WorldWideScience

Sample records for current slc control

  1. Report on the SLC control system

    Energy Technology Data Exchange (ETDEWEB)

    Phinney, N.

    1985-05-01

    The SLC control system is based on a VAX 11/780 Host computer with approximately 50 microprocessor clusters which provide distributed intelligence and control of all CAMAC interface modules. This paper will present an overview of the system including current status and a description of the software architecture and communication protocols. 8 refs.

  2. The SLC control system - status and development

    Energy Technology Data Exchange (ETDEWEB)

    Phinney, N.; Shoaee, H.

    1987-03-01

    The SLC control system is installed and operational in the full SLC through the Linac, Damping Rings, Positron Source, Arcs and Final Focus. The system now includes a host VAX 11/785, a development VAX 11/780, 4 VAX workstations, a distributed network of 70 microprocessors, and about 270 Camac crates with more than 4000 modules. The micros are used for control and monitoring of the hardware, for pulse-to-pulse feedback, and for consoles (COWs). High level model-driven host software provides a variety of tools for beam setup, optimization, diagnosis, and stabilization. This paper will summarize the current status and projects under development.

  3. Timing system control software in the SLC

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, K.; Phinney, N.

    1985-04-01

    A new timing system that allows precision (approx.1 to 2 ns) control of the trigger times of klystrons, beam position monitors, and other devices on a pulse-to-pulse basis at up to 360 Hz is in operation in the first third of the SLAC linear accelerator. The control software is divided between a central host VAX and local Intel 8086-based microprocessor clusters. Facilities exist to set up and adjust the timing of devices or groups of devices independently for beam pulses having different destinations and purposes, which are run in an interlaced fashion during normal machine operation. Upgrading of the system is currently underway, using a new version of the Programmable Delay Unit CAMAC module to allow pipelining of timing information for three machine pulses. An overview of the current state of the system is presented in this paper, with an emphasis on software control.

  4. History Data Facility in the SLC control system

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, R.G.; White, G.R.

    1991-10-01

    Two major enhancements to the SLC History Data Facility are described separately. First the internal design and procedures used for saving and using long term history data. Second the user interface, facilities and application of the History Data Comparisons sub-system, which is used for analyzing and correlating two or more accelerator device histories.

  5. History Data Facility in the SLC control system

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, R.G.; White, G.R.

    1991-10-01

    Two major enhancements to the SLC History Data Facility are described separately. First the internal design and procedures used for saving and using long term history data. Second the user interface, facilities and application of the History Data Comparisons sub-system, which is used for analyzing and correlating two or more accelerator device histories.

  6. Network Upgrade for the SLC: Control System Modifications

    Energy Technology Data Exchange (ETDEWEB)

    Crane, M.; Mackenzie, R.; Sass, R.; Himel, T.; /SLAC

    2011-09-09

    Current communications between the SLAC Linear Collider control system central host and the SLCmicros is built upon the SLAC developed SLCNET communication hardware and protocols. We will describe how the Internet Suite of protocols (TCP/IP) are used to replace the SLCNET protocol interface. The major communication pathways and their individual requirements are described. A proxy server is used to reduce the number of total system TCP/IP connections. The SLCmicros were upgraded to use Ethernet and TCP/IP as well as SLCNET. Design choices and implementation experiences are addressed.

  7. Error message recording and reporting in the SLC control system

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, N.; Bogart, J.; Phinney, N.; Thompson, K.

    1985-04-01

    Error or information messages that are signaled by control software either in the VAX host computer or the local microprocessor clusters are handled by a dedicated VAX process (PARANOIA). Messages are recorded on disk for further analysis and displayed at the appropriate console. Another VAX process (ERRLOG) can be used to sort, list and histogram various categories of messages. The functions performed by these processes and the algorithms used are discussed.

  8. Error message recording and reporting in the SLC control system

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, N.; Bogart, J.; Phinney, N.; Thompson, K.

    1985-10-01

    Error or information messages that are signaled by control software either in the VAX host computer or the local microprocessor clusters are handled by a dedicated VAX process (PARANOIA). Messages are recorded on disk for further analysis and displayed at the appropriate console. Another VAX process (ERRLOG) can be used to sort, list and histogram various categories of messages. The functions performed by these processes and the algorithms used are discussed.

