriptomic analysis showed that the hydrolysis of the supplied substrate was mainly carried out by Bacteroidetes of the “ML635J-40 aquatic group” while the hydrogenotrophic pathway was the main producer of methane in a methanogenic community dominated by Methanocalculus. PMID:26157422

  14. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Selvaraj Karthick Raja Namasivayam

    2015-04-01

    Full Text Available Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  15. Semicontinuous cultivation of the Cyanobacterium Spirulina platensis in a closed photobioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Reichert, C.C.; Costa, J.A.V. [Fundacao Universidade Federal do Rio Grande (FURG), Rio Grande, RS (Brazil). Dept. de Quimica], Email: dqmjorge@furg.br; Reinehr, C.O. [Universidade de Passo Fundo, RS (Brazil). Centro de Pesquisa em Alimentacao], Email: reinehr@upf.br

    2006-01-15

    The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate ({mu}{sub x}, day{sup -1}) and productivity (P{sub x}, in mg/L/day of Spirulina platensis biomass, dry weight basis) of two S. platensis strains (LEB-52 and Paracas) growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h) at 30 deg C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L) and high renewal rates (50% v/v) resulted in a high specific growth rate ({mu}{sub x} = 0.111 day{sup -1}) and high productivity (P{sub x} = 42.3 mg/L/day). These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable. (author)

  16. Semicontinuous cultivation of the cyanobacterium Spirulina platensis in a closed photobioreactor

    Directory of Open Access Journals (Sweden)

    C. C. Reichert

    2006-03-01

    Full Text Available The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate (µx, day-1 and productivity (Px, in mg/L/day of Spirulina platensis biomass, dry weight basis of two S. platensis strains (LEB-52 and Paracas growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h at 30°C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L and high renewal rates (50% v/v resulted in a high specific growth rate (µx = 0.111 day-1 and high productivity (Px = 42.3 mg/L/day. These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable.

  17. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Institute of Scientific and Technical Information of China (English)

    Duraisamy Jayakumar; Ramesh Kumar; Rajan SowriArvind Bharani

    2015-01-01

    Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  18. Biodiesel production from microalgae Spirulina maxima by two step process: Optimization of process variable

    Directory of Open Access Journals (Sweden)

    M.A. Rahman

    2017-04-01

    Full Text Available Biodiesel from green energy source is gaining tremendous attention for ecofriendly and economically aspect. In this investigation, a two-step process was developed for the production of biodiesel from microalgae Spirulina maxima and determined best operating conditions for the steps. In the first stage, acid esterification was conducted to lessen acid value (AV from 10.66 to 0.51 mgKOH/g of the feedstock and optimal conditions for maximum esterified oil yielding were found at molar ratio 12:1, temperature 60°C, 1% (wt% H2SO4, and mixing intensity 400 rpm for a reaction time of 90 min. The second stage alkali transesterification was carried out for maximum biodiesel yielding (86.1% and optimal conditions were found at molar ratio 9:1, temperature 65°C, mixing intensity 600 rpm, catalyst concentration 0.75% (wt% KOH for a reaction time of 20 min. Biodiesel were analyzed according to ASTM standards and results were within standards limit. Results will helpful to produce third generation algal biodiesel from microalgae Spirulina maxima in an efficient manner.

  19. Experimental Substantiation of the Possibility of Developing Selenium- and Iodine-Containing Pharmaceuticals Based on Blue-Green Algae Spirulina Platensis

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Khisanishvili, L A; Frontasyeva, M V; Pavlov, C C; Gundorina, S F

    2001-01-01

    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using -reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loding of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  20. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pavlov, S.S.; Gundorina, S.F.

    2001-01-01

    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed

  1. SOILS, FERTILIZATION AND MANAGEMENT OF WATER Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Liliana Gómez G

    2012-01-01

    Full Text Available Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibith better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.

  2. Valores energéticos e composição química da espirulina (Spirulina platensis) avaliada com frangos de corte

    OpenAIRE

    Alvarenga, Renata Ribeiro; Rodrigues, Paulo Borges; Cantarelli, Vinícius de Souza; Zangeronimo, Márcio Gilberto; Silva Júnior, José Walter da; Silva, Leonardo Rafael da; Santos, Luziane Moreira dos; Pereira, Luciano José

    2011-01-01

    The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis), the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME) and the apparent metabolizable energy corrected for nitrogen balance (AMEn) in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metab...

  3. Spirulina platensis: process optimization to obtain biomass Spirulina platensis: otimização de processo para a obtenção de biomassa

    Directory of Open Access Journals (Sweden)

    Iracema de Oliveira Moraes

    2013-02-01

    Full Text Available Spirulina platensis is a photoautotrophic mesophilic cyanobacterium. Its main sources of nutrients are nitrate, urea, and ammonium salts. Spirulina cultivation requires temperature, light intensity, and nutrient content control. This microalgae has been studied and used commercially due to its therapeutic and antioxidant potential. In addition, several studies have reported its ability to use CO2, its immune activity, and use as an adjuvant nutritive factor in the treatment of obesity. The objective of this study is the production of biomass of S. platensis using different rates of stirring, nitrogen source, amount of micronutrients, and luminosity. A 2(4 experimental design with the following factors: stirring (120 and 140 RPM, amount of nitrogen (1.5 and 2.5 g/L, amount of micronutrients (0,25 and 0,75 mL/L (11 and 15 W, and luminosity was used. Fermentation was performed in a 500 mL conical flask with 250 mL of culture medium and 10% inoculum in an incubator with controlled stirring and luminosity. Fermentation was monitored using a spectrophotometer (560 nm, and each fermentation lasted 15 days. Of the parameters studied, luminosity is the one with the highest significance, followed by the amount of nitrogen and the interaction between stirring and micronutrients. Maximum production of biomass for 15 days was 2.70 g/L under the following conditions: luminosity15W; stirring, 120 RPM; source of nitrogen, 1.5 g/L; and micronutrients, 0.75 mL/L.A Spirulina platensis é uma cianobactéria mesofílica, fotoautotrófica, que utiliza como nutrientes os nitratos, ureia e sais de amônio. O cultivo necessita de controle de temperatura, intensidade de luz e do teor de nutrientes utilizados. Esta microalga tem sido estuda pelo seu potencial nutricional, antioxidante, terapêutico e adjuvante em tratamento de obesidade. O objetivo deste trabalho foi a produção de biomassa de S. platensis em diferentes níveis de agitação, fonte de nitrog

  4. Nitrogen fixed by cyanobacteria is utilized by deposit-feeders.

    Science.gov (United States)

    Karlson, Agnes M L; Gorokhova, Elena; Elmgren, Ragnar

    2014-01-01

    Benthic communities below the photic zone depend for food on allochthonous organic matter derived from seasonal phytoplankton blooms. In the Baltic Sea, the spring diatom bloom is considered the most important input of organic matter, whereas the contribution of the summer bloom dominated by diazotrophic cyanobacteria is less understood. The possible increase in cyanobacteria blooms as a consequence of eutrophication and climate change calls for evaluation of cyanobacteria effects on benthic community functioning and productivity. Here, we examine utilization of cyanobacterial nitrogen by deposit-feeding benthic macrofauna following a cyanobacteria bloom at three stations during two consecutive years and link these changes to isotopic niche and variations in body condition (assayed as C:N ratio) of the animals. Since nitrogen-fixing cyanobacteria have δ(15)N close to -2‰, we expected the δ(15)N in the deposit-feeders to decrease after the bloom if their assimilation of cyanobacteria-derived nitrogen was substantial. We also expected the settled cyanobacteria with their associated microheterotrophic community and relatively high nitrogen content to increase the isotopic niche area, trophic diversity and dietary divergence between individuals (estimated as the nearest neighbour distance) in the benthic fauna after the bloom. The three surface-feeding species (Monoporeia affinis, Macoma balthica and Marenzelleria arctia) showed significantly lower δ(15)N values after the bloom, while the sub-surface feeder Pontoporeia femorata did not. The effect of the bloom on isotopic niche varied greatly between stations; populations which increased niche area after the bloom had better body condition than populations with reduced niche, regardless of species. Thus, cyanobacterial nitrogen is efficiently integrated into the benthic food webs in the Baltic, with likely consequences for their functioning, secondary production, transfer efficiency, trophic interactions, and

  5. Nitrogen fixed by cyanobacteria is utilized by deposit-feeders.

    Directory of Open Access Journals (Sweden)

    Agnes M L Karlson

    Full Text Available Benthic communities below the photic zone depend for food on allochthonous organic matter derived from seasonal phytoplankton blooms. In the Baltic Sea, the spring diatom bloom is considered the most important input of organic matter, whereas the contribution of the summer bloom dominated by diazotrophic cyanobacteria is less understood. The possible increase in cyanobacteria blooms as a consequence of eutrophication and climate change calls for evaluation of cyanobacteria effects on benthic community functioning and productivity. Here, we examine utilization of cyanobacterial nitrogen by deposit-feeding benthic macrofauna following a cyanobacteria bloom at three stations during two consecutive years and link these changes to isotopic niche and variations in body condition (assayed as C:N ratio of the animals. Since nitrogen-fixing cyanobacteria have δ(15N close to -2‰, we expected the δ(15N in the deposit-feeders to decrease after the bloom if their assimilation of cyanobacteria-derived nitrogen was substantial. We also expected the settled cyanobacteria with their associated microheterotrophic community and relatively high nitrogen content to increase the isotopic niche area, trophic diversity and dietary divergence between individuals (estimated as the nearest neighbour distance in the benthic fauna after the bloom. The three surface-feeding species (Monoporeia affinis, Macoma balthica and Marenzelleria arctia showed significantly lower δ(15N values after the bloom, while the sub-surface feeder Pontoporeia femorata did not. The effect of the bloom on isotopic niche varied greatly between stations; populations which increased niche area after the bloom had better body condition than populations with reduced niche, regardless of species. Thus, cyanobacterial nitrogen is efficiently integrated into the benthic food webs in the Baltic, with likely consequences for their functioning, secondary production, transfer efficiency, trophic

  6. Impact of physico-chemical parameters on the physiological growth ...

    African Journals Online (AJOL)

    Impact of physico-chemical parameters on the physiological growth of Arthrospira (Spirulina platensis) exogenous strain UTEXLB2340. Yahia Mustafa A Fagiri, Aisha Salleh, Saifeldin Ahmed F El-Nagerabi ...

  7. Stress Sensors and Signal Transducers in Cyanobacteria

    Science.gov (United States)

    Los, Dmitry A.; Zorina, Anna; Sinetova, Maria; Kryazhov, Sergey; Mironov, Kirill; Zinchenko, Vladislav V.

    2010-01-01

    In living cells, the perception of environmental stress and the subsequent transduction of stress signals are primary events in the acclimation to changes in the environment. Some molecular sensors and transducers of environmental stress cannot be identified by traditional and conventional methods. Based on genomic information, a systematic approach has been applied to the solution of this problem in cyanobacteria, involving mutagenesis of potential sensors and signal transducers in combination with DNA microarray analyses for the genome-wide expression of genes. Forty-five genes for the histidine kinases (Hiks), 12 genes for serine-threonine protein kinases (Spks), 42 genes for response regulators (Rres), seven genes for RNA polymerase sigma factors, and nearly 70 genes for transcription factors have been successfully inactivated by targeted mutagenesis in the unicellular cyanobacterium Synechocystis sp. PCC 6803. Screening of mutant libraries by genome-wide DNA microarray analysis under various stress and non-stress conditions has allowed identification of proteins that perceive and transduce signals of environmental stress. Here we summarize recent progress in the identification of sensory and regulatory systems, including Hiks, Rres, Spks, sigma factors, transcription factors, and the role of genomic DNA supercoiling in the regulation of the responses of cyanobacterial cells to various types of stress. PMID:22294932

  8. A novel potassium channel in photosynthetic cyanobacteria.

    Directory of Open Access Journals (Sweden)

    Manuela Zanetti

    Full Text Available Elucidation of the structure-function relationship of a small number of prokaryotic ion channels characterized so far greatly contributed to our knowledge on basic mechanisms of ion conduction. We identified a new potassium channel (SynK in the genome of the cyanobacterium Synechocystis sp. PCC6803, a photosynthetic model organism. SynK, when expressed in a K(+-uptake-system deficient E. coli strain, was able to recover growth of these organisms. The protein functions as a potassium selective ion channel when expressed in Chinese hamster ovary cells. The location of SynK in cyanobacteria in both thylakoid and plasmamembranes was revealed by immunogold electron microscopy and Western blotting of isolated membrane fractions. SynK seems to be conserved during evolution, giving rise to a TPK (two-pore K(+ channel family member which is shown here to be located in the thylakoid membrane of Arabidopsis. Our work characterizes a novel cyanobacterial potassium channel and indicates the molecular nature of the first higher plant thylakoid cation channel, opening the way to functional studies.

  9. Cultivo mixotrófico da microalga Spirulina platensis em batelada alimentada Mixotrophic growth of Spirulina platensis in fed-batch mode

    Directory of Open Access Journals (Sweden)

    Adriana Muliterno

    2005-12-01

    Full Text Available A Spirulina platensis tem sido estudada devido a seu alto valor protéico, digestibilidade e por apresentar quantidades significativas de ácidos graxos poliinsaturados, vitaminas, fenólicos e ficocianina, podendo ser utilizada na alimentação humana. A utilização de nutrientes de baixo custo é um fator importante na produção da cianobactéria por possibilitar a redução de custos de processo. Objetivou-se com este trabalho estudar o cultivo mixotrófico da S. platensis por meio da adição de uma fonte orgânica de carbono (glicose em modo bateladaalimentada. Foi utilizado um Planejamento Fatorial Completo 2³ para o cultivo e as variáveis de estudo foram a concentração de glicose (0,5 gL-1 e 1,0 gL-1, a diluição do meio Zarrouk (50% e 75% e a iluminância (1800 lux e 3000 lux. A concentração celular máxima obtida foi de 5,38 gL-1 com uma velocidade específica máxima de crescimento de 0,0063 h-1, nas condições de 0,5 gL-1 de glicose, diluição do meio de 75% e iluminância de 3000 lux.The cyanobacterium Spirulina platensis has been studied due to its high content (~65% of highly digestible protein as well as significant amounts of polyunsaturated fatty acids, phenolics, vitamins, minerals and phycocyanin which could be useful in the human nutrition. The use of nutrients of low costs in the cyanobacterium growth could reduce the costs of production. We studied the fed-batch mixotrophic growth of the S. platensis in Zarrouk's medium with glucose (0.5 gL-1 and 1.0 gL-1 as carbon source and also investigated the effects of dilution (50% and 75%, with water and illumination (1,800 lux and 3,000 lux using a 2³ factorial design. The maximum celular concentration of 5.38 gL-1 and maximum specific growth rate of 0.0063 h-1 were obtained with a glucose concentration of 0.5 gL-1, 50% dilution and 1800 lux of illuminance.

  10. Signature proteins for the major clades of Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Mathews Divya W

    2010-01-01

    Full Text Available Abstract Background The phylogeny and taxonomy of cyanobacteria is currently poorly understood due to paucity of reliable markers for identification and circumscription of its major clades. Results A combination of phylogenomic and protein signature based approaches was used to characterize the major clades of cyanobacteria. Phylogenetic trees were constructed for 44 cyanobacteria based on 44 conserved proteins. In parallel, Blastp searches were carried out on each ORF in the genomes of Synechococcus WH8102, Synechocystis PCC6803, Nostoc PCC7120, Synechococcus JA-3-3Ab, Prochlorococcus MIT9215 and Prochlor. marinus subsp. marinus CCMP1375 to identify proteins that are specific for various main clades of cyanobacteria. These studies have identified 39 proteins that are specific for all (or most cyanobacteria and large numbers of proteins for other cyanobacterial clades. The identified signature proteins include: (i 14 proteins for a deep branching clade (Clade A of Gloebacter violaceus and two diazotrophic Synechococcus strains (JA-3-3Ab and JA2-3-B'a; (ii 5 proteins that are present in all other cyanobacteria except those from Clade A; (iii 60 proteins that are specific for a clade (Clade C consisting of various marine unicellular cyanobacteria (viz. Synechococcus and Prochlorococcus; (iv 14 and 19 signature proteins that are specific for the Clade C Synechococcus and Prochlorococcus strains, respectively; (v 67 proteins that are specific for the Low B/A ecotype Prochlorococcus strains, containing lower ratio of chl b/a2 and adapted to growth at high light intensities; (vi 65 and 8 proteins that are specific for the Nostocales and Chroococcales orders, respectively; and (vii 22 and 9 proteins that are uniquely shared by various Nostocales and Oscillatoriales orders, or by these two orders and the Chroococcales, respectively. We also describe 3 conserved indels in flavoprotein, heme oxygenase and protochlorophyllide oxidoreductase proteins that

  11. Genome fluctuations in cyanobacteria reflect evolutionary, developmental and adaptive traits

    Directory of Open Access Journals (Sweden)

    Nylander Johan AA

    2011-06-01

    Full Text Available Abstract Background Cyanobacteria belong to an ancient group of photosynthetic prokaryotes with pronounced variations in their cellular differentiation strategies, physiological capacities and choice of habitat. Sequencing efforts have shown that genomes within this phylum are equally diverse in terms of size and protein-coding capacity. To increase our understanding of genomic changes in the lineage, the genomes of 58 contemporary cyanobacteria were analysed for shared and unique orthologs. Results A total of 404 protein families, present in all cyanobacterial genomes, were identified. Two of these are unique to the phylum, corresponding to an AbrB family transcriptional regulator and a gene that escapes functional annotation although its genomic neighbourhood is conserved among the organisms examined. The evolution of cyanobacterial genome sizes involves a mix of gains and losses in the clade encompassing complex cyanobacteria, while a single event of reduction is evident in a clade dominated by unicellular cyanobacteria. Genome sizes and gene family copy numbers evolve at a higher rate in the former clade, and multi-copy genes were predominant in large genomes. Orthologs unique to cyanobacteria exhibiting specific characteristics, such as filament formation, heterocyst differentiation, diazotrophy and symbiotic competence, were also identified. An ancestral character reconstruction suggests that the most recent common ancestor of cyanobacteria had a genome size of approx. 4.5 Mbp and 1678 to 3291 protein-coding genes, 4%-6% of which are unique to cyanobacteria today. Conclusions The different rates of genome-size evolution and multi-copy gene abundance suggest two routes of genome development in the history of cyanobacteria. The expansion strategy is driven by gene-family enlargment and generates a broad adaptive potential; while the genome streamlining strategy imposes adaptations to highly specific niches, also reflected in their different

  12. Genome fluctuations in cyanobacteria reflect evolutionary, developmental and adaptive traits

    Science.gov (United States)

    2011-01-01

    Background Cyanobacteria belong to an ancient group of photosynthetic prokaryotes with pronounced variations in their cellular differentiation strategies, physiological capacities and choice of habitat. Sequencing efforts have shown that genomes within this phylum are equally diverse in terms of size and protein-coding capacity. To increase our understanding of genomic changes in the lineage, the genomes of 58 contemporary cyanobacteria were analysed for shared and unique orthologs. Results A total of 404 protein families, present in all cyanobacterial genomes, were identified. Two of these are unique to the phylum, corresponding to an AbrB family transcriptional regulator and a gene that escapes functional annotation although its genomic neighbourhood is conserved among the organisms examined. The evolution of cyanobacterial genome sizes involves a mix of gains and losses in the clade encompassing complex cyanobacteria, while a single event of reduction is evident in a clade dominated by unicellular cyanobacteria. Genome sizes and gene family copy numbers evolve at a higher rate in the former clade, and multi-copy genes were predominant in large genomes. Orthologs unique to cyanobacteria exhibiting specific characteristics, such as filament formation, heterocyst differentiation, diazotrophy and symbiotic competence, were also identified. An ancestral character reconstruction suggests that the most recent common ancestor of cyanobacteria had a genome size of approx. 4.5 Mbp and 1678 to 3291 protein-coding genes, 4%-6% of which are unique to cyanobacteria today. Conclusions The different rates of genome-size evolution and multi-copy gene abundance suggest two routes of genome development in the history of cyanobacteria. The expansion strategy is driven by gene-family enlargment and generates a broad adaptive potential; while the genome streamlining strategy imposes adaptations to highly specific niches, also reflected in their different functional capacities. A few

  13. Determination of Oxygen Production by Cyanobacteria in Desert Environment Soil

    Science.gov (United States)

    Bueno Prieto, J. E.

    2009-12-01

    The cyanobacteria have been characterized for being precursor in the production of oxygen. By means of photosynthetic reactions, they provide oxygen to the environment that surrounds them and they capture part of surrounding dioxide of carbon. This way it happened since the primitive Earth until today. Besides, these microorganisms can support the harmful effects of ultraviolet radiation. The presence of cyanobacterias in an environment like a dry tropical bioma, such as the geographical location called Desert of The Tatacoa (Huila - Colombia), is determinant to establish parameters in the search of biological origin of atmospheric oxygen detected in Mars. In that case, I work with a random sample of not rhizospheric soil, taken to 15 cm of depth. After determining the presence of cyanobacterias in the sample, this one was in laboratory to stimulate the oxygen production. The presence of oxygen in Mars is very interesting. Since oxygen gas is very reactive, it disappear if it is not renewed; the possibility that this renovation of oxygen has a biological origin is encouraging, bearing in mind that in a dry environment and high radiation such as the studied one, the production of oxygen by cyanobacterias is notable. Also it is necessary to keep in mind that the existence of cyanobacterias would determine water presence in Mars subsoil and the nutrients cycles renovation. An interesting exploration possibility for some future space probe to Mars might be the study of worldwide distribution of oxygen concentration in this planet and this way, indentify zones suitable for microbian life.

  14. Toxicity of chlorpyrifos on some marine cyanobacteria species

    International Nuclear Information System (INIS)

    Shoaib, N.; Siddiqui, A.; Khalid, H.

    2012-01-01

    Pakistan is an agricultural country and a wide variety of pesticides are used on its cropland. Pesticides pose serious threats to the natural ecosystem. In the present study cyanobacteria (blue green algae) were used to assess the ecotoxicological effect of chlorpyrifos (organophosphate pesticide). Cyanobacteria are the base of the food web providing food resource to consumers in higher trophic level. Cyanobacteria were isolated and purified from water samples collected from Manora channel. Fast growing cultures of cyanobacteria were used to assess the toxicity of test pesticide . The Light and Dark method was used to determine the primary production of the organisms. The acute toxicity of chlorpyrifos was determined by calculating IC/sub 50/ of the test organisms. The IC/sub 50/ was found to be 0.074, 0.013, 0.08 and 0.3 ppm for Synechocystis aquatilis, Komvophoron minutum, Gloeocapsa crepidinum and Gloeocapsa sanguinea when exposed to chlorpyrifos pesticide . Laboratory experiments with cyanobacteria have demonstrated that organophosphate pesticides are potent inhibitors of photosynthesis. (author)

  15. Human health effects associated with exposure to toxic Cyanobacteria – what is the evidence?

    Science.gov (United States)

    Reports of toxic cyanobacteria blooms are increasing worldwide, as warming water and eutrophic surface water systems support the development of blooms. As awareness of toxic cyanobacteria blooms increases, reports of associated human and animal illnesses have also increased, but ...

  16. Oxygen and the light-dark cycle of nitrogenase activity in two unicellular cyanobacteria

    NARCIS (Netherlands)

    Compaore, J.; Stal, L.J.

    2010-01-01

    Cyanobacteria capable of fixing dinitrogen exhibit various strategies to protect nitrogenase from inactivation by oxygen. The marine Crocosphaera watsonii WH8501 and the terrestrial Gloeothece sp. PCC6909 are unicellular diazotrophic cyanobacteria that are capable of aerobic nitrogen fixation. These

  17. Expanding models of lake trophic state to predict cyanobacteria in lakes

    Science.gov (United States)

    Background/Question/Methods: Cyanobacteria are a primary taxonomic group associated with harmful algal blooms in lakes. Understanding the drivers of cyanobacteria presence has important implications for lake management and for the protection of human and ecosystem health. Chlor...

  18. Removal of Nitrate and Phosphate from Municipal Wastewater Sludge by Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda

    Directory of Open Access Journals (Sweden)

    Jalal K.C.A

    2011-12-01

    Full Text Available Nitrate and phosphorus in wastewater contribute to health and environmental threats as they are linked to illnesses as well as ecosystem disruption via algal blooms in contaminated water bodies. Based on above perspectives a comparative study was conducted on three local freshwater microalgae:Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda to evaluate their effects on nitrate and phosphorus removal from municipal wastewater sludge (MWS. Algae performance in removing nitrate and phosphorus was evaluated by measuring nitrate and phosphorus content of MWS incubated with the strains for 7 days. Instantaneous readings were taken every 48 hours to determine periodic levels of the nutrients phosphate and nitrate. BOD5 was also evaluated to identify the strain with the most robust growth that would demand for oxygen the most in the dark. Spirulina platensis was shown as the most efficient microalgae to reduce nitrate in MWS and the best-growing among the three strains, while Chlorella vulgaris removed phosphorus the most effectively. Thus Spirulina and Chlorella could be potential candidates by showing their intrinsic merit for the reduction of phosphate and nitrate in wastewater treatment.ABSTRAK: Nitrat dan fosforus dalam air sisa menggugat kesihatan dan mengancam alam sekitar memandangkan ia berkait dengan penyakit-penyakit serta gangguan terhadap ekosistem melalui pembiakan alga dalam air yang tercemar. Berdasarkan perspektif di atas, satu kajian perbandingan telah dijalankan terhadap tiga mikro alga air tawar tempatan : Chlorella vulgaris, Spirulina platensis dan Scenedesmus quadricauda untuk dinilai kesannya terhadap penyingkiran nitrat dan fosforus dari enap cemar air sisa bandaran (municipal wastewater sludge (MWS. Kebolehan alga dalam penyingkiran nitrat dan fosforus dikaji dengan menyukat kandungan nitrat dan fosforus dalam MWS yang dieramkan dengan strain ini selama 7 hari. Bacaan serta-merta diambil setiap 48 jam untuk

  19. Phylogeny of culturable cyanobacteria from Brazilian mangroves.

    Science.gov (United States)

    Silva, Caroline Souza Pamplona; Genuário, Diego Bonaldo; Vaz, Marcelo Gomes Marçal Vieira; Fiore, Marli Fátima

    2014-03-01

    The cyanobacterial community from Brazilian mangrove ecosystems was examined using a culture-dependent method. Fifty cyanobacterial strains were isolated from soil, water and periphytic samples collected from Cardoso Island and Bertioga mangroves using specific cyanobacterial culture media. Unicellular, homocytous and heterocytous morphotypes were recovered, representing five orders, seven families and eight genera (Synechococcus, Cyanobium, Cyanobacterium, Chlorogloea, Leptolyngbya, Phormidium, Nostoc and Microchaete). All of these novel mangrove strains had their 16S rRNA gene sequenced and BLAST analysis revealed sequence identities ranging from 92.5 to 99.7% when they were compared with other strains available in GenBank. The results showed a high variability of the 16S rRNA gene sequences among the genotypes that was not associated with the morphologies observed. Phylogenetic analyses showed several branches formed exclusively by some of these novel 16S rRNA gene sequences. BLAST and phylogeny analyses allowed for the identification of Nodosilinea and Oxynema strains, genera already known to exhibit poor morphological diacritic traits. In addition, several Nostoc and Leptolyngbya morphotypes of the mangrove strains may represent new generic entities, as they were distantly affiliated with true genera clades. The presence of non-ribosomal peptide synthetase, polyketide synthase, microcystin and saxitoxin genes were detected in 20.5%, 100%, 37.5% and 33.3%, respectively, of the 44 tested isolates. A total of 134 organic extracts obtained from 44 strains were tested against microorganisms, and 26% of the extracts showed some antimicrobial activity. This is the first polyphasic study of cultured cyanobacteria from Brazilian mangrove ecosystems using morphological, genetic and biological approaches. Copyright © 2014 Elsevier GmbH. All rights reserved.

  20. Microbial synthesis of silver nanoparticles by Streptomyces glaucus and Spirulina platensis

    International Nuclear Information System (INIS)

    Tsibakhashvili, N.Ya.; Kirkesali, E.I.; Pataraya, D.T.

    2011-01-01

    For the first time in Georgia a novel actinomycete strain Streptomyces glaucus 71 MD isolated from a soy rhizosphere has been used for microbial synthesis of silver nanoparticles. The Transmission Electron Microscopy (TEM) images revealed that most of the particles produced by these microorganisms from AgNO 3 are spherical-like in shape with an average size of 13 nm. The Scanning Electron Microscope (SEM) allowed one to observe extracellular synthesis of nanoparticles, which has many advantages from the point of view of applications. Production of silver nanoparticles proceeds extracellularly with the participation of another microorganism, blue-green microalgae Spirulina platensis. It is shown that the production rate of the nanoparticles depends not only on the initial concentration of AgNO 3 but also varies with time in a no monotonic way

  1. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates

    Directory of Open Access Journals (Sweden)

    Nur Maulida Safitri

    2017-08-01

    Full Text Available The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51 was identified and synthetized, which exhibited 45.98 ± 1.7% at concentration 128.15 µg/mL. Therefore, S. platensis is indicated as a potential therapeutic source for combating oxidative stress.

  2. Scavenging of peroxynitrite by phycocyanin and phycocyanobilin from Spirulina platensis: protection against oxidative damage to DNA.

    Science.gov (United States)

    Bhat, V B; Madyastha, K M

    2001-07-13

    Peroxynitrite (ONOO(-)) is known to inactivate important cellular targets and also mediate oxidative damage in DNA. The present study has demonstrated that phycocyanin, a biliprotein from spirulina platensis and its chromophore, phycocyanobilin (PCB), efficiently scavenge ONOO(-), a potent physiological inorganic toxin. Scavenging of ONOO(-) by phycocyanin and PCB was established by studying their interaction with ONOO(-) and quantified by using competition kinetics of pyrogallol red bleaching assay. The relative antioxidant ratio and IC(50) value clearly indicate that phycocyanin is a more efficient ONOO(-) scavenger than PCB. The present study has also shown that PCB significantly inhibits the ONOO(-)-mediated single-strand breaks in supercoiled plasmid DNA in a dose-dependent manner with an IC(50) value of 2.9 +/- 0.6 microM. These results suggest that phycocyanin, has the ability to inhibit the ONOO(-)-mediated deleterious biological effects and hence has the potential to be used as a therapeutic agent. Copyright 2001 Academic Press.

  3. PRODUKSI DAN KANDUNGAN NUTRISI Spirulina fusiformis YANG DIKULTUR DENGAN PENCAHAYAAN MONOKROMATIS LIGHT EMITTING DIODES (LEDs

    Directory of Open Access Journals (Sweden)

    Muhammad Firdaus

    2015-06-01

    yang bersumber dari LED dengan cahaya monokromatis merah (M, biru (B, dan biru-merah (BM, serta cahaya dari lampu fluoresens sebagai kontrol (K. Puncak kepadatan sel terjadi pada hari ke-18 dengan kepadatan masing-masing sebanyak 5,56 x 104 sel/mL (M; 1,65 x 104 sel/mL (B; 4,15 x 104 sel/mL (BM; dan 4,56 x 104 sel/mL (K. Perlakuan pencahayaan LED dengan cahaya monokromatis merah mencapai biomassa panen tertinggi sebesar 3,91 mg/mL dengan kandungan protein 49,77%; lemak 19,61%; karbohidrat 6,15%; serat kasar 0,00%; dan abu 24,48%. Pencahayaan dengan LED merah berpotensi diaplikasikan sebagai sumber cahaya dalam produksi Spirulina.

  4. Improvement of lipid yield from microalgae Spirulina platensis using ultrasound assisted osmotic shock extraction method

    Science.gov (United States)

    Adetya, NP; Hadiyanto, H.

    2018-01-01

    Microalgae Spirulina sp. has been identified as potential source of natural food supplement and food colorant. The high water content of microalgae (70-90%) causes an obstacle in biomass dehydration which requires large amounts of energy, eventually damaging the lipid in the microalgae. Therefore, the lipid must be extracted by using a suitable method which complies to wet biomass conditions. One of the methods is applying osmotic shock. This study was aimed to investigate the influence of osmotic agent (NaCl) concentration (10-30%) and extraction time (20-50 min) on yield of lipid and also to determine the optimal conditions in the extraction process through response surface methodology. The extraction was conducted at a temperature of 40°C under ultrasound frequency of 40 kHz. The result showed that the optimum yield lipid obtained was 6.39% in 16.98% NaCl concentration for 36 minutes 10 seconds.

  5. Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis

    OpenAIRE

    Figueira, Felipe da Silva; Crizel, Tainara de Morais; Silva, Camila Rubira; Salas-Mellado, Myriam de las Mercedes

    2011-01-01

    Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha). Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães ...

  6. Characteristic of resistant ionization-radiation and its relationship with polysaccharide contents in spirulina

    International Nuclear Information System (INIS)

    Wang Zhiping; Xu Bujin

    2001-01-01

    The anti-radiation capacities of intact filaments, no-sheath filaments and cells of 4 kinds of Spiralina strains (Ss-V, Sp-F, Sp-Z and Sp-D) treated by "6"0Co γ-rays were studied. The relationship between polysaccharide contents and anti-radiation capacity of 4 strains were also detected. The results showed that Spirulina is highly resistant toγ-radiation, however there were significant differences with various strains. The order of anti-radiation capacity is Ss-V > Sp-F > Sp-Z > Sp-D. Moreover, the anti-radiation capacity were remarkably related with polysaccharide contents in the 4 strains. This showed that polysaccharide is very important for raising and maintain-ing super anti-radiation capacity in Spiralina. (authors)

  7. Biodiesel Production from Wet Spirulina sp. by One-Step Extraction-Transesterification

    Directory of Open Access Journals (Sweden)

    Surya Pradana Yano

    2018-01-01

    Full Text Available Microalgae has gained immense interests as the raw material for biofuel production. The lipid content in microalgae can be converted into biodiesel through conventional method which involves separated process of extraction and transesterification. In this study, the production of biodiesel from Spirulina sp. was performed through one-step extraction-transesterification using KOH as base catalyst to simplify the production of biodiesel. The mixture of methanol-hexane was employed as both solvent and reactant in the process. The resulting biodiesel was found to be mainly composed of methyl oleate and methyl palmitate. On the other hand, increasing the reaction temperature and reducing the quantity of methanol in solvent mixture would also increase the yield of biodiesel. The optimum methanol-hexane volumetric ratio and temperature which gave the highest biodiesel yield were 3:7 and 50°C, respectively.

  8. Marine cyanobacteria as sources of new biotechnological applications

    Directory of Open Access Journals (Sweden)

    Vitor Vasconcelos

    2014-06-01

    Bioactive compounds from cyanobacteria may also have allelopathic activity with potential use to control algal blooms or as antifouling in the marine environment (Leão et al., 2012, Antunes et al., 2013. We have isolated and characterized for the first time allelopathic compounds named Portoamides that act synergistically to prevent the growth of some microalgae (Leão et al., 2010. Cyanobacteria extracts can also prevent the development of some invertebrates such as sea urchins and mussels (Martins et al., 2007 and so they can be candidates to develop antifouling agents that are environmentally friendly. The potential of cyanobacteria as source of new bioactive compounds is enormous, with the advantage of being applicable in many different areas of biotechnology, with many industrial applications.

  9. Extending the biosynthetic repertoires of cyanobacteria and chloroplasts

    DEFF Research Database (Denmark)

    Nielsen, Agnieszka Janina Zygadlo; Mellor, Silas Busck; Vavitsas, Konstantinos

    2016-01-01

    The chloroplasts found in plants and algae, and photosynthetic microorganisms such as cyanobacteria, are emerging hosts for sustainable production of valuable biochemicals, using only inorganic nutrients, water, CO2 and light as inputs. In the past decade, many bioengineering efforts have focused...... on metabolic engineering and synthetic biology in the chloroplast or in cyanobacteria for the production of fuels, chemicals, as well as complex, high-value bioactive molecules. Biosynthesis of all these compounds can be performed in photosynthetic organelles/organisms by heterologous expression...... of chloroplasts and cyanobacteria as biosynthetic compartments and hosts, and we estimate the production levels to be expected from photosynthetic hosts in light of the fraction of electrons and carbon that can potentially be diverted from photosynthesis. The supply of reducing power, in the form of electrons...

  10. CyanoClust: comparative genome resources of cyanobacteria and plastids.

    Science.gov (United States)

    Sasaki, Naobumi V; Sato, Naoki

    2010-01-01

    Cyanobacteria, which perform oxygen-evolving photosynthesis as do chloroplasts of plants and algae, are one of the best-studied prokaryotic phyla and one from which many representative genomes have been sequenced. Lack of a suitable comparative genomic database has been a problem in cyanobacterial genomics because many proteins involved in physiological functions such as photosynthesis and nitrogen fixation are not catalogued in commonly used databases, such as Clusters of Orthologous Proteins (COG). CyanoClust is a database of homolog groups in cyanobacteria and plastids that are produced by the program Gclust. We have developed a web-server system for the protein homology database featuring cyanobacteria and plastids. Database URL: http://cyanoclust.c.u-tokyo.ac.jp/.

  11. Exploring Marine Cyanobacteria for Lead Compounds of Pharmaceutical Importance

    Directory of Open Access Journals (Sweden)

    Bushra Uzair

    2012-01-01

    Full Text Available The Ocean, which is called the “mother of origin of life,” is also the source of structurally unique natural products that are mainly accumulated in living organisms. Cyanobacteria are photosynthetic prokaryotes used as food by humans. They are excellent source of vitamins and proteins vital for life. Several of these compounds show pharmacological activities and are helpful for the invention and discovery of bioactive compounds, primarily for deadly diseases like cancer, acquired immunodeficiency syndrome (AIDS, arthritis, and so forth, while other compounds have been developed as analgesics or to treat inflammation, and so forth. They produce a large variety of bioactive compounds, including substances with anticancer and antiviral activity, UV protectants, specific inhibitors of enzymes, and potent hepatotoxins and neurotoxins. Many cyanobacteria produce compounds with potent biological activities. This paper aims to showcase the structural diversity of marine cyanobacterial secondary metabolites with a comprehensive coverage of alkaloids and other applications of cyanobacteria.

  12. Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ut This Database Database Description Download License Update History of This Database Site Policy | Contact Us Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Protein (Cyanobacteria) Data detail Data name Protein (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  13. Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available of This Database Site Policy | Contact Us Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Taxon (Cyanobacteria) Data detail Data name Taxon (Cyanobacteria) DOI 10...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  14. Limited Multiplication of Symbiotic Cyanobacteria of Azolla spp. on Artificial Media

    Science.gov (United States)

    Tang, L. F.; Watanabe, I.; Liu, C. C.

    1990-01-01

    We examined various media and conditions to isolate symbiotic cyanobacteria from the leaf cavities of Azolla spp. Cyanobacteria survived and multiplied to a limited extent on a medium with fructose, Casamino Acids, yeast extract, and NaNO3 under 1% O2. These cyanobacteria were antigenically identical to the endosymbionts. Images PMID:16348366

  15. Lysogenic infection in sub-tropical freshwater cyanobacteria cultures and natural blooms

    NARCIS (Netherlands)

    Steenhauer, L.M.; Pollard, P.C.; Brussaard, C.P.D.; Säwström, C.

    2014-01-01

    Lysogeny has been reported for a few freshwater cyanobacteria cultures, but it is unknown how prevalent it is in freshwater cyanobacteria in situ. Here we tested for lysogeny in (a) cultures of eight Australian species of subtropical freshwater cyanobacteria; (b) seven strains of one species:

  16. Production of Spirulina sp by utilization of wastewater from the powder type energy drinks

    Science.gov (United States)

    Sumantri, Indro; Priyambada, Ika Bagus

    2015-12-01

    Wastewater of energy drink type of powder produced when the the production equipment required cleaning treatment to produce one taste to others. These equipments washed by water, so that, it produced wastewater. It contains high organic substances and classified as high degradable due to food product. The content of wastewater is high carbon and nitrogen substances. Microalgae is an autotrophic microorganism, live without carbon presence, utilized to digest the substances in wastewater especially for nitrogen substances. Spirulina sp is the type of microalgae selected to utilize the wastewater of energy drink, the selection criteria is the size of Spirulina sp is relatively large and easy to separated from its solution. The experiment conducted by cultivate the seeding microalgae with certain nutrients until the certain volume. The synthetic wastewater obtained from one of energy drink type of powder with commercial brand as Kuku Bima Ener-G, the wastewater concentration selected under the close to the real condition of wastewater as basis of COD measurement (6 sachet/L or COD of 12.480mg/L) and aqueous concentration (1 sachet/L or COD of 2080mg/L). The batch experiments with 1L volume conducted and with variable of percent volume of wastewater added in order to observe the growth of microlagae. The response of the microalgae growth obtained by increasing the optical density of the microalgae solution and continued by calculation for the growth rate of microalgae. The result of the experiments indicated that for the aqueous concentration (1 sachet/L or COD of 2080mg/L) the optimum added of wastewater is 40 % with growrate of 0.55/day while for the concentrated wastewater (6 sachet/L or COD of 12.480mg/L), the optimum condition is 25 % wastewater added with growth rate of 0.43/day.

  17. Variation of Spirulina maxima biomass production in different depths of urea-used culture medium.

    Science.gov (United States)

    Affan, Md-Abu; Lee, Dae-Won; Al-Harbi, Salim Marzoog; Kim, Han-Jun; Abdulwassi, Najah Ibrahim; Heo, Soo-Jin; Oh, Chulhong; Park, Heung-Sik; Ma, Chae Woo; Lee, Hyeon-Yong; Kang, Do-Hyung

    2015-01-01

    Fewer studies have assessed the outdoor cultivation of Spirulina maxima compared with S. platensis, although the protein content of S. maxima is higher than S. platensis. Spirulina growth medium requires an increased amount of NaHCO3, Na2CO3, and NaNO3, which increases the production cost. Therefore, the current study used a low-cost but high-efficiency biomass production medium (Medium M-19) after testing 33 different media. The medium depth of 25 cm (group A) was sub-divided into A1 (50% cover with a black curtain (PolyMax, 12 oz ultra-blackout), A2 (25% cover), and A3 (no cover). Similarly the medium depths of 30 and 35 cm were categorized as groups B (B1, B2, and B3) and C (C1, C2, and C3), respectively, and the effects of depth and surface light availability on growth and biomass production were assessed. The highest biomass production was 2.05 g L-1 in group A2, which was significantly higher (p maxima died in B1 and C1 on the fifth day of culture. The biochemical composition of the biomass obtained from A2 cultures, including protein, carbohydrate, lipid, moisture, and ash, was 56.59%, 14.42%, 0.94%, 5.03%, and 23.02%, respectively. Therefore, S. maxima could be grown outdoors with the highest efficiency in urea-enriched medium at a 25-cm medium depth with 25% surface cover or uncovered.

  18. Stable Isolation of Phycocyanin from Spirulina platensis Associated with High-Pressure Extraction Process

    Directory of Open Access Journals (Sweden)

    Kyung-Hwan Jung

    2013-01-01

    Full Text Available A method for stably purifying a functional dye, phycocyanin from Spirulina platensis was developed by a hexane extraction process combined with high pressure. This was necessary because this dye is known to be very unstable during normal extraction processes. The purification yield of this method was estimated as 10.2%, whose value is 3%–5% higher than is the case from another conventional separation method using phosphate buffer. The isolated phycocyanin from this process also showed the highest purity of 0.909 based on absorbance of 2.104 at 280 nm and 1.912 at 620 nm. Two subunits of phycocyanin namely α-phycocyanin (18.4 kDa and β-phycocyanin (21.3 kDa were found to remain from the original mixtures after being extracted, based on SDS-PAGE analysis, clearly demonstrating that this process can stably extract phycocyanin and is not affected by extraction solvent, temperature, etc. The stability of the extracted phycocyanin was also confirmed by comparing its DPPH (α,α-diphenyl-β-picrylhydrazyl scavenging activity, showing 83% removal of oxygen free radicals. This activity was about 15% higher than that of commercially available standard phycocyanin, which implies that the combined extraction method can yield relatively intact chromoprotein through absence of degradation. The results were achieved because the low temperature and high pressure extraction effectively disrupted the cell membrane of Spirulina platensis and degraded less the polypeptide subunits of phycocyanin (which is a temperature/pH-sensitive chromoprotein as well as increasing the extraction yield.