  9. Inrush Current Control Circuit

    Science.gov (United States)

    Cole, Steven W. (Inventor)

    2002-01-01

    An inrush current control circuit having an input terminal connected to a DC power supply and an output terminal connected to a load capacitor limits the inrush current that charges up the load capacitor during power up of a system. When the DC power supply applies a DC voltage to the input terminal, the inrush current control circuit produces a voltage ramp at the load capacitor instead of an abrupt DC voltage. The voltage ramp results in a constant low level current to charge up the load capacitor, greatly reducing the current drain on the DC power supply.

  10. Generation and functional characterization of epithelial cells with stable expression of SLC26A9 Cl- channels.

    Science.gov (United States)

    Salomon, Johanna J; Spahn, Stephan; Wang, Xiaohui; Füllekrug, Joachim; Bertrand, Carol A; Mall, Marcus A

    2016-04-01

    Recent studies identified the SLC26A9 Cl(-) channel as a modifier and potential therapeutic target in cystic fibrosis (CF). However, understanding of the regulation of SLC26A9 in epithelia remains limited and cellular models with stable expression for biochemical and functional studies are missing. We, therefore, generated Fisher rat thyroid (FRT) epithelial cells with stable expression of HA-tagged SLC26A9 via retroviral transfection and characterized SLC26A9 expression and function using Western blotting, immunolocalization, whole cell patch-clamp, and transepithelial bioelectric studies in Ussing chambers. We demonstrate stable expression of SLC26A9 in transfected FRT (SLC26A9-FRT) cells on the mRNA and protein level. Immunolocalization and Western blotting detected SLC26A9 in different intracellular compartments and to a lesser extent at the cell surface. Whole cell patch-clamp recordings demonstrated significantly increased constitutive Cl(-) currents in SLC26A9-FRT compared with control-transduced FRT (Control-FRT) cells (P < 0.01). Similar, transepithelial measurements showed that the basal short circuit current was significantly increased in SLC26A9-FRT vs. Control-FRT cell monolayers (P < 0.01). SLC26A9-mediated Cl(-) currents were increased by cAMP-dependent stimulation (IBMX and forskolin) and inhibited by GlyH-101, niflumic acid, DIDS, and 5-nitro-2-(3-phenylpropylamino) benzoic acid (NPPB), as well as RNAi knockdown of WNK1 implicated in epithelial osmoregulation. Our results support that these novel epithelial cells with stable expression of SLC26A9 will be a useful model for studies of pharmacological regulation including the identification of activators of SLC26A9 Cl(-) channels that may compensate deficient cystic fibrosis transmembrane regulator (CFTR)-mediated Cl(-) secretion and serve as an alternative therapeutic target in patients with CF and potentially other muco-obstructive lung diseases.

  11. Polarization at SLC

    Energy Technology Data Exchange (ETDEWEB)

    Swartz, M.L.

    1988-07-01

    The SLAC Linear Collider has been designed to readily accommodate polarized electron beams. Considerable effort has been made to implement a polarized source, a spin rotation system, and a system to monitor the beam polarization. Nearly all major components have been fabricated. At the current time, several source and polarimeter components have been installed. The installation and commissioning of the entire system will take place during available machine shutdown periods as the commissioning of SLC progresses. It is expected that a beam polarization of 45% will be achieved with no loss in luminosity. 13 refs., 15 figs.

  12. Controlled current inductors

    Science.gov (United States)

    Thaler, S.

    1970-01-01

    Magnetic permeability and shape of special core inserts are varied to produce desired changes in saturation characteristics of current dependent inductor, thus improving its inductance-to-current properties. Materials and saturation levels of the core pieces are selected to permit a wide variety of relationships between inductance and current.

  13. SLC6A4 STin2 VNTR genetic polymorphism is associated with tobacco use disorder, but not with successful smoking cessation or smoking characteristics: a case control study.

    Science.gov (United States)

    Pizzo de Castro, Márcia Regina; Maes, Michael; Guembarovski, Roberta Losi; Ariza, Carolina Batista; Reiche, Edna Maria Vissoci; Vargas, Heber Odebrecht; Vargas, Mateus Medonça; de Melo, Luiz Gustavo Piccoli; Dodd, Seetal; Berk, Michael; Watanabe, Maria Angelica Ehara; Nunes, Sandra Odebrecht Vargas

    2014-06-27

    The aim of this study was to determine if variable number of tandem repeats (VNTR) in the second intron (STin2) of the serotonin transporter (SLC6A4) gene was associated with tobacco use disorder, successful smoking cessation, or smoking characteristics. In this case-control study, patients with current tobacco use disorder, diagnosed according to DSM IV criteria (n = 185), and never-smokers, diagnosed according to CDC criteria (n = 175), were recruited and received 52 weeks of combined pharmacotherapy and cognitive therapy. Successful smoking cessation was defined as exhaled carbon monoxide smoking cessation, smoking characteristics and increased alcohol or sedative use risk. Our results suggest that the STin2.10/10 genotype and STin2.12 allele are associated with tobacco use disorder or nicotine dependence, but not with treatment response or severity of dependence. It is hypothesized that the ST2in.12 allele by modulating the metabolism of serotonin may participate in the pathophysiology of tobacco use disorder or nicotine dependence.