  19. Application of Low cost Spirulina growth medium using Deep sea water

    Science.gov (United States)

    Lim, Dae-hack; Kim, Bong-ju; Lee, Sung-jae; Choi, Nag-chul; Park, Cheon-young

    2017-04-01

    Deep-sea water has a relatively constant temperature, abundant nutrients such as calcium, magnesium, nitrates, and phosphates, etc., and stable water quality, even though there might be some variations of their compositions according to collection places. Thus, deep-sea water would be a good substrate for algal growth and biomass production since it contains various nutrients, including a fluorescent red pigment, and β-carotene, etc. The aim of this study was to investigate the economics of a culture condition through comparative analysis to Spirulina platensis growth characteristic under various medium conditions for cost-effective production of Spirulina sp.. Growth experiments were performed with S. platensis under various culture medium conditions (deep sea water + SP medium). Growth tests for culture medium demonstrated that the deep sea water to SP medium ratio of 50:50(W/W) was effective in S. platensis with the maximum biomass (1.35g/L) and minimum medium making cost per production mass (133.28 KRW/g). Parameter estimation of bio-kinetics (maximum growth rate and yield) for low cost medium results showed that the maximum growth rate and yield of N, P, K were obtained under deep sea water to SP medium ratio of 50:50(W/W) of 0.057 1/day and 0.151, 0.076, 0.123, respectively. Acknowledgment : "This research was a part of the project titled 'Development of microalgae culture technique for cosmetic materials based on ocean deep sea water(20160297)', funded by the Ministry of Oceans and Fisheries, Korea."

  20. PEMANFAATAN Spirulina platensis SEBAGAI SUPLEMEN PROTEIN SEL TUNGGAL (PST MENCIT (Mus musculus

    Directory of Open Access Journals (Sweden)

    Haryo Kuntoro Adi

    2007-06-01

    Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

  1. Toolboxes for cyanobacteria: Recent advances and future direction.

    Science.gov (United States)

    Sun, Tao; Li, Shubin; Song, Xinyu; Diao, Jinjin; Chen, Lei; Zhang, Weiwen

    2018-05-03

    Photosynthetic cyanobacteria are important primary producers and model organisms for studying photosynthesis and elements cycling on earth. Due to the ability to absorb sunlight and utilize carbon dioxide, cyanobacteria have also been proposed as renewable chassis for carbon-neutral "microbial cell factories". Recent progresses on cyanobacterial synthetic biology have led to the successful production of more than two dozen of fuels and fine chemicals directly from CO 2 , demonstrating their potential for scale-up application in the future. However, compared with popular heterotrophic chassis like Escherichia coli and Saccharomyces cerevisiae, where abundant genetic tools are available for manipulations at levels from single gene, pathway to whole genome, limited genetic tools are accessible to cyanobacteria. Consequently, this significant technical hurdle restricts both the basic biological researches and further development and application of these renewable systems. Though still lagging the heterotrophic chassis, the vital roles of genetic tools in tuning of gene expression, carbon flux re-direction as well as genome-wide manipulations have been increasingly recognized in cyanobacteria. In recent years, significant progresses on developing and introducing new and efficient genetic tools have been made for cyanobacteria, including promoters, riboswitches, ribosome binding site engineering, clustered regularly interspaced short palindromic repeats/CRISPR-associated nuclease (CRISPR/Cas) systems, small RNA regulatory tools and genome-scale modeling strategies. In this review, we critically summarize recent advances on development and applications as well as technical limitations and future directions of the genetic tools in cyanobacteria. In addition, toolboxes feasible for using in large-scale cultivation are also briefly discussed. Copyright © 2018 Elsevier Inc. All rights reserved.

  2. Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?

    Science.gov (United States)

    Sato, Naoki

    2015-10-01

    Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  3. Hot and toxic: Temperature regulates microcystin release from cyanobacteria.

    Science.gov (United States)

    Walls, Jeremy T; Wyatt, Kevin H; Doll, Jason C; Rubenstein, Eric M; Rober, Allison R

    2018-01-01

    The mechanisms regulating toxin release by cyanobacteria are poorly understood despite the threat cyanotoxins pose to water quality and human health globally. To determine the potential for temperature to regulate microcystin release by toxin-producing cyanobacteria, we evaluated seasonal patterns of water temperature, cyanobacteria biomass, and extracellular microcystin concentration in a eutrophic freshwater lake dominated by Planktothrix agardhii. We replicated seasonal variation in water temperature in a concurrent laboratory incubation experiment designed to evaluate cause-effect relationships between temperature and toxin release. Lake temperature ranged from 3 to 27°C and cyanobacteria biomass increased with warming up to 18°C, but declined rapidly thereafter with further increases in temperature. Extracellular microcystin concentration was tightly coupled with temperature and was most elevated between 20 and 25°C, which was concurrent with the decline in cyanobacteria biomass. A similar trend was observed in laboratory incubations where productivity-specific microcystin release was most elevated between 20 and 25°C and then declined sharply at 30°C. We applied generalized linear mixed modeling to evaluate the strength of water temperature as a predictor of cyanobacteria abundance and microcystin release, and determined that warming≥20°C would result in a 36% increase in microcystin release when Chlorophyll a was ≤50μgl -1 . These results show a temperature threshold for toxin release in P. agardhii, which demonstrates a potential to use water temperature to forecast bloom severity in eutrophic lakes where blooms can persist year-round with varying degrees of toxicity. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Gambaran Sel Eosinofil, Monosit, dan Basofil Setelah Pemberian Spirulina pada Ayam yang Diinfeksi Virus Flu Burung (OBSERVATION OF EOSINOPHILS, MONOCYTES, AND BASOPHILS AFTER TREATED WITH SPIRULINA IN CHICKENS THAT INFECTED WITH AVIAN INFLUENZA VIRUS

    Directory of Open Access Journals (Sweden)

    Widya Paramita Lokapirnasari

    2015-05-01

    Full Text Available High Pathogenecity Avian Influenza (HPAI viruses have high virulence and can frequently causesudden death on birds. The aims of this research was to know the role of Spirulina to a number ofmonocytes and lymphocytes in the blood of chickens which infected with the H5N1 virus. This researchconsisted of three levels of treatment in which each level given Spirulina 0%, 10%, 20% in the fresh wateralgae as drinking water. Each treatment consisted of seven replicates, and the treatment was done sincethe chickens at age 19 until 44 days ( for 25 days. Artificial infection of the chickens with the virus waschallenged by using AI (H5N1 104 EID 50 (A/Ck/Indonesia/BL/03 with route to the respiratory tract (nosedrops 0,1 mL starting on day 19. The results showed that there were a significant difference (p<0.05 ontreatment that given Spirulina at doses of 0%, 10% and 20% for the number ofn monocytes, eosinophils,whereas no significant difference (p > 0.05 was observed in basophils.

  5. Influência do consumo de diferentes níveis de Spirulina no desenvolvimento e perfil lipídico de ratos

    Directory of Open Access Journals (Sweden)

    Lidiane Moreira Chiattoni

    2015-04-01

    Full Text Available Spirulina é uma cianobactéria que vem sendo produzida e estudada por suas propriedades nutricionais e por seus benefícios à saúde. Neste estudo, avaliou-se a influência de dietas acrescidas de diferentes concentrações de Spirulina sobre o desenvolvimento corporal e o perfil lipídico de ratos. Foram utilizados 24 ratos Wistar, alimentados, durante 40 dias, com quatro dietas isoproteicas (10% distintas, sendo seis animais por grupo: 1 Dieta controle (AIN93G adaptada; 2 Dieta S1 (8,8% de Spirulina; 3 Dieta S2 (17,6% de Spirulina; 4 Dieta S3 (26,4% de Spirulina. Foram avaliados parâmetros nutricionais e o perfil lipídico dos animais, cujos dados foram analisados estatisticamente por Análise de Variância, seguida do teste de Tukey, a 5% de significância (p ≤ 0,05. O tratamento com 8,8% de Spirulina mostrou-se equivalente ao controle, apresentando respostas mais adequadas de CEA, medidas de crescimento e lipídios séricos. Já o S2 não foi capaz de promover um bom desenvolvimento corporal, comparado com o do controle, além de elevar os níveis de colesterol total e LDL-c. O tratamento S3 apresentou somente valores estatisticamente diferentes de HDL-c, quando comparado com os do controle (p ≤ 0,05. Conclui-se que, no tempo e condições do estudo, o tratamento S3, único com Spirulina como fonte exclusiva de proteína, foi capaz de substituir a fonte proteica padrão (caseína na dieta para roedores, promovendo o adequado desenvolvimento corporal e lipídico dos animais.

  6. Pressurized liquid extracts from Spirulina platensis microalga Determination of their antioxidant activity and preliminary analysis by micellar electrokinetic chromatography

    OpenAIRE

    Herrero, Miguel; Ibáñez, Elena; Señorans, F. Javier; Cifuentes, Alejandro

    2004-01-01

    In this work, different extracts from the microalga Spirulina platensis are obtained using pressurized liquid extraction (PLE) and four different solvents (hexane, light petroleum, ethanol andwater). Different extraction temperatures (115 and 170 ◦C) were tested using extraction times ranging from 9 to 15 min. The antioxidant activity of the different extracts is determined by means of an in vitro assay using a free radical method. Moreover, a new and fast method is developed using m...

  7. The Effect of Active Principles of Cilantro and Spirulina Powder on Lead Antagonism to Copper and Chromium in Carassius gibelio

    Directory of Open Access Journals (Sweden)

    Mărioara Nicula

    2017-11-01

    Full Text Available The goal of our work was to highlight the detoxifying potential of the active principles from lyophilized cilantro and spirulina in experimental contamination with lead, to Carassius gibelio, and their effect on lead antagonism to copper and chromium. 120 Prussian carps, weighing 22-25 g each were divided according to the following treatments for 21 days: C group (without treatment, E1 group (75 ppm Pb into water as Pb(NO32x ½H2O, E2 group (75 ppm Pb into water+2% lyophilized cilantro in feed, E3 group (75 ppm Pb into water+2% lyophilized spirulina in feed. At the end of the experimental period, tissue samples (gills, muscles myotome– epaxial, heart, skin and scales, intestine, liver, brain, gonads, kidney were collected after a starving for 12 hours, and fish euthanasia with clove oil. Determination of Cu and Cr concentration in biological samples was performed using atomic absorption spectrophotometer AAS-VARIAN. Pb addition into water in dose of 75 ppm, has resulted in Cu and Cr mobilization from fish tissues. Decreasing of Cu tissue level occurred less intensive in tissues sampled from groups receiving cilantro and spiriulina powder in feed, maximum efficiency in the counteracting the antagonism against Pb showing spirulina on the heart, liver, and kidney. Cr was maintained at relatively low values, although, cilantro powder has induced in some wise the Pb complexing. In contrast, the freeze-dried spirulina brought the tissue level of Cr close to that of the control group or even has determined its more efficient takeover from the feed.

  8. Effect of Spirulina Intervention on Oxidative Stress, Antioxidant Status, and Lipid Profile in Chronic Obstructive Pulmonary Disease Patients

    Directory of Open Access Journals (Sweden)

    Md. Ismail

    2015-01-01

    Full Text Available Background and Objective. Oxidative stress is intimately associated with many diseases, including chronic obstructive pulmonary disease (COPD. Study objectives include a comparison of the oxidative stress, antioxidant status, and lipid profile between COPD patients and controls and evaluation of the effect of spirulina intervention on oxidative stress, antioxidant status, and lipid profile of COPD patients. Methods. 30 patients with COPD and 20 controls with no respiratory problems were selected. Global Initiative for Chronic Obstructive Lung Disease criteria were served as the basis of COPD diagnosis. The serum content of malondialdehyde (MDA, lipid hydroperoxide, glutathione (GSH, vitamin C, cholesterol, triglyceride (TG, and high density lipoprotein (HDL was measured. The activity of superoxide dismutase (SOD, catalase (CAT, and glutathione-s-transferase (GST was also measured. Two different doses, (500 × 2 mg and (500 × 4 mg spirulina, were given to two groups, each of which comprises 15 COPD patients. Results. All targeted blood parameters have significant difference (P=0.000 between COPD patients and controls except triglyceride (TG. Spirulina intake for 30 and 60 days at (500 × 2 mg dose has significantly reduced serum content of MDA, lipid hydroperoxide, and cholesterol (P=0.000 while increasing GSH, Vit C level (P=0.000, and the activity of SOD (P=0.000 and GST (P=0.038. At the same time, spirulina intake for 30 and 60 days at (500 × 4 mg dose has favorable significant effect (P=0.000 on all targeted blood parameters except for HDL (P=0.163.

  9. Magnetic field action on outdoor and indoor cultures of Spirulina: Evaluation of growth, medium consumption and protein profile.

    Science.gov (United States)

    Deamici, Kricelle Mosquera; Santos, Lucielen Oliveira; Costa, Jorge Alberto Vieira

    2018-02-01

    This study aimed at evaluating whether a magnetic field (MF) affects the growth of Spirulina sp. when applied to it at different exposure times in indoor and outdoor culture systems. The effects of MF on chlorophyll content, medium consumption and protein profile were also investigated. In raceway tanks, a 25 mT MF was applied for 24 h or for 1 h d -1 . MF for 24 h to outdoor assays increased biomass concentration and chlorophyll-a content besides altering the protein profile. Outdoor Spirulina growth was higher (∼3.65 g L -1 ) than the growth found in indoor assays (∼1.80 g L -1 ), while nitrogen and phosphorus consumption was not enhanced by the application of MF. This is the first study that investigated the influence of MF on outdoor microalga assays, and the results showed that MF affected the metabolism of Spirulina cultured in raceways, especially when it was grown outdoors in uncontrolled environmental conditions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Enhancement of antioxidant activity of C-phycocyanin of Spirulina powder treated with supercritical fluid carbon dioxide

    Directory of Open Access Journals (Sweden)

    Monchai Dejsungkranont

    2017-10-01

    Full Text Available The functionality and activity of proteins can be modified by supercritical fluid CO2 (SCFCO2. The objectives of this study were to investigate the possibility of enhanced antioxidant activity of C-phycocyanin (C-PC proteins from light-harvested Spirulina maxima powder using the SCFCO2 pretreatment and to optimize the SCFCO2 pretreatment conditions enhancing the antioxidant activity of C-PC. The Taguchi method was used to determine the optimum conditions for the SCFCO2 pretreatment. The experimental factors were the pretreatment temperature, pressure, pretreatment mode (static, dynamic and conjugated and duration. The optimal conditions of SCFCO2 pretreatment were: 60 °C, 24.13 MPa and 60 min in static batch mode. Using these pretreatment conditions, the maximum antioxidant activity of C-PC from the treated residual biomass was 410.1 μmole trolox/mg, which was 1.7-fold higher than the untreated biomass (control. The factor that most affected the antioxidant activity of C-PC was temperature (59%. A high pretreatment temperature could damage C-PC, but promoted antioxidant activity. Of note is that this work was the first to explore SCFCO2 treatment enhancing the antioxidant activity of C-PC in Spirulina sp. powder. Keywords: Antioxidant activity, C-phycocyanin, Spirulina sp., Supercritical fluid carbon dioxide pretreatment, Taguchi method

  11. Toxicity of trichloroethylene (TCE) on some algae and cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Lukavský, Jaromír; Furnadzhieva, S.; Dittrt, František

    2011-01-01

    Roč. 86, č. 2 (2011), 226-231 ISSN 0007-4861 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z20600510 Keywords : toxicity * cyanobacteria * trichloroethylene Subject RIV: EF - Botanics Impact factor: 1.018, year: 2011

  12. Risk Levels of Toxic Cyanobacteria in Portuguese Recreational Freshwaters

    Directory of Open Access Journals (Sweden)

    Carina Menezes

    2017-10-01

    Full Text Available Portuguese freshwater reservoirs are important socio-economic resources, namely for recreational use. National legislation concerning bathing waters does not include mandatory levels or guidelines for cyanobacteria and cyanotoxins. This is an issue of concern since cyanotoxin-based evidence is insufficient to change the law, and the collection of scientific evidence has been hampered by the lack of regulatory levels for cyanotoxins in bathing waters. In this work, we evaluate the profile of cyanobacteria and microcystins (MC in eight freshwater reservoirs from the center of Portugal, used for bathing/recreation, in order to determine the risk levels concerning toxic cyanobacteria occurrence. Three of the reservoirs did not pose a risk of MC contamination. However, two reservoirs presented a high risk in 7% of the samples according to the World Health Organization (WHO guidelines for MC in bathing waters (above 20 µg/L. In the remaining three reservoirs, the risk concerning microcystins occurrence was low. However, they exhibited recurrent blooms and persistent contamination with MC up to 4 µg/L. Thus, the risk of exposure to MC and potential acute and/or chronic health outcomes should not be disregarded in these reservoirs. These results contribute to characterize the cyanobacterial blooms profile and to map the risk of toxic cyanobacteria and microcystins occurrence in Portuguese inland waters.

  13. Inoculation effects of two South African cyanobacteria strains on ...

    African Journals Online (AJOL)

    Two South African cyanobacteria strains (coded 3g and 7e) of the genus Nostoc were evaluated for improvement of the aggregate stability of a silty loam soil with low organic C content and compared with Nostoc strain 9v isolated from a Tanzanian soil. The soil was either cropped with maize or non-cropped and inoculated ...

  14. Cyanobacteria Occurrence and Nitrogen Fixation Rates in the ...

    African Journals Online (AJOL)

    The occurrence and biological nitrogen fixation rates of epiphytic and benthic diazotrophs were studied in seagrass meadows at sites with seaweed farms and at a control site without seaweed farms from two locations, Chwaka Bay and Jambiani, along the east coast of. Zanzibar. Ten species of cyanobacteria were ...

  15. Characterization of rhizo-cyanobacteria and their associations with ...

    African Journals Online (AJOL)

    Four heterocystous cyanobacteria, belonging to the genera Anabaena and Nostoc isolated from the rhizosphere of wheat, were tested for their ability to form associations with the roots of wheat seedlings under light and dark conditions using hydroponics. The cyanobacterial strains formed close associations with wheat ...

  16. Cyanobacteria and cyanotoxins in the source water from Lake ...

    African Journals Online (AJOL)

    The phytoplankton community and cyanotoxins in Lake Chivero (formerly Lake McIlwaine) and the presence of cyanotoxins in treated drinking water were investigated between 2003 and 2004. A typical seasonal succession of Cyanobacteria species occurred from January to April, Bacillariophyta from May to July, and ...

  17. Cyanobacteria and cyanobacterial toxins in the alkaline-saline ...

    African Journals Online (AJOL)

    Physicochemical parameters, phytoplankton communities, microcystin (MC) concentrations and potential MC-producing cyanobacteria were investigated in Lakes Natron and Momela, Tanzania. In Lake Big Momela, concentrations of soluble reactive phosphorus, nitrate and ammonia were 7.1, 2.6 and 0.9 μg/L, respectively ...

  18. Extending the biosynthetic repertoires of cyanobacteria and chloroplasts.

    Science.gov (United States)

    Nielsen, Agnieszka Zygadlo; Mellor, Silas Busck; Vavitsas, Konstantinos; Wlodarczyk, Artur Jacek; Gnanasekaran, Thiyagarajan; Perestrello Ramos H de Jesus, Maria; King, Brian Christopher; Bakowski, Kamil; Jensen, Poul Erik

    2016-07-01

    Chloroplasts in plants and algae and photosynthetic microorganisms such as cyanobacteria are emerging hosts for sustainable production of valuable biochemicals, using only inorganic nutrients, water, CO2 and light as inputs. In the past decade, many bioengineering efforts have focused on metabolic engineering and synthetic biology in the chloroplast or in cyanobacteria for the production of fuels, chemicals and complex, high-value bioactive molecules. Biosynthesis of all these compounds can be performed in photosynthetic organelles/organisms by heterologous expression of the appropriate pathways, but this requires optimization of carbon flux and reducing power, and a thorough understanding of regulatory pathways. Secretion or storage of the compounds produced can be exploited for the isolation or confinement of the desired compounds. In this review, we explore the use of chloroplasts and cyanobacteria as biosynthetic compartments and hosts, and we estimate the levels of production to be expected from photosynthetic hosts in light of the fraction of electrons and carbon that can potentially be diverted from photosynthesis. The supply of reducing power, in the form of electrons derived from the photosynthetic light reactions, appears to be non-limiting, but redirection of the fixed carbon via precursor molecules presents a challenge. We also discuss the available synthetic biology tools and the need to expand the molecular toolbox to facilitate cellular reprogramming for increased production yields in both cyanobacteria and chloroplasts. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.

  19. Engineering cyanobacteria for direct biofuel production from CO2

    NARCIS (Netherlands)

    Savakis, P.; Hellingwerf, K.J.

    2015-01-01

    For a sustainable future of our society it is essential to close the global carbon cycle. Oxidised forms of carbon, in particular CO2, can be used to synthesise energy-rich organic molecules. Engineered cyanobacteria have attracted attention as catalysts for the direct conversion of CO2 into reduced

  20. Variability of Chroococcus (Cyanobacteria) morphospecies with regard to phylogenetic relationships

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Jezberová, J.; Komárek, O.; Zapomělová, E.

    2010-01-01

    Roč. 639, č. 1 (2010), s. 69-83 ISSN 0018-8158 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : morphological variability * Cyanobacteria * reservoirs Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.964, year: 2010

  1. Environmental factors that influence cyanobacteria and geosmin occurrence in reservoirs

    Science.gov (United States)

    Journey, Celeste A.; Beaulieu, Karen M.; Bradley, Paul M.; Bradley, Paul M.

    2013-01-01

    Phytoplankton are small to microscopic, free-floating algae that inhabit the open water of freshwater, estuarine, and saltwater systems. In freshwater lake and reservoirs systems, which are the focus of this chapter, phytoplankton communities commonly consist of assemblages of the major taxonomic groups, including green algae, diatoms, dinoflagellates, and cyanobacteria. Cyanobacteria are a diverse group of single-celled organisms that can exist in a wide range of environments, not just open water, because of their adaptability. It is the adaptability of cyanobacteria that enables this group to dominate the phytoplankton community and even form nuisance or harmful blooms under certain environmental conditions. In fact, cyanobacteria are predicted to adapt favorably to future climate change in freshwater systems compared to other phytoplankton groups because of their tolerance to rising temperatures, enhanced vertical thermal stratification of aquatic ecosystems, and alterations in seasonal and interannual weather patterns. Understanding those environmental conditions that favor cyanobacterial dominance and bloom formation has been the focus of research throughout the world because of the concomitant production and release of nuisance and toxic cyanobacterial-derived compounds. However, the complex interaction among the physical, chemical, and biological processes within lakes, reservoirs, and large rivers often makes it difficult to identify primary environmental factors that cause the production and release of these cyanobacterial by-products.

  2. Cyanobacteria HABs - Causes, Prevention, and Mitigation Workgroup Report.

    Science.gov (United States)

    Cyanobacteria (blue-green algae) are estimated to have evolved 3.5 billion years ago, at which time they began to add oxygen to the existing anaerobic atmosphere, actually changing the chemistry of the planet and allowing new life forms to evolve. These ubiquitous microbes are capable of tolerating ...

  3. The cyanobacteria toxins, microcystins – emerging risks to human health

    Science.gov (United States)

    Dialysis patients appear to be at increased risk for exposure to cyanobacteria toxins; episodes of microcystin (MCYST) exposure via dialysate during 1996 and 2001 have been previously reported. During 2001, as many as 44 renal insufficiency patients were exposed to contaminated d...

  4. cyanoScope: Mapping cyanobacteria one slide at a time

    Science.gov (United States)

    cyanoScope is a new initiative for engaging the public, and particularly citizen scientists, to assist with mapping potentially harmful algal blooms throughout New England. Cyanobacteria are important members of the phytoplankton assemblages in lakes. In most situations these p...

  5. One Health and Toxic Cyanobacteria | Science Inventory | US ...

    Science.gov (United States)

    One Health and toxic cyanobacteria Blooms of toxic freshwater blue-green algae or cyanobacteria (HABs) have been in the news after HABs associated with human and animal health problems have been reported in Florida, California and Utah during 2016. HABs occur in warm, slow moving or stagnant surface waters that are enriched with nutrients such as nitrogen and phosphorous. People are exposed to potentially toxic HABs during recreation in contaminated water, after exposure to contaminated drinking water or to blue-green algae supplements. Animals may be exposed to toxic HABs after drinking contaminated surface waters or coming into contact with HABs then ingesting cyanobacteria from their bodies during self-grooming activities. As HABs are being reported more frequently in the US, it is important for veterinarians to secure good exposure histories and to recognize the potential signs and health consequences of HAB exposures. We will review the current knowledge about human and animal health effects associated with freshwater HABs and scenarios that pose the highest risks for illnesses and deaths. This abstract does not necessarily reflect EPA policy. This is a summary of One Health and Cyanobacteria for public health and public practice veterinarians at the American Veterinary Medical Association annual convention. This product is associated with SSWR 4.01B

  6. Evidence for bacterial chemotaxis to cyanobacteria from a radioassay technique

    International Nuclear Information System (INIS)

    Kangatharalingam, N.; Wang, Lizhu; Priscu, J.C.

    1991-01-01

    Lyngbya birgei and Aphanizomenon flos-aquae elicited a significant chemotactic attraction of Aeromonas hydrophila compared with controls lacking cyanobacteria. There was a positive exponential relationship between biomass (chlorophyll a) of L. birgei and A. flos-aquae and chemotactic attraction of A. hydrophila. The assay equipment was simple and reliable and could be used to study bacterial chemotaxis in other species in situ

  7. A gene expression study on strains of Nostoc (Cyanobacteria ...

    African Journals Online (AJOL)

    Cyanobacteria are well known for their production of a multitude of highly allelopathic compounds. These products have features such as incorporation of non-proteinogenic amino acids which are characteristics of peptides biosynthesized by non-ribosomal peptide synthetases (NRPSs). Some of these peptides have ...

  8. Critical assessment of chitosan as coagulant to remove cyanobacteria

    NARCIS (Netherlands)

    Lürling, Miquel; Noyma, Natalia Pessoa; Magalhães, Leonardo de; Miranda, Marcela; Mucci, Maíra; Oosterhout, Frank van; Huszar, Vera L.M.; Marinho, Marcelo Manzi

    2017-01-01

    Removal of cyanobacteria from the water column using a coagulant and a ballast compound is a promising technique to mitigate nuisance. As coagulant the organic, biodegradable polymer chitosan has been promoted. Results in this study show that elevated pH, as may be common during cyanobacterial

  9. Nodularia (Cyanobacteria, Nostocaceae): a phylogenetically uniform genus with variable phenotypes

    Czech Academy of Sciences Publication Activity Database

    Řeháková, Klára; Mareš, Jan; Lukešová, Alena; Zapomělová, Eliška; Bernardová, Kateřina; Hrouzek, Pavel

    2014-01-01

    Roč. 172, č. 3 (2014), s. 235-246 ISSN 1179-3155 R&D Projects: GA ČR(CZ) GA14-18067S; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:60077344 ; RVO:61388971 Keywords : cyanobacteria * Nodularia * taxonomy Subject RIV: EF - Botanics Impact factor: 1.318, year: 2014

  10. N-2 fixation by non-heterocystous cyanobacteria

    NARCIS (Netherlands)

    Bergman, B.; Gallon, J.R.; Rai, A.N.; Stal, L.J.

    1997-01-01

    Many, though not all, non-heterocystous cyanobacteria can fix N-2. However, very few strains can fix N-2 aerobically. Nevertheless, these organisms may make a substantial contribution to the global nitrogen cycle. In this general review, N-2 fixation by laboratory cultures and natural populations of

  11. BMAA extraction of cyanobacteria samples: which method to choose?

    Science.gov (United States)

    Lage, Sandra; Burian, Alfred; Rasmussen, Ulla; Costa, Pedro Reis; Annadotter, Heléne; Godhe, Anna; Rydberg, Sara

    2016-01-01

    β-N-Methylamino-L-alanine (BMAA), a neurotoxin reportedly produced by cyanobacteria, diatoms and dinoflagellates, is proposed to be linked to the development of neurological diseases. BMAA has been found in aquatic and terrestrial ecosystems worldwide, both in its phytoplankton producers and in several invertebrate and vertebrate organisms that bioaccumulate it. LC-MS/MS is the most frequently used analytical technique in BMAA research due to its high selectivity, though consensus is lacking as to the best extraction method to apply. This study accordingly surveys the efficiency of three extraction methods regularly used in BMAA research to extract BMAA from cyanobacteria samples. The results obtained provide insights into possible reasons for the BMAA concentration discrepancies in previous publications. In addition and according to the method validation guidelines for analysing cyanotoxins, the TCA protein precipitation method, followed by AQC derivatization and LC-MS/MS analysis, is now validated for extracting protein-bound (after protein hydrolysis) and free BMAA from cyanobacteria matrix. BMAA biological variability was also tested through the extraction of diatom and cyanobacteria species, revealing a high variance in BMAA levels (0.0080-2.5797 μg g(-1) DW).

  12. Phenotypic and genetic diversification of Pseudanabaena spp. (cyanobacteria)

    NARCIS (Netherlands)

    Acinas, S.G.; Haverkamp, T.H.A.; Huisman, J.; Stal, L.J.

    2009-01-01

    Pseudanabaena species are poorly known filamentous bloom-forming cyanobacteria closely related to Limnothrix. We isolated 28 Pseudanabaena strains from the Baltic Sea (BS) and the Albufera de Valencia (AV; Spain). By combining phenotypic and genotypic approaches, the phylogeny, diversity and

  13. Advances in Oceanography and Limnology - Themed Issue - Cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Babica, Pavel (ed.); Capelli, C. (ed.); Drobac, D. (ed.); Gkelis, S. (ed.)

    2017-01-01

    Roč. 8, č. 1 (2017), s. 1-178 ISSN 1947-573X Institutional support: RVO:67985939 Keywords : cyanobacterial water blooms * cyanobacterial water blooms * cyanobacteria Subject RIV: DJ - Water Pollution ; Quality OBOR OECD: Marine biology, freshwater biology, limnology http://pagepressjournals.org/index.php/aiol/issue/view/460

  14. The occurrence and removal of algae (including cyanobacteria) and ...

    African Journals Online (AJOL)

    Cyanobacterial bloom formation in freshwaters, such as rivers, lakes and dams, is known to occur throughout the world. The Vaalkop Dam, which serves as source to the Vaalkop drinking water treatment works (DWTW), is no exception. Blooms of cyanobacteria occur annually in Vaalkop Dam as well as in dams from which ...

  15. Cyanobacteria of the thermal spring at Pancharevo, Sofia, Bulgaria.

    Czech Academy of Sciences Publication Activity Database

    Lukavský, Jaromír; Furnadzhieva, S.; Pilarski, P.

    2011-01-01

    Roč. 70, č. 2 (2011), 191-208 ISSN 0365-0588 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : cyanobacteria * Thermal spring * Pancharevo, Sofia, Bulgaria Subject RIV: EF - Botanics Impact factor: 0.702, year: 2011

  16. Critical assessment of chitosan as coagulant to remove cyanobacteria

    NARCIS (Netherlands)

    Lurling, Miguel; Noyma, Natalia Pessoa; Magalhães, de Leonardo; Miranda, Marcela; Mucci, Maíra; Oosterhout, van F.; Huszar, Vera L.M.; Marinho, Marcelo Manzi

    2017-01-01

    Removal of cyanobacteria from the water column using a coagulant and a ballast compound is a promising technique to mitigate nuisance. As coagulant the organic, biodegradable polymer chitosan has been promoted. Results in this study show that elevated pH, as may be common during cyanobacterial

  17. Ecology: a niche for cyanobacteria containing chlorophyll d

    DEFF Research Database (Denmark)

    Kühl, Michael; Chen, Min; Ralph, Peter J

    2005-01-01

    we demonstrate photosynthetic activity in Acaryochloris-like phototrophs that live underneath minute coral-reef invertebrates (didemnid ascidians) in a shaded niche enriched in near-infrared light. This discovery clarifies how these cyanobacteria are able to thrive as free-living organisms...

  18. Assessment of cyanobacteria impact on bathing water quality in Poland

    Directory of Open Access Journals (Sweden)

    Krzysztof Skotak

    2012-12-01

    Full Text Available Introduction: Quality of bathing water is of key importance for bathers’ health, mainly due to the fact, that each year millions of people use bathing sites as places for recreation and sport activities. Most of the bathing sites are of adequate quality of water, but still there are cases of health risk because bathing water is polluted. One of the main health risk factor in bathing water are cyanobacteria and their blooms. Cyanobacteria are microorganisms of morphological features of bacteria and algae. They live in colonies, which in large quantities show up as streaks, dense foam on the water surface. The aim of this paper was to assess the impact of cyanobacteria blooms on health regarding bathing water quality in Poland. Materials and methods: Assessment covered all bathing sites in Poland supervised by Polish National Sanitary Inspection (PIS in the period from 2007 to 2009. The base was data collected during bathing water monitoring conducted by PIS and their formal decisions of bathing bans introduced in response to revealed bathing water pollution. Results and discussion: The results of assessment indicate, that about one-fourth of all bathing bans in Poland was due to cyanobacteria blooms. Conclusions: Every fifth bathing sites located on artificial lake or water reservoir and every tenth on the sea bathing sites were polluted. Average period of bathing ban due to cyanobacteria blooms in Poland varies. Relatively the shortest bathing bans were observed on the sea bathing sites (no longer than one week on average. Much longer were bathing bans on lakes and artificial lakes (one month on average.

  19. Genetic and genomic analysis of RNases in model cyanobacteria.

    Science.gov (United States)

    Cameron, Jeffrey C; Gordon, Gina C; Pfleger, Brian F

    2015-10-01

    Cyanobacteria are diverse photosynthetic microbes with the ability to convert CO2 into useful products. However, metabolic engineering of cyanobacteria remains challenging because of the limited resources for modifying the expression of endogenous and exogenous biochemical pathways. Fine-tuned control of protein production will be critical to optimize the biological conversion of CO2 into desirable molecules. Messenger RNAs (mRNAs) are labile intermediates that play critical roles in determining the translation rate and steady-state protein concentrations in the cell. The majority of studies on mRNA turnover have focused on the model heterotrophic bacteria Escherichia coli and Bacillus subtilis. These studies have elucidated many RNA modifying and processing enzymes and have highlighted the differences between these Gram-negative and Gram-positive bacteria, respectively. In contrast, much less is known about mRNA turnover in cyanobacteria. We generated a compendium of the major ribonucleases (RNases) and provide an in-depth analysis of RNase III-like enzymes in commonly studied and diverse cyanobacteria. Furthermore, using targeted gene deletion, we genetically dissected the RNases in Synechococcus sp. PCC 7002, one of the fastest growing and industrially attractive cyanobacterial strains. We found that all three cyanobacterial homologs of RNase III and a member of the RNase II/R family are not essential under standard laboratory conditions, while homologs of RNase E/G, RNase J1/J2, PNPase, and a different member of the RNase II/R family appear to be essential for growth. This work will enhance our understanding of native control of gene expression and will facilitate the development of an RNA-based toolkit for metabolic engineering in cyanobacteria.

  20. Assessing the antibiotic susceptibility of freshwater cyanobacteria spp.

    Directory of Open Access Journals (Sweden)

    Elsa eDias

    2015-08-01

    Full Text Available Freshwater is a vehicle for the emergence and dissemination of antibiotic resistance. Cyanobacteria are ubiquitous in freshwater, where they are exposed to antibiotics and resistant organisms, but their role on water resistome was never evaluated. Data concerning the effects of antibiotics on cyanobacteria, obtained by distinct methodologies, is often contradictory. This emphasizes the importance of developing procedures to understand the trends of antibiotic susceptibility in cyanobacteria. In this study we aimed to evaluate the susceptibility of four cyanobacterial isolates from different genera (Microcystis aeruginosa, Aphanizomenon gracile, Chrisosporum bergii, Planktothix agradhii, and among them nine isolates from the same specie (M. aeruginosa to distinct antibiotics (amoxicillin, ceftazidime, ceftriaxone, kanamycine, gentamicine, tetracycline, trimethoprim, nalidixic acid, norfloxacin. We used a method adapted from the bacteria standard broth microdilution. Cyanobacteria were exposed to serial dilution of each antibiotic (0.0015-1.6 mg/L in Z8 medium (20 ± 1 ºC; 14/10 h L/D cycle; light intensity 16 ± 4 µEm-2 s-1. Cell growth was followed overtime (OD450nm/microscopic examination and the minimum inhibitory concentrations (MICs were calculated for each antibiotic/isolate. We found that -lactams exhibited the lower MICs, aminoglycosides, tetracycline and norfloxacine presented intermediate MICs; none of the isolates were susceptible to trimethoprim and nalidixic acid. The reduced susceptibility of all tested cyanobacteria to some antibiotics suggests that they might be naturally non-susceptible to these compounds, or that that they might became non-susceptible due to antibiotic contamination pressure, or to the transfer of genes from resistant bacteria present in the environment.

  1. Spirulina platensis

    African Journals Online (AJOL)

    abc

    2013-08-28

    Aug 28, 2013 ... techniques for cultivation of useful microalgae ... cheaper nutritional sources such as ammonia and urea. (Bezerra et al., 2008; .... The analysis was conducted with .... tion effect was less marked with urea due to enzymatic.

  2. Characterization and pyrolysis of Chlorella vulgaris and Arthrospira platensis: potential of bio-oil and chemical production by Py-GC/MS analysis.

    Science.gov (United States)

    Almeida, Hanna N; Calixto, Guilherme Q; Chagas, Bruna M E; Melo, Dulce M A; Resende, Fabio M; Melo, Marcus A F; Braga, Renata Martins

    2017-06-01

    Biofuels have been seen as potential sources to meet future energy demand as a renewable and sustainable energy source. Despite the fact that the production technology of first-generation biofuels is consolidated, these biofuels are produced from foods crops such as grains, sugar cane, and vegetable oils competing with food for crop use and agricultural land. In recent years, it was found that microalgae have the potential to provide a viable alternative to fossil fuels as source of biofuels without compromising food supplies or arable land. On this scenario, this paper aims to demonstrate the energetic potential to produce bio-oil and chemicals from microalgae Chlorella vulgaris and Arthrospira platensis. The potential of these biomasses was evaluated in terms of physical-chemical characterization, thermogravimetric analysis, and analytical pyrolysis interfaced with gas chromatograph (Py-GC/MS). The results show that C. vulgaris and A. platensis are biomasses with a high heating value (24.60 and 22.43 MJ/kg) and low ash content, showing a high percentage of volatile matter (72.49 and 79.42%). These characteristics confirm their energetic potential for conversion process through pyrolysis, whereby some important aromatic compounds such as toluene, styrene, and phenol were identified as pyrolysis products, which could turn these microalgae a potential for biofuels and bioproduct production through the pyrolysis.

  3. Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Gómez G. Liliana Cecilia

    2012-04-01

    Full Text Available

    Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibit better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.

  4. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis.

    Science.gov (United States)

    Mosulishvili, L M; Kirkesali, E I; Belokobylsky, A I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F

    2002-08-22

    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p) reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in S. platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterized. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  5. Outdoor pilot-scale cultivation of Spirulina sp. LEB-18 in different geographic locations for evaluating its growth and chemical composition.

    Science.gov (United States)

    de Jesus, Cristiane Santos; da Silva Uebel, Lívia; Costa, Samantha Serra; Miranda, Andréa Lobo; de Morais, Etiele Greque; de Morais, Michele Greque; Costa, Jorge Alberto Vieira; Nunes, Itaciara Larroza; de Souza Ferreira, Ederlan; Druzian, Janice Izabel

    2018-05-01

    This study evaluated whether outdoor cultivation of Spirulina sp. in different geographical locations affected its growth and biomass quality, with respect to the chemical composition, volatile compound and heavy metal content, and thermal stability. The positive effect of solar radiation and temperature on biomass productivity in Spirulina sp. cultivated in the northeast was directly related to its improved nutritional characteristics, which occurred with an increase in protein, phycocyanin, and polyunsaturated fatty acid (mainly γ-linolenic) content. The biomass produced in Northeast and South Brazil showed high thermal stability and had volatile compounds that could be used as biomarkers of Spirulina, and their parameters were within the limits of internationally recognized standards for food additives; hence, they have been considered safe foods. However, the growth of crops in south Brazil occurred at lower rates due to low temperatures and luminous intensities, indicative of the robustness of microalgae in relation to these parameters. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. Dampak Intervensi Sumber Iodium Alami Spirulina sp terhadap Kadar T4 Bebas (FT4 dan Tiroglobulin (TG pada Wanita Usia Subur di Daerah Kalibawang Kulon Progo

    Directory of Open Access Journals (Sweden)

    R. Agus Wibowo

    2015-01-01

    Full Text Available ABSRACT Iodine Deficiency Disorder (IDD is still a public health problem in Indonesia. Salt iodization was one of IDD prevention programme to prevent IDD, however the national coverage for iodized salt is still less than 90%. Alternative solution to solve IDD elimination is needed to find a better iodine sources. One of nutrient rich source from the sea that was developed to improve the nutritional status is Spirulina sp. Spirulina has high bioavailability due to the simple structure of the cell wall, so that the nutrients contained iodine will be more easily absorbed by the body. The aim of this research was to describe the effect of Spirulina sp to free T4 and thyroglobulin level in women of child bearing age in Kalibawang Kulon Progo regency. This is an experimental study using double blind randomized control trial (RCT. Subjects are euthyroid child bearing woman (18-40 years old, with TSH levels of 3 to 6.2 μIU/L. They were divided into 2 groups with subjects in control group were given placebo while the treatment group were given Spirulina sp (1 gr/day for 3 months. Serum for free T4 and thyroglobulin was analysed using ELISA. The results showed that there were significant changes in free T4 level in both groups after intervention (P <0.05, but there were no significant differences between the two groups at the beginning and end of treatment (P> 0.05 in thyroglobulin. The intervention using Spirulina sp has potential effect to increase free T4 level, however it did not effect thyroglobulin level. Keywords: FreeT4, RCT, Spirulina sp, Thyroglobulin   ABSTRAK   Masalah kekurangan asupan iodium dan gangguan akibat kekurangan iodium (GAKI masih menjadi masalah di Indonesia. Program iodisasi garam merupakan salah satu program yang dijalankan oleh pemerintah Indonesia untuk menanggulangi GAKI, namun sampai saat ini cakupan angka nasional untuk garam beriodium belum mencapai 90%. Dibutuhkan metode baru yang efektif dalam membantu program

  7. The Effect of Temperature on Protein and Amino Acid Composition of Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Leyla Hızarcı Uslu

    2015-12-01

    Full Text Available Sıcaklığın Spirulina platensis’in protein ve amino asit kompozisyonu üzerine etkisi. Bu çalışma, mevsime bağlı iklim değişikliğinin yaz ve kış mevsimlerinde kültüre alınan Spirulina platensis’in protein içeriği ve amino asit kompozisyonuna etkilerini incelemek amacıyla yürütülmüştür. Çalışma boyunca ışık yoğunluğu, pH ve tuzluluk günlük olarak ölçülmüş, sıcaklık ve çözünmüş oksijen gün boyunca ve gece ölçülmüştür. Yaz ve kış mevsiminde ortalama gündüz sıcaklığı sırasıyla 33,9±0,4 ºC ve 18,6±0,5 ºC olarak belirlenirken, gece sıcaklığı 29,9±0,2 °C ve 14.4±0.2°C olarak belirlenmiştir. Ortalama ışık yoğunluğu yaz mevsiminde 848,3 µmol m-2s-1 iken kışın 506,26±48 µmol m-2s-1 olmuştur. Yaz büyüme döneminde protein miktarı (72,9±03 % ve amino asit konsantrasyonu kış dönemine göre daha yüksek bulunmuştur. Amino asitlerden Prolin, Sistin ve Arjinin sadece kış mevsiminde gözlenmiştir

  8. Inferring Properties of Ancient Cyanobacteria from Biogeochemical Activity and Genomes of Siderophilic Cyanobacteria

    Science.gov (United States)

    McKay, David S.; Brown, I. I.; Tringe, S. G.; Thomas-Keprta, K. E.; Bryant, D. A.; Sarkisova, S. S.; Malley, K.; Sosa, O.; Klatt, C. G.; McKay, D. S.

    2010-01-01

    Interrelationships between life and the planetary system could have simultaneously left landmarks in genomes of microbes and physicochemical signatures in the lithosphere. Verifying the links between genomic features in living organisms and the mineralized signatures generated by these organisms will help to reveal traces of life on Earth and beyond. Among contemporary environments, iron-depositing hot springs (IDHS) may represent one of the most appropriate natural models [1] for insights into ancient life since organisms may have originated on Earth and probably Mars in association with hydrothermal activity [2,3]. IDHS also seem to be appropriate models for studying certain biogeochemical processes that could have taken place in the late Archean and,-or early Paleoproterozoic eras [4, 5]. It has been suggested that inorganic polyphosphate (PPi), in chains of tens to hundreds of phosphate residues linked by high-energy bonds, is environmentally ubiquitous and abundant [6]. Cyanobacteria (CB) react to increased heavy metal concentrations and UV by enhanced generation of PPi bodies (PPB) [7], which are believed to be signatures of life [8]. However, the role of PPi in oxygenic prokaryotes for the suppression of oxidative stress induced by high Fe is poorly studied. Here we present preliminary results of a new mechanism of Fe mineralization in oxygenic prokaryotes, the effect of Fe on the generation of PPi bodies in CB, as well as preliminary analysis of the diversity and phylogeny of proteins involved in the prevention of oxidative stress in phototrophs inhabiting IDHS.

  9. BASIC: Baltic Sea cyanobacteria. An investigation of the structure and dynamics of water blooms of cyanobacteria in the Baltic Sea––responses to a changing environment

    NARCIS (Netherlands)

    Stal, L.J.; Albertano, P.; Bergman, B.; Von Bröckel, K.; Gallon, J.R.; Hayes, P.K.; Sivonen, K.; Walsby, A.E.

    2003-01-01

    The blooms of cyanobacteria that develop each summer in the Baltic Sea are composed of two functional groups, namely the small-sized picocyanobacteria (Synechococcus sp.) and the larger, colony-forming, filamentous N2-fixing cyanobacteria. The former encompassed both red (phycoerythrin-rich) and

  10. Evolution of saxitoxin synthesis in cyanobacteria and dinoflagellates.

    Science.gov (United States)

    Hackett, Jeremiah D; Wisecaver, Jennifer H; Brosnahan, Michael L; Kulis, David M; Anderson, Donald M; Bhattacharya, Debashish; Plumley, F Gerald; Erdner, Deana L

    2013-01-01

    Dinoflagellates produce a variety of toxic secondary metabolites that have a significant impact on marine ecosystems and fisheries. Saxitoxin (STX), the cause of paralytic shellfish poisoning, is produced by three marine dinoflagellate genera and is also made by some freshwater cyanobacteria. Genes involved in STX synthesis have been identified in cyanobacteria but are yet to be reported in the massive genomes of dinoflagellates. We have assembled comprehensive transcriptome data sets for several STX-producing dinoflagellates and a related non-toxic species and have identified 265 putative homologs of 13 cyanobacterial STX synthesis genes, including all of the genes directly involved in toxin synthesis. Putative homologs of four proteins group closely in phylogenies with cyanobacteria and are likely the functional homologs of sxtA, sxtG, and sxtB in dinoflagellates. However, the phylogenies do not support the transfer of these genes directly between toxic cyanobacteria and dinoflagellates. SxtA is split into two proteins in the dinoflagellates corresponding to the N-terminal portion containing the methyltransferase and acyl carrier protein domains and a C-terminal portion with the aminotransferase domain. Homologs of sxtB and N-terminal sxtA are present in non-toxic strains, suggesting their functions may not be limited to saxitoxin production. Only homologs of the C-terminus of sxtA and sxtG were found exclusively in toxic strains. A more thorough survey of STX+ dinoflagellates will be needed to determine if these two genes may be specific to SXT production in dinoflagellates. The A. tamarense transcriptome does not contain homologs for the remaining STX genes. Nevertheless, we identified candidate genes with similar predicted biochemical activities that account for the missing functions. These results suggest that the STX synthesis pathway was likely assembled independently in the distantly related cyanobacteria and dinoflagellates, although using some

  11. Fatty acid composition of Spirulina sp., Chlorella sp. and Chaetoceros sp. microalgae and introduction as potential new sources to extinct omega 3 and omega 6

    Directory of Open Access Journals (Sweden)

    Homan Gorjzdadeh

    2016-05-01

    Full Text Available Background: This study was carried out to determine the oil fatty acids from two special species of microalgae; Spirulina sp.,Chlorella sp. and also Chaetoceros sp. collected from Bahmanshir River. Materials and Methods: Sampling of microalgae Chaetoceros sp. from Bahmanshir River was under taken using bottle samplers during spring season of 2013. Microalgae Spirulina sp. and Chlorella sp. were supplied from Shrimp Research Institute of Iran in Bushehr Province. Samples then were cultured under controlled laboratory conditions and mass culture for 100 liters was undertaken. Isolation of microalgae species from water of cultured media was carried out using filtration and centrifugation methods. The fatty acid compositions were determined by Gas – FID chromatography. Results: Results showed that regarding Saturated Fatty Acids (SFA obtained from purified culture of Chaetoceros sp., Spirulina sp. and Chlorella sp. the maximum amount of total fatty acids were belonged to palmitic acids (C16:0 with 15.21%, 30.1% and 25.17% of total fatty acids  respectively. Analysis of Mono Unsaturated Fatty Acids (MUFA showed that in the Oleic acid was maximum amount of 34% in Spirulina sp. In addition the amount of MUFA in Chlorella sp. was 16.37% of total fatty acids. On the other hand the amount of palmeotic acid in purified culture of Chaetoceros sp. was 30.33% from total content of fatty acids. Analysis of Poly Unsaturated Fatty Acids (PUFA, Linoleic acid (C18:2 (Omega 6, revealed maximum percentage in Spirulina sp. with 18.8%. Results of Alpha linoleic acid (C18:3 (Omega3 analysis showed maximum amount of 9.66% in Chlorella sp. compared to other microalgae with lower omega 3 contents. Spirulina sp. contained maximum amount of Linoleic acid (C18:2 with 18.8% of total fatty acids. Therefore, Spirulina sp. can be considered as a rich source of omega 6 for the purpose of fatty acid extractions. The presence of PUFA in Chlorella sp. and Spirulina sp. was

  12. Optimization of phycocyanin extraction from microalgae Spirulina platensis by sonication as antioxidant

    Science.gov (United States)

    Dianursanti, Indraputri, Claudia Maya; Taurina, Zarahmaida

    2018-02-01

    Cardiovascular disease is known as an epidemic disease which has high casualty in the world. One of its trigger factors is the amount of reactive oxygen species (ROS) inside the body. In order to regulate its amount, antioxidant ingestion is compulsory. Microalgae can be adopted as a source of antioxidant. Spirulina platensis is one of the consistently produced microalgae. It contains phycocyanin, a blue pigment, which is known as a nutritious food agent. Phycocyanin could be assumed as an antioxidant and has been clinically validated both in vitro and in vivo. This research is proposed to determine the optimum extraction time. The experiment was conducted by sonication at 37 kHz using phosphate buffer as the solvent. The result exhibited that increasing the sonication time would increase the yield until it achieved the optimum yield. Based on the experiment, the optimum extraction time was 25 minutes with yield of 8.25 mg/g dry biomass and purity of 0.6. It can be summarized that extraction time also affected the extraction efficiency and its antioxidant activity. This paper shows a prospect on future development in cultivating micro flora in Indonesia, particularly in Depok.

  13. Purification and Identification of Antioxidant Peptides from Enzymatic Hydrolysate of Spirulina platensis.

    Science.gov (United States)

    Yu, Jie; Hu, Yuanliang; Xue, Mingxiong; Dun, Yaohao; Li, Shenao; Peng, Nan; Liang, Yunxiang; Zhao, Shumao

    2016-07-28

    The aim of this study was to isolate antioxidant peptides from an enzymatic hydrolysate of Spirulina platensis. A novel antioxidant peptide was obtained by ultrafiltration, gel filtration chromatography, and reverse-phase high-performance liquid chromatography, with the 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging assay used to measure the antioxidant activity, and the sequence was determined to be Pro-Asn-Asn (343.15 Da) by electrospray ionization tandem mass spectrometry. This peptide was synthesized to confirm its antioxidant properties, and it exhibited 81.44 ± 0.43% DPPH scavenging activity at 100 µg/ml, which was similar to that of glutathione (82.63 ± 0.56%). Furthermore, the superoxide anion and hydroxyl free-radical scavenging activities and the SOD activity of the peptide were 47.84 ± 0.49%, 54.01 ± 0.82%, and 12.55 ± 0.75%, respectively, at 10 mg/ml. These results indicate that S. platensis is a good source of antioxidant peptides, and that its hydrolysate may have important applications in the pharmaceutical and food industries.

  14. Phosphonate degradation by Spirulina strains: cyanobacterial biofilters for the removal of anticorrosive polyphosphonates from wastewater.

    Science.gov (United States)

    Forlani, Giuseppe; Prearo, Valentina; Wieczorek, Dorota; Kafarski, Paweł; Lipok, Jacek

    2011-03-07

    The ability of Spirulina spp. to metabolize the recalcitrant xenobiotic Dequest 2054(®) [hexamethylenediamine-N,N,N',N'-tetrakis(methylphosphonic acid)], a CaSO(4) inhibitor used for boiler treatment and reverse osmosis desalination, was investigated. The compound served as sole source of phosphorus, but not of nitrogen, for cyanobacterial growth. In vivo utilization was followed by (31)P NMR analysis. The disappearance of the polyphosphonate proceeded only with actively dividing cells, and no release of inorganic phosphate was evident. However, no difference was found between P-starved and P-fed cultures. Maximal utilization reached 1.0 ± 0.2 mmoll(-1), corresponding to 0.56 ± 0.11 mmol g(-1) dry biomass, thus residual amounts were still present in the exhausted medium when the compound was supplied at higher initial concentrations. At low substrate levels metabolism rates were lower, suggesting that a concentration-driven uptake may represent a limiting step during the biodegradation process. The compound was not retained by biocolumns made with immobilized cyanobacterial cells, either alive or dead. A lab-scale pilot plant, consisting of a series of sequentially connected vessels containing an actively proliferating algal culture, was built and tested for wastewater treatment. Results showed 50% removal of the polyphosphonate added to an initial concentration of 2.5mM. Although further optimization will be required, data strengthen the possibility of using cyanobacterial strains for bioremediation purposes. Copyright © 2010 Elsevier Inc. All rights reserved.

  15. Application of an Ultrafine Shearing Method for the Extraction of C-Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Jianfeng Yu

    2017-11-01

    Full Text Available Cell disruption is an important step during the extraction of C-phycocyanin from Spirulina platensis. An ultrafine shearing method is introduced and combined with soaking and ultrasonication to disrupt the cell walls of S. platensis efficiently and economically. Five kinds of cell disruption method, including soaking, ultrasonication, freezing-thawing, soaking-ultrafine shearing and soaking-ultrafine shearing-ultrasonication were applied to break the cell walls of S. platensis. The effectiveness of cell breaking was evaluated based on the yield of the C-phycocyanin. The results show that the maximum C-phycocyanin yield was 9.02%, achieved by the soaking-ultrafine shearing-ultrasonication method, followed by soaking (8.43%, soaking-ultrafine shearing (8.89%, freezing and thawing (8.34%, and soaking-ultrasonication (8.62%. The soaking-ultrafine shearing-ultrasonication method is a novel technique for breaking the cell walls of S. platensis for the extraction of C-phycocyanin.

  16. Incorporation of Chlorella vulgaris and Spirulina maxima biomass in pasta products. Part 1: Preparation and evaluation.

    Science.gov (United States)

    Fradique, Mónica; Batista, Ana Paula; Nunes, M Cristiana; Gouveia, Luísa; Bandarra, Narcisa M; Raymundo, Anabela

    2010-08-15

    Microalgae are able to enhance the nutritional content of conventional foods and hence to positively affect human health, due to their original chemical composition. The aim of the present study was to prepare fresh spaghetti enriched with different amounts of microalgae biomass (Chlorella vulgaris and Spirulina maxima) and to compare the quality parameters (optimal cooking time, cooking losses, swelling index and water absorption), chemical composition, instrumental texture and colour of the raw and cooked pasta enriched with microalgae biomass with standard semolina spaghetti. The incorporation of microalgae results in an increase of quality parameters when compared to the control sample. The colour of microalgae pastas remained relatively stable after cooking. The addition of microalgae resulted in an increase in the raw pasta firmness when compared to the control sample. Of all the microalgae studied, an increase in the biomass concentration (0.5-2.0%) resulted in a general tendency of an increase in the pasta firmness. Sensory analysis revealed that microalgae pastas had higher acceptance scores by the panellists than the control pasta. Microalgae pastas presented very appellative colours, such as orange and green, similar to pastas produced with vegetables, with nutritional advantages, showing energetic values similar to commercial pastas. The use of microalgae biomass can enhance the nutritional and sensorial quality of pasta, without affecting its cooking and textural properties. Copyright (c) 2010 Society of Chemical Industry.

  17. Enhancement of Immune Activation Activities of Spirulina maxima Grown in Deep-Sea Water

    Science.gov (United States)

    Choi, Woon Yong; Kang, Do Hyung; Lee, Hyeon Yong

    2013-01-01

    In this study, the immuno-modulatory and anticancer activities of marine algae, Spirulina maxima grown in deep-sea water (DSW), were investigated. It was found that the extract of S. maxima, cultured in DSW, effectively suppressed the expression of Bcl2 in A549 cells as well as inhibiting various human cancer cells with concentration dependency, which possibly implies that the extracts may play more important roles in controlling cancer cell growth. The secretion of cytokines IL-6 and TNF-α from human B cells was also greatly increased, compared to those of the extract grown in conventional sea-water. The growth of Human Natural Killer (NK) cells in the presence of the extracts from DSW was significantly higher (12.2 × 104 viable cells/mL) when compared to the control (1.1 × 104 viable cells/mL). Based on HPLC analysis, the increase in the biological activities of the extracts from DSW was caused by considerably high amounts of β-carotene and ascorbic acid because the DSW contained high concentrations and good ratios of several key minerals for biosynthesizing β-carotene and ascorbic acid, as well as maintaining high cell growth. PMID:23743830

  18. Alleviation of metabolic abnormalities induced by excessive fructose administration in Wistar rats by Spirulina maxima.

    Science.gov (United States)

    Jarouliya, Urmila; Zacharia, J Anish; Kumar, Pravin; Bisen, P S; Prasad, G B K S

    2012-03-01

    Diabetes mellitus is a metabolic disorder characterized by hyperglycaemia. Several natural products have been isolated and identified to restore the complications of diabetes. Spirulina maxima is naturally occurring fresh water cyanobacterium, enriched with proteins and essential nutrients. The aim of the study was to determine whether S. maxima could serve as a therapeutic agent to correct metabolic abnormalities induced by excessive fructose administration in Wistar rats. Oral administration of 10 per cent fructose solution to Wistar rats (n = 5 in each group) for 30 days resulted in hyperglycaemia and hyperlipidaemia. Aqueous suspension of S. maxima (5 or 10%) was also administered orally once daily for 30 days. The therapeutic potential of the preparation with reference to metformin (500 mg/kg) was assessed by monitoring various biochemical parameters at 10 day intervals during the course of therapy and at the end of 30 days S. maxima administration. Significant (Pmaxima aquous extract. Co-administration of S. maxima extract (5 or 10% aqueous) with 10 per cent fructose solution offered a significant protection against fructose induced metabolic abnormalities in Wistar rats. The present findings showed that S. maxima exhibited anti-hyperglycaemic, anti-hyperlipidaemic and hepatoprotective activity in rats fed with fructose. Further studies are needed to understand the mechanisms.

  19. Functional Properties and Amino Acid Profile of Spirulina Platensis Protein Isolates

    International Nuclear Information System (INIS)

    Bashir, S.; Sharif, M. K.; Butt, M. S.; Shahid, M.

    2016-01-01

    Protein malnutrition and food insecurity represent serious obstructions to sustainable development, poverty reduction and food quality throughout the world. The present study has been designed to evaluate the Spirulina platensis (SP) as a protein alternative source for the utilization in food products. A protein isolate was prepared from S. platensis powder through extraction with 0.1N NaOH, precipitation at pH 3, neutralization of the dispersed precipitate to pH 6.8-7.0, and subsequent freeze drying. The S. platensis isolate amino acids compositions revealed that the total essential amino acids contribution was comparatively higher in SPI (31.16±1.43 g/100 g) as compared with SP (27.75±1.21 g/100 g). Moreover, oil and water absorption capacities, foaming and emulsifying properties, surface hydrophobicity and nitrogen solubility index were found better functional properties under laboratory conditions except emulsion properties. Conclusively, SP and its isolates might be used in various food products to curtail protein energy malnutrition. (author)

  20. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp

    Energy Technology Data Exchange (ETDEWEB)

    Hadiyanto,, E-mail: hadiyanto@live.undip.ac.id; Suttrisnorhadi,; Soetrisnanto, Danny; Azizah, Nur [Department of Chemical Engineering, Diponegoro University, Jl. Prof. Soedarto, SH-Tembalang, Semarang 50239 INDONESIA (Indonesia); Sutanto, Heri [Physic Department, Faculty of Science and Mathematics, Diponegoro University (Indonesia); Suzery, Meiny [Chemistry Department, Faculty of Science and Mathematics, Diponegoro University (Indonesia)

    2015-12-29

    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae.

  1. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp

    Science.gov (United States)

    Hadiyanto, Suttrisnorhadi, Sutanto, Heri; Suzery, Meiny; Soetrisnanto, Danny; Azizah, Nur

    2015-12-01

    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae.

  2. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp

    International Nuclear Information System (INIS)

    Hadiyanto,; Suttrisnorhadi,; Soetrisnanto, Danny; Azizah, Nur; Sutanto, Heri; Suzery, Meiny

    2015-01-01

    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae

  3. Subcellular proteomic characterization of the high-temperature stress response of the cyanobacterium Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Cheevadhanarak Supapon

    2009-09-01

    Full Text Available Abstract The present study examined the changes in protein expression in Spirulina platensis upon exposure to high temperature, with the changes in expression analyzed at the subcellular level. In addition, the transcriptional expression level of some differentially expressed proteins, the expression pattern clustering, and the protein-protein interaction network were analyzed. The results obtained from differential expression analysis revealed up-regulation of proteins involved in two-component response systems, DNA damage and repair systems, molecular chaperones, known stress-related proteins, and proteins involved in other biological processes, such as capsule formation and unsaturated fatty acid biosynthesis. The clustering of all differentially expressed proteins in the three cellular compartments showed: (i the majority of the proteins in all fractions were sustained tolerance proteins, suggesting the roles of these proteins in the tolerance to high temperature stress, (ii the level of resistance proteins in the photosynthetic membrane was 2-fold higher than the level in two other fractions, correlating with the rapid inactivation of the photosynthetic system in response to high temperature. Subcellular communication among the three cellular compartments via protein-protein interactions was clearly shown by the PPI network analysis. Furthermore, this analysis also showed a connection between temperature stress and nitrogen and ammonia assimilation.

  4. Biological Synthesis of Silver Nanoparticles by Cell-Free Extract of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Gaurav Sharma

    2015-01-01

    Full Text Available The present study explores biological synthesis of silver nanoparticles (AgNPs using the cell-free extract of Spirulina platensis. Biosynthesised AgNPs were characterised by UV-Vis spectroscopy, SEM, TEM, and FTIR analysis and finally evaluated for antibacterial activity. Extracellular synthesis using aqueous extract of S. platensis showed the formation of well scattered, highly stable, spherical AgNPs with an average size of 30–50 nm. The size and morphology of the nanoparticles were confirmed by SEM and TEM analysis. FTIR and UV-Vis spectra showed that biomolecules, proteins and peptides, are mainly responsible for the formation and stabilisation of AgNPs. Furthermore, the synthesised nanoparticles exhibited high antibacterial activity against pathogenic Gram-negative, that is, Escherichia coli, MTCC-9721; Proteus vulgaris, MTCC-7299; Klebsiella pneumoniae, MTCC-9751, and Gram-positive, that is, Staphylococcus aureus, MTCC-9542; S. epidermidis, MTCC-2639; Bacillus cereus, MTCC-9017, bacteria. The AgNPs had shown maximum zone of inhibition (ZOI that is 31.3±1.11 in P. vulgaris. Use of such a microalgal system provides a simple, cost-effective alternative template for the biosynthesis of nanomaterials of silver in a large scale that could be of great use in biomedical applications.

  5. Polyhydroxybutyrate (PHB) Synthesis by Spirulina sp. LEB 18 Using Biopolymer Extraction Waste.

    Science.gov (United States)

    da Silva, Cleber Klasener; Costa, Jorge Alberto Vieira; de Morais, Michele Greque

    2018-01-20

    The reuse of waste as well as the production of biodegradable compounds has for years been the object of studies and of global interest as a way to reduce the environmental impact generated by unsustainable exploratory processes. The conversion of linear processes into cyclical processes has environmental and economic advantages, reducing waste deposition and reducing costs. The objective of this work was to use biopolymer extraction waste in the cultivation of Spirulina sp. LEB 18, for the cyclic process of polyhydroxybutyrate (PHB) synthesis. Concentrations of 10, 15, 20, 25, and 30% (v/v) of biopolymer extraction waste were tested. For comparison, two assays were used without addition of waste, Zarrouk (SZ) and modified Zarrouk (ZM), with reduction of nitrogen. The assays were carried out in triplicate and evaluated for the production of microalgal biomass and PHB. The tests with addition of waste presented a biomass production statistically equal to ZM (0.79 g L -1 ) (p PHB in the assay containing 25% of waste was higher when compared to the other cultivations, obtaining 10.6% (w/w) of biopolymer. From the results obtained, it is affirmed that the use of PHB extraction waste in the microalgal cultivation, aiming at the synthesis of biopolymers, can occur in a cyclic process, reducing process costs and the deposition of waste, thus favoring the preservation of the environment.

  6. Effect of operating conditions on hydrothermal liquefaction of Spirulina over Ni/TiO2 catalyst.

    Science.gov (United States)

    Tian, Wenying; Liu, Renlong; Wang, Wenjia; Yin, Zhaosen; Yi, Xuewen

    2018-05-04

    In this study, the effects of reaction temperature, holding time, algae/water ratio and catalyst dosage on the yield and quality of bio-oil produced via the HTL of Spirulina were investigated. The maximum bio-oil yield (43.05 wt%) and energy recovery (ER) value (64.62%) were obtained at 260 °C for 30 min, with an algae/water ratio of 1/4 and a catalyst dosage of 5 wt%. The bio-oil samples were characterized by elemental analysis, Gas Chromatography-Mass Spectrometry (GC-MS), Fourier Transform Infrared (FI-IR), and Thermo-gravimetric analysis (TGA). Results indicated that higher heating values (HHVs) of bio-oils were in the range of 27.28-36.01 MJ/kg, and main compounds of bio-oil were amides, esters, nitriles, hydroperoxide and alkanes. Adding of the Ni/TiO 2 catalyst can decrease the contents of oxygenated and nitrogenous compounds and promote the formation of desirable components such as esters and alkanes. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. Bioprocess Engineering Aspects of Biopolymer Production by the Cyanobacterium Spirulina Strain LEB 18

    Directory of Open Access Journals (Sweden)

    Roberta Guimarães Martins

    2014-01-01

    Full Text Available Microbial biopolymers can replace environmentally damaging plastics derived from petrochemicals. We investigated biopolymer synthesis by the cyanobacterium Spirulina strain LEB 18. Autotrophic culture used unmodified Zarrouk medium or modified Zarrouk medium in which the NaNO3 content was reduced to 0.25 g L−1 and the NaHCO3 content reduced to 8.4 g L−1 or increased to 25.2 g L−1. Heterotrophic culture used modified Zarrouk medium containing 0.25 g L−1 NaNO3 with the NaHCO3 replaced by 0.2 g L−1, 0.4 g L−1, or 0.6 g L−1 of glucose (C6H12O6 or sodium acetate (CH3COONa. Mixotrophic culture used modified Zarrouk medium containing 0.25 g L−1 NaNO3 plus 16.8 g L−1 NaHCO3 with the addition of 0.2 g L−1, 0.4 g L−1, or 0.6 g L−1 of glucose or sodium acetate. The highest biopolymer yield was 44% when LEB 18 was growing autotrophically in media containing 0.25 g L−1 NaNO3 and 8.4 g L−1 NaHCO3.

  8. Production of Spirulina platensis using dry chicken manure supplemented with urea and sodium bicarbonate

    Directory of Open Access Journals (Sweden)

    Thepparath Ungsethaphand

    2009-10-01

    Full Text Available The cyanobacterium Spirulina platensis is an attractive source of valuable protein for both human and animal consumption. The conventional nitrogen source for S. platensis is nitrate. However, recent research has evaluated the potential of using animal waste as a low-cost nitrogen source. In this work, the cultivation of S. platensis was done using dry chicken manure (DCM, collected from a closed-system poultry house, as nitrogen source. The experiment was carried out in open concrete tanks with 100 litres of culture medium and an initial biomass concentration of 0.5 g/L. The culture media were prepared to test the effect of unsupplemented DCM, DCM supplemented with 2.0 mg/L of urea (DCM+U, and/or 40 mg/L of sodium bicarbonate (DCM+U+B or DCM+B. The best cellular growth and highest protein production were observed for S. platensis in the biomass harvested from the culture medium containing DCM supplemented with 2.0 mg/L of urea (DCM+U.

  9. Cyanobacteria as Chassis for Industrial Biotechnology: Progress and Prospects

    Science.gov (United States)

    Al-Haj, Lamya; Lui, Yuen Tin; Abed, Raeid M.M.; Gomaa, Mohamed A.; Purton, Saul

    2016-01-01

    Cyanobacteria hold significant potential as industrial biotechnology (IB) platforms for the production of a wide variety of bio-products ranging from biofuels such as hydrogen, alcohols and isoprenoids, to high-value bioactive and recombinant proteins. Underpinning this technology, are the recent advances in cyanobacterial “omics” research, the development of improved genetic engineering tools for key species, and the emerging field of cyanobacterial synthetic biology. These approaches enabled the development of elaborate metabolic engineering programs aimed at creating designer strains tailored for different IB applications. In this review, we provide an overview of the current status of the fields of cyanobacterial omics and genetic engineering with specific focus on the current molecular tools and technologies that have been developed in the past five years. The paper concludes by giving insights on future commercial applications of cyanobacteria and highlights the challenges that need to be addressed in order to make cyanobacterial industrial biotechnology more feasible in the near future. PMID:27916886

  10. Genetic instability in cyanobacteria – an elephant in the room?

    Directory of Open Access Journals (Sweden)

    Patrik R. Jones

    2014-05-01

    Full Text Available Many research groups are interested in engineering the metabolism of cyanobacteria with the objective to convert solar energy, CO2 and water (perhaps also N2 into commercially valuable products. Towards this objective, many challenges stand in the way before sustainable production can be realized. One of these challenges, potentially, is genetic instability. Although only a handful of reports of this phenomenon are available in the scientific literature, it does appear to be a real issue that so far has not been studied much in cyanobacteria. With this brief perspective, I wish to raise the awareness of this potential issue and hope to inspire future studies on the topic as I believe it will make an important contribution to enabling sustainable large-scale biotechnology in the future using liquid photobiological microorganisms.

  11. Chlorophyll a with a farnesyl tail in thermophilic cyanobacteria.

    Science.gov (United States)

    Wiwczar, Jessica M; LaFountain, Amy M; Wang, Jimin; Frank, Harry A; Brudvig, Gary W

    2017-11-01

    Photosystem II (PSII) of oxygenic photosynthetic organisms normally contains exclusively chlorophyll a (Chl a) as its major light-harvesting pigment. Chl a canonically consists of the chlorin headgroup with a 20-carbon, 4-isoprene unit, phytyl tail. We have examined the 1.9 Å crystal structure of PSII from thermophilic cyanobacteria reported by Shen and coworkers in 2012 (PDB accession of 3ARC/3WU2). A newly refined electron density map from this structure, presented here, reveals that some assignments of the cofactors may be different from those modeled in the 3ARC/3WU2 structure, including a specific Chl a that appears to have a truncated tail by one isoprene unit. We provide experimental evidence using high-performance liquid chromatography and mass spectrometry for a small population of Chl a esterified to a 15-carbon farnesyl tail in PSII of thermophilic cyanobacteria.

  12. Diversity of Cyanobacteria in the Zasavica river, Serbia

    Directory of Open Access Journals (Sweden)

    Predojević Dragana

    2015-01-01

    Full Text Available Cyanobacteria are ancient organisms that are capable of colonizing different habitats in various climatic zones due to their plasticity and rapid accommodation. They are a widely studied group of microorganisms due to the presence of many potentially toxic and invasive species. The aim of this research was a diversity exploration of the freshwater Cyanobacteria in the Zasavica River, which is part of the Special Nature Reserve “Zasavica” in Serbia. Organisms were sampled once a month at two study sites during one year. Phytoplankton and metaphyton analysis showed the presence of 50 freshwater cyanobacterial taxa, of which 12 are new taxa for Serbia. Three invasive and potentially toxic species (Cylindrospermopsis raciborskii, Sphaerospermopsis aphanizomenoides and Raphidiopsis mediterranea were recorded only in metaphyton in April at one site. It can be expected that, if conditions change, this species can migrate and form phytoplankton blooms. [Projekat Ministarstva nauke Republike Srbije, br. ON 176020

  13. Preliminary Assessment of Cyanobacteria Diversity and Toxic Potential in Ten Freshwater Lakes in Selangor, Malaysia.

    Science.gov (United States)

    Sinang, Som Cit; Poh, Keong Bun; Shamsudin, Syakirah; Sinden, Ann

    2015-10-01

    Toxic cyanobacteria blooms are increasing in magnitude and frequency worldwide. However, this issue has not been adequately addressed in Malaysia. Therefore, this study aims to better understand eutrophication levels, cyanobacteria diversity, and microcystin concentrations in ten Malaysian freshwater lakes. The results revealed that most lakes were eutrophic, with total phosphorus and total chlorophyll-a concentrations ranging from 15 to 4270 µg L(-1) and 1.1 to 903.1 µg L(-1), respectively. Cyanobacteria were detected in all lakes, and identified as Microcystis spp., Planktothrix spp., Phormidium spp., Oscillatoria spp., and Lyngbya spp. Microcystis spp. was the most commonly observed and most abundant cyanobacteria recorded. Semi-quantitative microcystin analysis indicated the presence of microcystin in all lakes. These findings illustrate the potential health risk of cyanobacteria in Malaysia freshwater lakes, thus magnifying the importance of cyanobacteria monitoring and management in Malaysian waterways.

  14. CYANOBACTERIA FOR MITIGATING METHANE EMISSION FROM SUBMERGED PADDY FIELDS

    Energy Technology Data Exchange (ETDEWEB)

    Upasana Mishra; Shalini Anand [Department of Environmental Studies, Inderprastha Engineering College, Sahibabad, Ghaziabad (India)

    2008-09-30

    Atmospheric methane, a potent greenhouse gas with high absorption potential for infrared radiation, is responsible for one forth of the total anticipated warming. It is forming a major part of green house gases, next after carbon dioxide. Its concentration has been increasing alarmingly on an average at the rate of one percent per year. Atmospheric methane, originating mainly from biogenic sources such as paddy fields, natural wetlands and landfills, accounts for 15-20% of the world's total anthropogenic methane emission. With intensification of rice cultivation in coming future, methane emissions from paddy fields are anticipated to increase. India's share in world's rice production is next after to China and likewise total methane emission from paddy fields also. Methane oxidation through planktophytes, particularly microalgae which are autotrophic and abundant in rice rhizospheres, hold promise in controlling methane emission from submerged paddy fields. The present study is focused on the role of nitrogen fixing, heterocystous cyanobacteria and Azolla (a water fern harboring a cyanobacterium Anabaena azollae) as biological sink for headspace concentration of methane in flooded soils. In this laboratory study, soil samples containing five potent nitrogen fixer cyanobacterial strains from paddy fields, were examined for their methane reducing potential. Soil sample without cyanobacterial strain was tested and taken as control. Anabaena sp. was found most effective in inhibiting methane concentration by 5-6 folds over the control. Moist soil cores treated with chemical nitrogen, urea, in combination with cyanobacteria mixture, Azolla microphylla or cyanobacteria mixture plus Azolla microphylla exhibited significance reduction in the headspace concentration of methane than the soil cores treated with urea alone. Contrary to other reports, this study also demonstrates that methane oxidation in soil core samples from paddy fields was stimulated by

  15. Subcellular distribution of glutathione and cysteine in cyanobacteria

    OpenAIRE

    Zechmann, Bernd; Tomašić, Ana; Horvat, Lucija; Fulgosi, Hrvoje

    2010-01-01

    Glutathione plays numerous important functions in eukaryotic and prokaryotic cells. Whereas it can be found in virtually all eukaryotic cells, its production in prokaryotes is restricted to cyanobacteria and proteobacteria and a few strains of gram-positive bacteria. In bacteria, it is involved in the protection against reactive oxygen species (ROS), osmotic shock, acidic conditions, toxic chemicals, and heavy metals. Glutathione synthesis in bacteria takes place in two steps out of cysteine,...

  16. Extracellular proteins: Novel key components of metal resistance in cyanobacteria?

    Directory of Open Access Journals (Sweden)

    Joaquin eGiner-Lamia

    2016-06-01

    Full Text Available Metals are essential for all living organisms and required for fundamental biochemical processes. However, when in excess, metals can turn into highly-toxic agents able to disrupt cell membranes, alter enzymatic activities and damage DNA. Metal concentrations are therefore tightly controlled inside cells, particularly in cyanobacteria. Cyanobacteria are ecologically relevant prokaryotes that perform oxygenic photosynthesis and can be found in many different marine and freshwater ecosystems, including environments contaminated with heavy metals. As their photosynthetic machinery imposes high demands for metals, homeostasis of these micronutrients has been widely studied in cyanobacteria. So far, most studies have focused on how cells are capable of controlling their internal metal pools, with a strong bias towards the analysis of intracellular processes. Ultrastructure, modulation of physiology, dynamic changes in transcription and protein levels have been studied, but what takes place in the extracellular environment when cells are exposed to an unbalanced metal availability remains largely unknown. The interest in studying the subset of proteins present in the extracellular space has only recently begun and the identification and functional analysis of the cyanobacterial exoproteomes are just emerging. Remarkably, metal-related proteins such as the copper-chaperone CopM or the iron-binding protein FutA2 have already been identified outside the cell. With this perspective, we aim to raise the awareness that metal-resistance mechanisms are not yet fully known and hope to motivate future studies assessing the role of extracellular proteins on bacterial metal homeostasis, with a special focus on cyanobacteria.

  17. CyanoClust: comparative genome resources of cyanobacteria and plastids

    OpenAIRE

    Sasaki, Naobumi V.; Sato, Naoki

    2010-01-01

    Cyanobacteria, which perform oxygen-evolving photosynthesis as do chloroplasts of plants and algae, are one of the best-studied prokaryotic phyla and one from which many representative genomes have been sequenced. Lack of a suitable comparative genomic database has been a problem in cyanobacterial genomics because many proteins involved in physiological functions such as photosynthesis and nitrogen fixation are not catalogued in commonly used databases, such as Clusters of Orthologous Protein...

  18. Antimicrobial and Cytotoxic Assessment of Marine Cyanobacteria - Synechocystis and Synechococcus

    OpenAIRE

    Martins, Rosário F.; Ramos, Miguel F.; Herfindal, Lars; Sousa, José A.; Skærven, Kaja; Vasconcelos, Vitor M.

    2008-01-01

    Aqueous extracts and organic solvent extracts of isolated marine cyanobacteria strains were tested for antimicrobial activity against a fungus, Gram-positive and Gram-negative bacteria and for cytotoxic activity against primary rat hepatocytes and HL-60 cells. Antimicrobial activity was based on the agar diffusion assay. Cytotoxic activity was measured by apoptotic cell death scored by cell surface evaluation and nuclear morphology. A high percentage of apoptotic cells were observed for HL-60...

  19. Cyanobacteria as efficient producers of mycosporine-like amino acids.

    Science.gov (United States)

    Jain, Shikha; Prajapat, Ganshyam; Abrar, Mustari; Ledwani, Lalita; Singh, Anoop; Agrawal, Akhil

    2017-09-01

    Mycosporine-like amino acids are the most common group of transparent ultraviolet radiation absorbing intracellular secondary metabolites. These molecules absorb light in the range of ultraviolet-A and -B with a maximum absorbance between 310 and 362 nm. Cyanobacteria might have faced the most deleterious ultraviolet radiation, which leads to an evolution of ultraviolet protecting mycosporine-like amino acids for efficient selection in the environment. In the last 30 years, scientists have investigated various cyanobacteria for novel mycosporine-like amino acids, applying different induction techniques. This review organizes all the cyanobacterial groups that produce various mycosporine-like amino acids. We found out that cyanobacteria belonging to orders Synechococcales, Chroococcales, Oscillatoriales, and Nostocales are frequently studied for the presence of mycosporine-like amino acids, while orders Gloeobacterales, Spirulinales, Pleurocapsales, and Chroococcidiopsidales are still need to be investigated. Nostoc and Anabaena strains are major studied genus for the mycosporine-like amino acids production. Hence, this review will give further insight to the readers about potential mycosporine-like amino acid producing cyanobacterial groups in future investigations. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Climate change and regulation of hepatotoxin production in Cyanobacteria.

    Science.gov (United States)

    Gehringer, Michelle M; Wannicke, Nicola

    2014-04-01

    Harmful, bloom-forming cyanobacteria (CyanoHABs) are occurring with increasing regularity in freshwater and marine ecosystems. The most commonly occurring cyanobacterial toxins are the hepatotoxic microcystin and nodularin. These cyclic hepta- and pentapeptides are synthesised nonribosomally by the gene products of the toxin gene clusters mcy and nda, respectively. Understanding of the regulation of hepatotoxin production is incomplete, although there is strong evidence supporting the roles of iron, light, higher nitrate availability and inorganic carbon in modulating microcystin levels. The majority of these studies have focused on the unicellular freshwater, microcystin-producing strain of Microcystis aeruginosa, with little attention being paid to terrestrial or marine toxin producers. This review intends to investigate the regulation of microcystin and nodularin production in unicellular and filamentous diazotrophic cyanobacteria against the background of changing climate conditions. Special focus is given to diazotrophic filamentous cyanobacteria, for example Nodularia spumigena, capable of regulating their nitrogen levels by actively fixing dinitrogen. By combining data from significant studies, an overall scheme of the regulation of toxin production is presented, focussing specifically on nodularin production in diazotrophs against the background of increasing carbon dioxide concentrations and temperatures envisaged under current climate change models. Furthermore, the risk of sustaining and spreading CyanoHABs in the future ocean is evaluated. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  1. Synthetic Biology of Cyanobacteria: Unique Challenges and Opportunities

    Directory of Open Access Journals (Sweden)

    Bertram M Berla

    2013-08-01

    Full Text Available Photosynthetic organisms, and especially cyanobacteria, hold great promise as sources of renewably-produced fuels, bulk and specialty chemicals, and nutritional products. Synthetic biology tools can help unlock cyanobacteria’s potential for these functions, but unfortunately tool development for these organisms has lagged behind that for S. cerevisiae and E. coli. While these organisms may in many cases be more difficult to work with as ‘chassis’ strains for synthetic biology than certain heterotrophs, the unique advantages of autotrophs in biotechnology applications as well as the scientific importance of improved understanding of photosynthesis warrant the development of these systems into something akin to a ‘green E. coli’. In this review, we highlight unique challenges and opportunities for development of synthetic biology approaches in cyanobacteria. We review classical and recently developed methods for constructing targeted mutants in various cyanobacterial strains, and offer perspective on what genetic tools might most greatly expand the ability to engineer new functions in such strains. Similarly, we review what genetic parts are most needed for the development of cyanobacterial synthetic biology. Finally, we highlight recent methods to construct genome-scale models of cyanobacterial metabolism and to use those models to measure properties of autotrophic metabolism. Throughout this paper, we discuss some of the unique challenges of a diurnal, autotrophic lifestyle along with how the development of synthetic biology and biotechnology in cyanobacteria must fit within those constraints.

  2. Use of cyanobacteria to assess water quality in running waters

    International Nuclear Information System (INIS)

    Douterelo, I.; Perona, E.; Mateo, P.

    2004-01-01

    Epilithic cyanobacterial communities in rivers in the province of Madrid (Spain) and their relationship with water quality were studied. Sampling locations above and below outlets for sewage effluent and other wastes from human settlements were selected. We aimed to evaluate the use of cyanobacteria as potential indicators of pollution in running waters. Large increases in nutrient concentrations were always observed at downstream sampling sites. A decrease in species richness and the Margalef diversity index were associated with these increases in nutrient load. Differences in cyanobacterial community structure were also observed. A higher proportion of cyanobacteria belonging to the Oscillatoriales order predominated at sampling sites with higher nutrient content. However, Nostocales species were more abundant at upstream sites characterized by lower nutrient load than at downstream locations. The soluble reactive phosphate (SRP) had a threshold effect on cyanobacterial biomass: a decrease in phycobiliprotein content as SRP increased, reaching a minimum, followed by an increase in abundance. This increase may be attributed to hypertrophic conditions in those locations. Our results and literature data confirm the suitability of this phototroph community for monitoring eutrophication in rivers - Taxonomic composition of cyanobacteria is a sensitive indicator of river water quality

  3. Integration vector for the cyanobacteria Synechocystis sp. 6803

    International Nuclear Information System (INIS)

    Shestakov, S.V.; Elanskaya, I.V.; Bibikova, M.V.

    1985-01-01

    The authors have constructed recombinant plasmid DNA molecules with fragments of chromosomal DNA of the cyanobacterium Synechocystis 6803 in the vector plasmid pACYC 184, carrying markers for resistance against tetracycline (TC/sup r/) and chloramphenicol (Cm/sup r/). The authors also present their scheme of constructing integration vectors for Synechocystis 6803. To demonstrate integration of the recombinant plasmids of pSIS and pSIB series into the chromosomes of cyanobacteria, chromosomal DNA was isolated from the Cm/sup r/ transformants of Synechocystis 6803, and used for blot-hybridization using P 32-labeled plasmid DNA of pACYC 184. The hybridization results show that the chromosomal DNA isolated from the Cm/sup r/ transformants of cyanobacteria carries a region homologous with plasmid pACYC 184, whereas the DNA from wild type cells does not hybridize with pACYC 184. The transformation frequency of the Synechocystis 6803 cells by chromosomal DNA from the Cm/sup r/ clones of cyanobacteria was 3-7 x 10 -5 , which corresponds to the frequency of chromosomal transformation for other markers

  4. Use of cyanobacteria to assess water quality in running waters

    Energy Technology Data Exchange (ETDEWEB)

    Douterelo, I.; Perona, E.; Mateo, P

    2004-02-01

    Epilithic cyanobacterial communities in rivers in the province of Madrid (Spain) and their relationship with water quality were studied. Sampling locations above and below outlets for sewage effluent and other wastes from human settlements were selected. We aimed to evaluate the use of cyanobacteria as potential indicators of pollution in running waters. Large increases in nutrient concentrations were always observed at downstream sampling sites. A decrease in species richness and the Margalef diversity index were associated with these increases in nutrient load. Differences in cyanobacterial community structure were also observed. A higher proportion of cyanobacteria belonging to the Oscillatoriales order predominated at sampling sites with higher nutrient content. However, Nostocales species were more abundant at upstream sites characterized by lower nutrient load than at downstream locations. The soluble reactive phosphate (SRP) had a threshold effect on cyanobacterial biomass: a decrease in phycobiliprotein content as SRP increased, reaching a minimum, followed by an increase in abundance. This increase may be attributed to hypertrophic conditions in those locations. Our results and literature data confirm the suitability of this phototroph community for monitoring eutrophication in rivers - Taxonomic composition of cyanobacteria is a sensitive indicator of river water quality.

  5. Biomineralization Patterns of Intracellular Carbonatogenesis in Cyanobacteria: Molecular Hypotheses

    Directory of Open Access Journals (Sweden)

    Jinhua Li

    2016-02-01

    Full Text Available The recent discovery of intracellular carbonatogenesis in several cyanobacteria species has challenged the traditional view that this process was extracellular and not controlled. However, a detailed analysis of the size distribution, chemical composition and 3-D-arrangement of carbonates in these cyanobacteria is lacking. Here, we characterized these features in Candidatus Gloeomargarita lithophora C7 and Candidatus Synechococcus calcipolaris G9 by conventional transmission electron microscopy, tomography, ultramicrotomy, and scanning transmission X-ray microscopy (STXM. Both Ca. G. lithophora C7 and Ca. S. calcipolaris G9 formed numerous polyphosphate granules adjacent or engulfing Ca-carbonate inclusions when grown in phosphate-rich solutions. Ca-carbonates were scattered within Ca. G. lithophora C7 cells under these conditions, but sometimes arranged in one or several chains. In contrast, Ca-carbonates formed at cell septa in Ca. S. calcipolaris G9 and were segregated equally between daughter cells after cell division, arranging as distorted disks at cell poles. The size distribution of carbonates evolved from a positively to a negatively skewed distribution as particles grew. Conventional ultramicrotomy did not preserve Ca-carbonates explaining partly why intracellular calcification has been overlooked in the past. All these new observations allow discussing with unprecedented insight some nucleation and growth processes occurring in intracellularly calcifying cyanobacteria with a particular emphasis on the possible involvement of intracellular compartments and cytoskeleton.

  6. Incorporating nitrogen fixing cyanobacteria in the global biogeochemical model HAMOCC

    Science.gov (United States)

    Paulsen, Hanna; Ilyina, Tatiana; Six, Katharina

    2015-04-01

    Nitrogen fixation by marine diazotrophs plays a fundamental role in the oceanic nitrogen and carbon cycle as it provides a major source of 'new' nitrogen to the euphotic zone that supports biological carbon export and sequestration. Since most global biogeochemical models include nitrogen fixation only diagnostically, they are not able to capture its spatial pattern sufficiently. Here we present the incorporation of an explicit, dynamic representation of diazotrophic cyanobacteria and the corresponding nitrogen fixation in the global ocean biogeochemical model HAMOCC (Hamburg Ocean Carbon Cycle model), which is part of the Max Planck Institute for Meteorology Earth system model (MPI-ESM). The parameterization of the diazotrophic growth is thereby based on available knowledge about the cyanobacterium Trichodesmium spp., which is considered as the most significant pelagic nitrogen fixer. Evaluation against observations shows that the model successfully reproduces the main spatial distribution of cyanobacteria and nitrogen fixation, covering large parts of the tropical and subtropical oceans. Besides the role of cyanobacteria in marine biogeochemical cycles, their capacity to form extensive surface blooms induces a number of bio-physical feedback mechanisms in the Earth system. The processes driving these interactions, which are related to the alteration of heat absorption, surface albedo and momentum input by wind, are incorporated in the biogeochemical and physical model of the MPI-ESM in order to investigate their impacts on a global scale. First preliminary results will be shown.

  7. Light-dependent governance of cell shape dimensions in cyanobacteria

    Directory of Open Access Journals (Sweden)

    Beronda L Montgomery

    2015-05-01

    Full Text Available The regulation of cellular dimension is important for the function and survival of cells. Cellular dimensions, such as size and shape, are regulated throughout the life cycle of bacteria and can be adapted in response to environmental changes to fine-tune cellular fitness. Cell size and shape are generally coordinated with cell growth and division. Cytoskeletal regulation of cell shape and cell wall biosynthesis and/or deposition occurs in a range of organisms. Photosynthetic organisms, such as cyanobacteria, particularly exhibit light-dependent regulation of morphogenes and generation of reactive oxygen species and other signals that can impact cellular dimensions. Environmental signals initiate adjustments of cellular dimensions, which may be vitally important for optimizing resource acquisition and utilization or for coupling the cellular dimensions with the regulation of subcellular organization to maintain optimal metabolism. Although the involvement of cytoskeletal components in the regulation of cell shape is widely accepted, the signaling factors that regulate cytoskeletal and other distinct components involved in cell shape control, particularly in response to changes in external light cues, remain to be fully elucidated. In this review, factors impacting the inter-coordination of growth and division, the relationship between the regulation of cellular dimensions and central carbon metabolism, and consideration of the effects of specific environment signals, primarily light, on cell dimensions in cyanobacteria will be discussed. Current knowledge about the molecular bases of the light-dependent regulation of cellular dimensions and cell shape in cyanobacteria will be highlighted.

  8. Biodegradation of Dimethyl Phthalate by Freshwater Unicellular Cyanobacteria.

    Science.gov (United States)

    Zhang, Xiaohui; Liu, Lincong; Zhang, Siping; Pan, Yan; Li, Jing; Pan, Hongwei; Xu, Shiguo; Luo, Feng

    2016-01-01

    The biodegradation characteristics of dimethyl phthalate (DMP) by three freshwater unicellular organisms were investigated in this study. The findings revealed that all the organisms were capable of metabolizing DMP; among them, Cyanothece sp. PCC7822 achieved the highest degradation efficiency. Lower concentration of DMP supported the growth of the Cyanobacteria; however, with the increase of DMP concentration growth of Cyanobacteria was inhibited remarkably. Phthalic acid (PA) was detected to be an intermediate degradation product of DMP and accumulated in the culture solution. The optimal initial pH value for the degradation was detected to be 9.0, which mitigated the decrease of pH resulting from the production of PA. The optimum temperature for DMP degradation of the three species of organisms is 30°C. After 72 hours' incubation, no more than 11.8% of the residual of DMP aggregated in Cyanobacteria cells while majority of DMP remained in the medium. Moreover, esterase was induced by DMP and the activity kept increasing during the degradation process. This suggested that esterase could assist in the degradation of DMP.

  9. Biodegradation of Dimethyl Phthalate by Freshwater Unicellular Cyanobacteria

    Science.gov (United States)

    Zhang, Xiaohui; Liu, Lincong; Zhang, Siping; Pan, Yan; Li, Jing; Pan, Hongwei

    2016-01-01

    The biodegradation characteristics of dimethyl phthalate (DMP) by three freshwater unicellular organisms were investigated in this study. The findings revealed that all the organisms were capable of metabolizing DMP; among them, Cyanothece sp. PCC7822 achieved the highest degradation efficiency. Lower concentration of DMP supported the growth of the Cyanobacteria; however, with the increase of DMP concentration growth of Cyanobacteria was inhibited remarkably. Phthalic acid (PA) was detected to be an intermediate degradation product of DMP and accumulated in the culture solution. The optimal initial pH value for the degradation was detected to be 9.0, which mitigated the decrease of pH resulting from the production of PA. The optimum temperature for DMP degradation of the three species of organisms is 30°C. After 72 hours' incubation, no more than 11.8% of the residual of DMP aggregated in Cyanobacteria cells while majority of DMP remained in the medium. Moreover, esterase was induced by DMP and the activity kept increasing during the degradation process. This suggested that esterase could assist in the degradation of DMP. PMID:28078293

  10. Protective Effect of Water Extracted Spirulina maxima on Glutamate-induced Neuronal Cell Death in Mouse Hippocampal HT22 Cell.

    Science.gov (United States)

    Lee, Hyeon Yong; Ryu, Ga Hee; Choi, Woon Yong; Yang, Woo Seung; Lee, Hyeon Woo; Ma, Choong Je

    2018-01-01

    Spirulina maxima was used as important nutritional source in the Aztec civilization because it is rich in proteins and vitamins. It contains various antioxidants such as phycocyanin and flavonoids. Based on abundant antioxidants, S. maxima is known to possess anti-inflammatory effect, especially on neuronal cells. S. maxima was extracted in water and contain of phycocyanin was identified by high-performance liquid chromatography. Cell viability test was performed with treatment of S. maxima extract. After, oxidative stress-related mechanisms were evaluated by detecting the accumulation of reactive oxygen species (ROS) and Ca 2+ influx, and decrease of mitochondrial membrane potential (MMP) level. Then, the glutathione (GSH) related assays were conducted. The water extracted S. maxima exerted the neuroprotective activity by attenuating the ROS and Ca 2+ formation, maintaining the MMP level, and protecting the activity of the antioxidant enzymes by increasing reduced GSH against oxidative stress compared to control. The results suggested that water extracted S. maxima showed powerful neuroprotective effect through the mechanism related to antioxidant activity, able to preventing the radical-mediated cell death. Water extracted Spirulina maxima contains C-phycocyaninWater extracted Spirulina maxima exerts neuroprotective effect on HT22 cellTo investigate the protective mechanisms, reactive oxygen species, Ca 2+ , mitochondrial membrane potential, Glutathione-related assays were performed. Abbreviations used: ROS: Reactive oxygen species; MMP: Mitochondrial membrane potential; GSH: Glutathione; GSSG: Glutathione disulfide, oxidized glutathione; GPx: Glutathione peroxidase; GR: Glutathione reductase; DMEM: Dulbecco's modified Eagle's medium; FBS: Fetal bovine serum; DCF-DA: 2',7'-dichlorofluorescein diacetate; PBS: Phosphate buffered serum; Rho 123: Rhodamine 123; NADPH: Nicotinamide adenine dinucleotide phosphate; DTNB: 5,5'-dithiobis-2-nitrobenzoic acid, Ellman

  11. Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 3090”. This cluster ID is uniquely-assigned by the PGDBj Ortholog Database. Cluster size Number of proteins ...ster About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Cluster (Cyanobacteria) Data detail Data name Cluster (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  12. Cyanobacteria: Photoautotrophic Microbial Factories for the Sustainable Synthesis of Industrial Products

    OpenAIRE

    Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf

    2015-01-01

    Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of int...

  13. Immobilized periphytic cyanobacteria for removal of nitrogenous compounds and phosphorus from shrimp farm wastewater

    OpenAIRE

    BANERJEE, SANJOY; KHATOON, HELENA; SHARIFF, MOHAMED; YUSOFF, FATIMAH

    2015-01-01

    Cyanobacteria can be used to remove nitrogenous compounds from wastewater, but a major bottleneck in the process is the separation of cyanobacterial biomass from the treated water discharge, which may cause eutrophication. The current study assessed the suitability of three periphytic cyanobacteria (Geitlerinema sp., Gloeotrichia sp., and Lyngbya sp.) isolated from shrimp ponds. These cyanobacteria were immobilized by self-adhesion to polyvinyl chloride sheets, forming mats, and were screened...

  14. Capacidade antioxidante da microalga Spirulina platensis em células da levedura Saccharomyces cerevisiae submetidas ao estressor paraquat

    OpenAIRE

    Guarienti, Cíntia; Bertolin, Telma Elita; Costa, Jorge Alberto Vieira

    2010-01-01

    Em virtude de várias publicações terem mostrado a alta associação entre a geração de radicais livres e as doenças crônico-degenerativas, tem havido grande interesse por alimentos funcionais antioxidantes. O excesso de espécies reativas no organismo resulta em estresse oxidativo que provoca danos celulares e teciduais. A microalga Spirulina tem sido pesquisada em função de suas propriedades nutricionais e antioxidantes. O objetivo desse trabalho foi de avaliar a atividade antioxidante da mi...

  15. Investigation of the Structure and Element Composition of C-Phycocyanin Extracted from the Microalgae Spirulina platensis

    CERN Document Server

    Mosulishvili, L M; Kirkesali, E I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F

    2002-01-01

    The structure and element composition of C-phycocyanin (C-PC) extracted from the blue-green alga Spirulina platensis were studied. The behavior of structural subunits forming phycobilisomes in the purification process was studied by capillary electrophoresis. Their proportion in high-purity C-PC was determined. The element composition of C-PC of different purity was studied by means of epithermal neutron activation analysis, and metals which may form macromolecular complexes with C-PC were determined (Zn, Cr, Ni, Co, As, Sr, Mo, Ag, Hg). It was shown that contents of toxic metals did not exceed accepted permissible levels for the human organism.

  16. Health risk assessment standards of cyanobacteria bloom occurrence in bathing sites

    Directory of Open Access Journals (Sweden)

    Agnieszka Stankiewicz

    2011-03-01

    Full Text Available Threat for human health appears during a massive cyanobacteria bloom in potable water used for human consumption or in basins used for recreational purposes. General health risk assessment standards and preventive measures to be taken by sanitation service were presented in scope of: – evaluation of cyanobacteria bloom occurrence in bathing sites / water bodies, – procedures in case of cyanobacteria bloom, including health risk assessment and decision making process to protect users’ health at bathing sites, – preventive measures, to be taken in case of cyanobacteria bloom occurrence in bathing sites and basins, where bathing sites are located.

  17. Cyanobacteria: Photoautotrophic Microbial Factories for the Sustainable Synthesis of Industrial Products.

    Science.gov (United States)

    Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf

    2015-01-01

    Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed.

  18. Cyanobacteria: Photoautotrophic Microbial Factories for the Sustainable Synthesis of Industrial Products

    Science.gov (United States)

    Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf

    2015-01-01

    Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed. PMID:26199945

  19. Cyanobacteria: Photoautotrophic Microbial Factories for the Sustainable Synthesis of Industrial Products

    Directory of Open Access Journals (Sweden)

    Nyok-Sean Lau

    2015-01-01

    Full Text Available Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed.

  20. Screening of Norharmane from Seven Cyanobacteria by High-performance Liquid Chromatography.

    Science.gov (United States)

    Karan, Tunay; Erenler, Ramazan

    2017-10-01

    Cyanobacteria, including pharmaceutically and medicinally valuable compounds attract the great attention lately. Norharmane (9H-pyrido (3,4-b) indole found in some cyanobacteria revealed a great number of biological effects. Seven cyanobacteria were isolated and identified from Yesilirmak River and Gaziosmanpasa University Campus to determine the norharmane content. Cyanobacteria collected from Tokat, Turkey were isolated and identified by morphologically. Norharmane (9H-pyrido [3,4-b] indole) quantities were presented for seven cyanobacteria, Chroococcus minutus (Kütz.) Nägeli, Geitlerinema carotinosum (Geitler) Anagnostidis, Nostoc linckia Bornet ex Bornet and Flahault, Anabaena oryzae F. E. Fritsch, Oscillatoria limnetica Lemmermann, Phormidium sp . Kützing ex Gomont, and Cylindrospermum sp . Kutzing ex E. Bornet and C. Flahault by high-performance liquid chromatography. The norharmane amount indicated for cyanobacterial culture media altered in a species-dependent kind in the range of 0.81-10.87 μg/g. C. minutus produced the most norharmane among the investigated cyanobacteria as 10.87 μg/g. Cyanobacteria could be an important source of norharmane as well as pharmaceutically valuable compounds. Seven cyanobacteria were isolated and identified from Yesilirmak RiverQuantitative analysis of norharmane was executed on isolated cyanobacteriaFour cyanobecteria species included the norharmane Chroococcus minutus contained the most norharmane (10.87 μg/g). Abbreviations used: HPLC: High performance liquid chromatograph.

  1. IMPROVING CYANOBACTERIA AND CYANOTOXIN MONITORING IN SURFACE WATERS FOR DRINKING WATER SUPPLY

    Directory of Open Access Journals (Sweden)

    Jing Li

    2017-06-01

    Full Text Available Cyanobacteria in fresh water can cause serious threats to drinking water supplies. Managing cyanobacterial blooms particularly at small drinking water treatment plants is challenging. Because large amount of cyanobacteria may cause clogging in the treatment process and various cyanotoxins are hard to remove, while they may cause severe health problems. There is lack of instructions of what cyanobacteria/toxin amount should trigger what kind of actions for drinking water management except for Microcystins. This demands a Cyanobacteria Management Tool (CMT to help regulators/operators to improve cyanobacteria/cyanotoxin monitoring in surface waters for drinking water supply. This project proposes a CMT tool, including selecting proper indicators for quick cyanobacteria monitoring and verifying quick analysis methods for cyanobacteria and cyanotoxin. This tool is suggested for raw water management regarding cyanobacteria monitoring in lakes, especially in boreal forest climate. In addition, it applies to regions that apply international WHO standards for water management. In Swedish context, drinking water producers which use raw water from lakes that experience cyanobacterial blooms, need to create a monitoring routine for cyanobacteria/cyanotoxin and to monitor beyond such as Anatoxins, Cylindrospermopsins and Saxitoxins. Using the proposed CMT tool will increase water safety at surface water treatment plants substantially by introducing three alerting points for actions. CMT design for each local condition should integrate adaptive monitoring program.

  2. Diverse taxa of cyanobacteria produce beta-N-methylamino-L-alanine, a neurotoxic amino acid.

    Science.gov (United States)

    Cox, Paul Alan; Banack, Sandra Anne; Murch, Susan J; Rasmussen, Ulla; Tien, Georgia; Bidigare, Robert Richard; Metcalf, James S; Morrison, Louise F; Codd, Geoffrey A; Bergman, Birgitta

    2005-04-05

    Cyanobacteria can generate molecules hazardous to human health, but production of the known cyanotoxins is taxonomically sporadic. For example, members of a few genera produce hepatotoxic microcystins, whereas production of hepatotoxic nodularins appears to be limited to a single genus. Production of known neurotoxins has also been considered phylogenetically unpredictable. We report here that a single neurotoxin, beta-N-methylamino-L-alanine, may be produced by all known groups of cyanobacteria, including cyanobacterial symbionts and free-living cyanobacteria. The ubiquity of cyanobacteria in terrestrial, as well as freshwater, brackish, and marine environments, suggests a potential for wide-spread human exposure.

  3. Diverse taxa of cyanobacteria produce β-N-methylamino-l-alanine, a neurotoxic amino acid

    Science.gov (United States)

    Cox, Paul Alan; Banack, Sandra Anne; Murch, Susan J.; Rasmussen, Ulla; Tien, Georgia; Bidigare, Robert Richard; Metcalf, James S.; Morrison, Louise F.; Codd, Geoffrey A.; Bergman, Birgitta

    2005-01-01

    Cyanobacteria can generate molecules hazardous to human health, but production of the known cyanotoxins is taxonomically sporadic. For example, members of a few genera produce hepatotoxic microcystins, whereas production of hepatotoxic nodularins appears to be limited to a single genus. Production of known neurotoxins has also been considered phylogenetically unpredictable. We report here that a single neurotoxin, β-N-methylamino-l-alanine, may be produced by all known groups of cyanobacteria, including cyanobacterial symbionts and free-living cyanobacteria. The ubiquity of cyanobacteria in terrestrial, as well as freshwater, brackish, and marine environments, suggests a potential for wide-spread human exposure. PMID:15809446

  4. Screening of Norharmane from Seven Cyanobacteria by High-performance Liquid Chromatography

    Science.gov (United States)

    Karan, Tunay; Erenler, Ramazan

    2017-01-01

    Background: Cyanobacteria, including pharmaceutically and medicinally valuable compounds attract the great attention lately. Norharmane (9H-pyrido (3,4-b) indole found in some cyanobacteria revealed a great number of biological effects. Objective: Seven cyanobacteria were isolated and identified from Yesilirmak River and Gaziosmanpasa University Campus to determine the norharmane content. Materials and Methods: Cyanobacteria collected from Tokat, Turkey were isolated and identified by morphologically. Norharmane (9H-pyrido [3,4-b] indole) quantities were presented for seven cyanobacteria, Chroococcus minutus (Kütz.) Nägeli, Geitlerinema carotinosum (Geitler) Anagnostidis, Nostoc linckia Bornet ex Bornet and Flahault, Anabaena oryzae F. E. Fritsch, Oscillatoria limnetica Lemmermann, Phormidium sp. Kützing ex Gomont, and Cylindrospermum sp. Kutzing ex E. Bornet and C. Flahault by high-performance liquid chromatography. Results: The norharmane amount indicated for cyanobacterial culture media altered in a species-dependent kind in the range of 0.81–10.87 μg/g. C. minutus produced the most norharmane among the investigated cyanobacteria as 10.87 μg/g. Conclusion: Cyanobacteria could be an important source of norharmane as well as pharmaceutically valuable compounds. SUMMARY Seven cyanobacteria were isolated and identified from Yesilirmak RiverQuantitative analysis of norharmane was executed on isolated cyanobacteriaFour cyanobecteria species included the norharmaneChroococcus minutus contained the most norharmane (10.87 μg/g). Abbreviations used: HPLC: High performance liquid chromatograph. PMID:29142439

  5. Computational analysis of LexA regulons in Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Su Zhengchang

    2010-09-01

    Full Text Available Abstract Background The transcription factor LexA plays an important role in the SOS response in Escherichia coli and many other bacterial species studied. Although the lexA gene is encoded in almost every bacterial group with a wide range of evolutionary distances, its precise functions in each group/species are largely unknown. More recently, it has been shown that lexA genes in two cyanobacterial genomes Nostoc sp. PCC 7120 and Synechocystis sp. PCC 6803 might have distinct functions other than the regulation of the SOS response. To gain a general understanding of the functions of LexA and its evolution in cyanobacteria, we conducted the current study. Results Our analysis indicates that six of 33 sequenced cyanobacterial genomes do not harbor a lexA gene although they all encode the key SOS response genes, suggesting that LexA is not an indispensable transcription factor in these cyanobacteria, and that their SOS responses might be regulated by different mechanisms. Our phylogenetic analysis suggests that lexA was lost during the course of evolution in these six cyanobacterial genomes. For the 26 cyanobacterial genomes that encode a lexA gene, we have predicted their LexA-binding sites and regulons using an efficient binding site/regulon prediction algorithm that we developed previously. Our results show that LexA in most of these 26 genomes might still function as the transcriptional regulator of the SOS response genes as seen in E. coli and other organisms. Interestingly, putative LexA-binding sites were also found in some genomes for some key genes involved in a variety of other biological processes including photosynthesis, drug resistance, etc., suggesting that there is crosstalk between the SOS response and these biological processes. In particular, LexA in both Synechocystis sp. PCC6803 and Gloeobacter violaceus PCC7421 has largely diverged from those in other cyanobacteria in the sequence level. It is likely that LexA is no longer a

  6. Protective effects of a polysaccharide from Spirulina platensis on dopaminergic neurons in an MPTP-induced Parkinson′s disease model in C57BL/6J mice

    Directory of Open Access Journals (Sweden)

    Fang Zhang

    2015-01-01

    Full Text Available The present study aimed to determine whether a polysaccharide obtained from Spirulina platensis shows protective effects on dopaminergic neurons. A Parkinson′s disease model was established through the intraperitoneal injection of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP in C57BL/6J mice. Prior to the MPTP injection, some mice were pretreated with intraperitoneal injections of a polysaccharide derived from Spirulina platensis once daily for 10 days. The results showed that the immunoreactive staining and mRNA expression of the dopamine transporter and tyrosine hydroxylase, the rate-limiting enzyme in dopamine synthesis, in the substantia nigra, were significantly increased in mice pretreated with 800 mg/kg of the polysaccharide compared with those in MPTP-treated mice. The activities of superoxide dismutase and glutathione peroxidase in the serum and midbrain were also increased significantly in mice injected with MPTP after pretreatment with the polysaccharide from Spirulina platensis. By contrast, the activity of monoamine oxidase B in serum and midbrain maintained unchanged. These experimental findings indicate that the polysaccharide obtained from Spirulina platensis plays a protective role against the MPTP-induced loss of dopaminergic neurons in C57BL/6J mice, and that the antioxidative properties of this polysaccharide likely underlie its neuroprotective effect.

  7. Effect of spirulina on the levels of zinc, vitamin E and linoleic acid in the palm skin extracts of people with prolonged exposure to arsenic

    Directory of Open Access Journals (Sweden)

    Mir Misbahuddin

    2013-03-01

    Full Text Available Spirulina, a dietary supplement, improves the symptoms of arsenical palmer keratosis. To understand its mechanism of action, palm skin extracts of moderate palmer arsenical keratosis (n=10, arsenic exposed controls (n=10 and healthy volunteers (n=10 were collected before and after treatment with spirulina powder 10 g/day orally for 12 weeks. The mean (±SD amount of zinc in the palm skin of healthy volunteers was 13.1 ± 5.7 ng/cm2, which was not changed significantly in patients (11.3 ± 5.3 ng/cm2. The amount of vitamin E in healthy volunteers was 6.0 ± 0.3 ng/cm2 which was severely reduced in patients (3.5 ± 0.6 ng/cm2. The amount of linoleic acid was lowered in patient (26.7 ± 17.1 ng/cm2 which was statistically significant in comparison to healthy volunteers (p=0.029. After supplementation of spirulina, zinc level in the palm skin of arsenic exposed controls was increased but it was not statistically significant (p=0.068. The vitamin E and linoleic acid levels were not changed significantly in the skin of palm. In conclusion, arsenical keratosis showed significantly low levels of vitamin E and linoleic acid without any significant change in zinc level. After supplementation of spirulina, low levels of these three compounds were not returned towards the normal levels.

  8. Optimization of Growth Conditions for Purification and Production of L-Asparaginase by Spirulina maxima

    Science.gov (United States)

    El Baroty, Gamal S.

    2016-01-01

    L-asparaginase (L-AsnA) is widely distributed among microorganisms and has important applications in medicine and in food technology sectors. Therefore, the ability of the production, purification, and characterization of AsnA from Spirulina maxima (SM) were tested. SM cultures grown in Zarrouk medium containing different N2 (in NaNO3 form) concentrations (1.25, 2.50, and 5.0 g/L) for 18 days contained a significant various quantity of dry biomass yields and AsnA enzyme levels. MS L-AsnA activity was found to be directly proportional to the N2 concentration. The cultures of SM at large scales (300 L medium, 5 g/L N2) showed a high AsnA enzyme activity (898 IU), total protein (405 mg/g), specific enzyme activity (2.21 IU/mg protein), and enzyme yield (51.28 IU/L) compared with those in low N2 cultures. The partial purification of crude MS AsnA enzyme achieved by 80% ammonium sulfate AS precipitated and CM-Sephadex C-200 gel filtration led to increases in the purification of enzyme with 5.28 and 10.91 times as great as that in SM crude enzymes. Optimum pH and temperature of purified AsnA for the hydrolyzate were 8.5 and 37 ± 0.2°C, respectively. To the best of our knowledge, this is the first report on L-asparaginase production in S. maxima. PMID:27525017

  9. Anti-Inflammatory Effects of Spirulina platensis Extract via the Modulation of Histone Deacetylases

    Directory of Open Access Journals (Sweden)

    Tho X. Pham

    2016-06-01

    Full Text Available We previously demonstrated that the organic extract of Spirulina platensis (SPE, an edible blue-green alga, possesses potent anti-inflammatory effects. In this study, we investigated if the regulation of histone deacetylases (HDACs play a role in the anti-inflammatory effect of SPE in macrophages. Treatment of macrophages with SPE rapidly and dose-dependently reduced HDAC2, 3, and 4 proteins which preceded decreases in their mRNA levels. Degradation of HDAC4 protein was attenuated in the presence of inhibitors of calpain proteases, lysosomal acidification, and Ca2+/calmodulin-dependent protein kinase II, respectively, but not a proteasome inhibitor. Acetylated histone H3 was increased in SPE-treated macrophages to a similar level as macrophages treated with a pan-HDAC inhibitor, with concomitant inhibition of inflammatory gene expression upon LPS stimulation. Knockdown of HDAC3 increased basal and LPS-induced pro-inflammatory gene expression, while HDAC4 knockdown increased basal expression of interleukin-1β (IL-1β, but attenuated LPS-induced inflammatory gene expression. Chromatin immunoprecipitation showed that SPE decreased p65 binding and H3K9/K14 acetylation at the Il-1β and tumor necrosis factor α (Tnfα promoters. Our results suggest that SPE increased global histone H3 acetylation by facilitating HDAC protein degradation, but decreases histone H3K9/K14 acetylation and p65 binding at the promoters of Il-1β and Tnfα to exert its anti-inflammatory effect.

  10. Optimization of Growth Conditions for Purification and Production of L-Asparaginase by Spirulina maxima

    Directory of Open Access Journals (Sweden)

    Hanaa H. Abd El Baky

    2016-01-01

    Full Text Available L-asparaginase (L-AsnA is widely distributed among microorganisms and has important applications in medicine and in food technology sectors. Therefore, the ability of the production, purification, and characterization of AsnA from Spirulina maxima (SM were tested. SM cultures grown in Zarrouk medium containing different N2 (in NaNO3 form concentrations (1.25, 2.50, and 5.0 g/L for 18 days contained a significant various quantity of dry biomass yields and AsnA enzyme levels. MS L-AsnA activity was found to be directly proportional to the N2 concentration. The cultures of SM at large scales (300 L medium, 5 g/L N2 showed a high AsnA enzyme activity (898 IU, total protein (405 mg/g, specific enzyme activity (2.21 IU/mg protein, and enzyme yield (51.28 IU/L compared with those in low N2 cultures. The partial purification of crude MS AsnA enzyme achieved by 80% ammonium sulfate AS precipitated and CM-Sephadex C-200 gel filtration led to increases in the purification of enzyme with 5.28 and 10.91 times as great as that in SM crude enzymes. Optimum pH and temperature of purified AsnA for the hydrolyzate were 8.5 and 37 ± 0.2°C, respectively. To the best of our knowledge, this is the first report on L-asparaginase production in S. maxima.

  11. Chemical and biological characterization of wastewater generated from hydrothermal liquefaction of Spirulina.

    Science.gov (United States)

    Pham, Mai; Schideman, Lance; Scott, John; Rajagopalan, Nandakishore; Plewa, Michael J

    2013-02-19

    Hydrothermal liquefaction (HTL) is an attractive method for converting wet biomass into petroleum-like biocrude oil that can be refined to make petroleum products. This approach is advantageous for conversion of low-lipid algae, which are promising feedstocks for sustainable large-scale biofuel production. As with natural petroleum formation, the water in contact with the produced oil contains toxic compounds. The objectives of this research were to: (1) identify nitrogenous organic compounds (NOCs) in wastewater from HTL conversion of Spirulina; (2) characterize mammalian cell cytotoxicity of specific NOCs, NOC mixture, and the complete HTL wastewater (HTL-WW) matrix; and (3) investigate mitigation measures to reduce toxicity in HTL-WW. Liquid-liquid extraction and nitrogen-phosphorus detection was used in conjunction with gas chromatography-mass spectrometry (GC-MS), which detected hundreds of NOCs in HTL-WW. Reference materials for nine of the most prevalent NOCs were used to identify and quantify their concentrations in HTL-WW. Mammalian cell cytotoxicity of the nine NOCs was quantified using a Chinese hamster ovary (CHO) cell assay, and the descending rank order for cytotoxicity was 3-dimethylamino-phenol > 2,2,6,6-tetramethyl-4-piperidone > 2,6-dimethyl-3-pyridinol > 2-picoline > pyridine > 1-methyl-2-pyrrolidinone > σ-valerolactam > 2-pyrrolidinone > ε-caprolactam. The organic mixture extracted from HTL-WW expressed potent CHO cell cytotoxic activity, with a LC(50) at 7.5% of HTL-WW. Although the toxicity of HTL-WW was substantial, 30% of the toxicity was removed biologically by recycling HTL-WW back into algal cultivation. The remaining toxicity of HTL-WW was mostly eliminated by subsequent treatment with granular activated carbon.

  12. Cyanobacteria and prawn farming in northern New South Wales, Australia--a case study on cyanobacteria diversity and hepatotoxin bioaccumulation

    International Nuclear Information System (INIS)

    Kankaanpaeae, Harri T.; Holliday, Jon; Schroeder, Helge; Goddard, Timothy J.; Fister, Richard von; Carmichael, Wayne W.

    2005-01-01

    Harmful cyanobacteria pose a hazard to aquatic ecosystems due to toxins (hepatotoxic microcystins, nodularins, and cylindrospermopsin) they produce. The microcystins and nodularins are potent toxins, which are also tumor promoters. The microcystins and nodularins may accumulate into aquatic organisms and be transferred to higher trophic levels, and eventually affect vector animals and consumers. Prawn farming is a rapidly growing industry in Australia. Because information regarding effects of cyanobacteria at prawn farms was lacking, we examined diversity of cyanobacteria and toxin production plus bioaccumulation into black tiger prawns (Penaeus monodon) under both field (northern New South Wales, Australia, December 2001-April 2002) and laboratory conditions. Samples were analyzed for hepatotoxins using enzyme-linked immunosorbent assay (ELISA) and high-performance liquid chromatography (HPLC). The maximum density of cyanobacteria (1 x 10 6 to 4 x 10 6 cells/l) was reached in April. Cyanobacteria encountered were Oscillatoria sp. (up to 4 x 10 6 cells/l), Pseudanabaena sp. (up to 1.8 x 10 6 cells/l), Microcystis sp. (up to 3.5 x 10 4 cells/l), and Aphanocapsa sp. (up to 2 x 10 4 cells/l). An uncommon cyanobacterium, Romeria sp. (up to 2.2 x 10 6 cells/l), was also observed. Contrasting earlier indications, toxic Nodularia spumigena was absent. Despite that both Oscillatoria sp. and Microcystis sp. are potentially hepatotoxic, hepatotoxin levels in phytoplankton samples remained low (up to 0.5-1.2 mg/kg dw; ELISA) in 2001-2002. ELISA was found suitable not only for phytoplankton but prawn tissues as well. Enzymatic pretreatment improved extractability of hepatotoxin from cyanobacteria (nodularin from N. spumigena as an example), but did not generally increase toxin recovery from prawn hepatopancreas. There were slightly increasing hepatotoxin concentrations in prawn hepatopancreas (from 6-20 to 20-80 μg/kg dw; ELISA) during the study. Hepatotoxin concentrations in

  13. Analysis of Life Cycle within Various Strains of Cyanobacteria with a Focus on Internal Regulators & Toxin Production

    Science.gov (United States)

    Cyanobacteria are photosynthetic bacteria that exhibit some similarities to algae and can be found naturally in lakes, streams, ponds, and other surface waters. However, toxin producing cyanobacteria have become an increasing concern as growth rates have been escalating. Neverthe...

  14. EnviroAtlas Cyanobacteria Assessment Network (CyAN) Dashboard: A Tool for Data Visualization and Exploratory Analysis

    Science.gov (United States)

    Economic, health, and environmental impacts of cyanobacteria and associated harmful algal blooms are increasingly recognized by policymakers, managers, and scientific researchers. However, spatially-distributed, long-term data on cyanobacteria blooms are largely unavailable. The ...

  15. Value added by Spirulina platensis in two different diets on growth performance, gut microbiota, and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Mohamed S. Yusuf

    2016-11-01

    Full Text Available Aim: The growth promoting effect of the blue-green filamentous alga Spirulina platensis (SP was observed on meat type Japanese quail with antibiotic growth promoter alternative and immune enhancing power. Materials and Methods: This study was conducted on 180 Japanese quail chicks for 4 weeks to find out the effect of diet type (vegetarian protein diet [VPD] and fish meal protein diet [FMPD]- Spirulina dose interaction (1 or 2 g/kg diet on growth perfor-mance, gut microbiota, and sensory meat quality of growing Japanese quails (1-5 weeks old. Results: Data revealed improvement (p<0.05 of weight gain, feed conversion ratio and European efficiency index due to 1, 2 g (SP/kg VPD, and 2 g (SP/kg FMPD, respectively. There was a significant decrease of ileum mean pH value by 1 g (SP/kg VPD. Concerning gut microbiota, there was a trend toward an increase in Lactobacilli count in both 1; 2 g (SP/kg VPD and 2 g (SP/kg FMPD. It was concluded that 1 or 2 g (SP/kg vegetarian diet may enhance parameters of performance without obvious effect on both meat quality and gut microbiota. Moreover, 1 and/or 2 g (SP may not be invited to share fish meal based diet for growing Japanese quails. Conclusion: Using of SP will support the profitable production of Japanese quails fed vegetable protein diet.

  16. Chemical absorption and CO2 biofixation via the cultivation of Spirulina in semicontinuous mode with nutrient recycle.

    Science.gov (United States)

    da Rosa, Gabriel Martins; Moraes, Luiza; Cardias, Bruna Barcelos; de Souza, Michele da Rosa Andrade Zimmermann; Costa, Jorge Alberto Vieira

    2015-09-01

    The chemical absorption of carbon dioxide (CO2) is a technique used for the mitigation of the greenhouse effect. However, this process consumes high amounts of energy to regenerate the absorbent and to separate the CO2. CO2 removal by microalgae can be obtained via the photosynthesis process. The objective of this study was to investigate the cultivation and the macromolecules production by Spirulina sp. LEB 18 with the addition of monoethanolamine (MEA) and CO2. In the cultivation with MEA, were obtained higher results of specific growth rate, biomass productivity, CO2 biofixation, CO2 use efficiency, and lower generation time. Besides this, the carbohydrate concentration obtained at the end of this assay was approximately 96.0% higher than the control assay. Therefore, Spirulina can be produced using medium recycle and the addition of MEA, thereby promoting the reduction of CO2 emissions and showing potential for areas that require higher concentrations of carbohydrates, such as in bioethanol production. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Spirulina maxima Extract Prevents Neurotoxicity via Promoting Activation of BDNF/CREB Signaling Pathways in Neuronal Cells and Mice.

    Science.gov (United States)

    Koh, Eun-Jeong; Seo, Young-Jin; Choi, Jia; Lee, Hyeon Yong; Kang, Do-Hyung; Kim, Kui-Jin; Lee, Boo-Yong

    2017-08-17

    Spirulina maxima is a microalgae which contains flavonoids and other polyphenols. Although Spirulina maxima 70% ethanol extract (SM70EE) has diverse beneficial effects, its effects on neurotoxicity have not been fully understood. In this study, we investigated the neuroprotective effects of SM70EE against trimethyltin (TMT)-induced neurotoxicity in HT-22 cells. SM70EE inhibited the cleavage of poly-ADP ribose polymerase (PARP). Besides, ROS production was decreased by down-regulating oxidative stress-associated enzymes. SM70EE increased the factors of brain-derived neurotrophic factor (BDNF)/cyclic AMPresponsive elementbinding protein (CREB) signalling pathways. Additionally, acetylcholinesterase (AChE) was suppressed by SM70EE. Furthermore, we investigated whether SM70EE prevents cognitive deficits against scopolamine-induced neurotoxicity in mice by applying behavioral tests. SM70EE increased step-through latency time and decreased the escape latency time. Therefore, our data suggest that SM70EE may prevent TMT neurotoxicity through promoting activation of BDNF/CREB neuroprotective signaling pathways in neuronal cells. In vivo study, SM70EE would prevent cognitive deficits against scopolamine-induced neurotoxicity in mice.

  18. The role of peptides derived from Spirulina maxima in downregulation of FcεRI-mediated allergic responses.

    Science.gov (United States)

    Vo, Thanh-Sang; Ngo, Dai-Hung; Kang, Kyong-Hwa; Park, Sun-Joo; Kim, Se-Kwon

    2014-11-01

    Spirulina has been found suitable for use as a bioactive additive. It is an excellent source of protein that can be hydrolyzed into bioactive peptides. Two peptides LDAVNR (P1) and MMLDF (P2) purified from enzymatic hydrolysate of Spirulina maxima have been reported to be effective against early atherosclerotic responses. In this study, the intracellular mechanism involved in the downregulation of these peptides on high-affinity IgE receptor-mediated allergic reaction was further investigated. RBL-2H3 mast cells were pretreated with P1 or P2 and sensitized with dinitrophenyl-specific IgE antibody before stimulation of antigen dinitrophenyl-BSA. It was revealed that P1 and P2 exhibited significant inhibition on mast-cell degranulation via decreasing histamine release and intracellular Ca(2+) elevation. The inhibitory activity of P1 was found due to blockade of calcium- and microtubule-dependent signaling pathways. Meanwhile, the inhibition of P2 was involved in suppression of phospholipase Cγ activation and reactive oxygen species production. Moreover, the suppressive effects of P1 and P2 on generation of IL-4 were evidenced via depression of nuclear factor-κB translocation. These findings indicate that peptides P1 and P2 from S. maxima may be promising candidates of antiallergic therapeutics, contributing to development of bioactive food ingredients for amelioration of allergic diseases. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Role of Spirulina in mitigating hemato-toxicity in Swiss albino mice exposed to aluminum and aluminum fluoride.

    Science.gov (United States)

    Sharma, Shweta; Sharma, K P; Sharma, Subhasini

    2016-12-01

    Aluminum is ingested through foods, water, air, and even drugs. Its intake is potentiated further through foods and tea prepared in aluminum utensils and Al salt added in the drinking water for removal of suspended impurities and also fluoride in the affected areas. The ameliorating role of a blue green alga Spirulina is well documented to various pollutants in the animal models. We, therefore, examined its protective role (230 mg/kg body weight) on the hematology of male Swiss albino mice treated with aluminum (sub-acute = 78.4 mg/kg body weight for 7 days, sub-chronic = 7.8 mg/kg body weight for 90 days) and aluminum fluoride (sub-acute = 103 mg/kg body weight, sub-chronic = 21 mg/kg body weight), along with their recovery after 90 days of sub-chronic exposure. This study revealed significant reduction in the values of RBC (5-18 %), Hb (15-17 %), PCV (8-14 %), and platelets (26-36 %), and increase in WBC (54-124 %) in the treated mice, particularly after sub-acute exposure. Aluminum fluoride was comparatively more toxic than aluminum. Further, Spirulina supplement not only alleviated toxicity of test chemicals in Swiss albino mice but also led to their better recovery after withdrawal.

  20. Total bakteri asam laktat dan Coliform pada ileum dan sekum ayam broiler yang diberi Spirulina platensis dengan lama pemberian berbeda

    Directory of Open Access Journals (Sweden)

    Muhammad Irfan Sulfani

    2018-02-01

    Full Text Available This research was conducted to determine the amount of lactic acid bacteria and coliform inside the caecum and ileum of broilers. 240 days old chicks broiler (DOC with 42.015 ± 0.219 g average body weight were used in this research as an experimental objects. The chicks broiler were treated with 0.04% antibiotics and 1% Spirulina plantensis as a prebiotic under different interval ingestion. This experiment was constructed under completely random design (CRD with 4 treatments and 5 repetition. The treatment that was applied were T0 (Poultry feed + 0.04% Zinc bacitracin, T1 (Poultry feed + 1% throughout 7 days, T2 (Poultry feed + 1% throughout 21 days, and T4 (Poultry feed + 1% throughout 35 days. The parameter measurements conducted in the 32nd day with random sampling from each experiments. Total amount of lactic acid and coliform from each samples were observed and the variance was with 5% accuration. The result showed the total amout of Coliform in ileum was significantly different (P<0.05 in the other hand the total amount of Coliform and acid bacteria in caecum were not influenced (P<0.05. It can be inferred that the Spirulina platensis treatment for 3 weeks reduced the total amount of bacteria inside caecum and ileum.