  14. CXCR1 and SLC11A1 polymorphisms affect susceptibility to cutaneous leishmaniasis in Brazil: a case-control and family-based study

    Directory of Open Access Journals (Sweden)

    Oliveira Joyce

    2010-01-01

    Full Text Available Abstract Background L. braziliensis causes cutaneous (CL and mucosal (ML leishmaniasis. Wound healing neutrophil (PMN and macrophage responses made following the bite of the vector sand fly contribute to disease progression in mice. To look at the interplay between PMN and macrophages in disease progression in humans we asked whether polymorphisms at genes that regulate their infiltration or function are associated with different clinical phenotypes. Specifically, CXCR1 (IL8RA and CXCR2 (IL8RB are receptors for chemokines that attract PMN to inflammatory sites. They lie 30-260 kb upstream of SLC11A1, a gene known primarily for its role in regulating macrophage activation, resistance to leishmaniasis, and wound healing responses in mice, but also known to be expressed in PMN, macrophages and dendritic cells. Methods Polymorphic variants at CXCR1, CXCR2 and SLC11A1 were analysed using Taqman or ABI fragment separation technologies in cases (60 CL; 60 ML, unrelated controls (n = 120, and multicase families (104 nuclear families; 88 ML, 250 CL cases from Brazil. Logistic regression analysis, family-based association testing (FBAT and haplotype analysis (TRANSMIT were performed. Results Case-control analysis showed association between the common C allele (OR 2.38; 95% CI 1.23-4.57; P = 0.009 of CXCR1_rs2854386 and CL, supported by family-based (FBAT; Z score 2.002; P = 0.045 analysis (104 nuclear families; 88 ML, 250 CL cases. ML associated with the rarer G allele (Z score 1.999; P = 0.046. CL associated with a 3' insertion/deletion polymorphism at SLC11A1 (Z score 2.549; P = 0.011. Conclusions The study supports roles for CXCR1 and SLC11A1 in the outcome of L. braziliensis infection in humans. Slc11a1 does not influence cutaneous lesion development following needle injection of Leishmania in mice, suggesting that its role here might relate to the action of PMN, macrophage and/or dendritic cells in the wound healing response to the sand fly bite

  15. Magnetoelectric control of spin currents

    Science.gov (United States)

    Gómez, J. E.; Vargas, J. M.; Avilés-Félix, L.; Butera, A.

    2016-06-01

    The ability to control the spin current injection has been explored on a hybrid magnetoelectric system consisting of a (011)-cut ferroelectric lead magnesium niobate-lead titanate (PMNT) single crystal, a ferromagnetic FePt alloy, and a metallic Pt. With this PMNT/FePt/Pt structure we have been able to control the magnetic field position or the microwave excitation frequency at which the spin pumping phenomenon between FePt and Pt occurs. We demonstrate that the magnetoelectric heterostructure operating in the L-T (longitudinal magnetized-transverse polarized) mode couples the PMNT crystal to the magnetostrictive FePt/Pt bilayer, displaying a strong magnetoelectric coefficient of ˜140 Oe cm kV-1. Our results show that this mechanism can be effectively exploited as a tunable spin current intensity emitter and open the possibility to create an oscillating or a bistable switch to effectively manipulate spin currents.

  16. Impaired nutrient signaling and body weight control in a Na+ neutral amino acid cotransporter (Slc6a19)-deficient mouse.

    Science.gov (United States)

    Bröer, Angelika; Juelich, Torsten; Vanslambrouck, Jessica M; Tietze, Nadine; Solomon, Peter S; Holst, Jeff; Bailey, Charles G; Rasko, John E J; Bröer, Stefan

    2011-07-29

    Amino acid uptake in the intestine and kidney is mediated by a variety of amino acid transporters. To understand the role of epithelial neutral amino acid uptake in whole body homeostasis, we analyzed mice lacking the apical broad-spectrum neutral (0) amino acid transporter B(0)AT1 (Slc6a19). A general neutral aminoaciduria was observed similar to human Hartnup disorder which is caused by mutations in SLC6A19. Na(+)-dependent uptake of neutral amino acids into the intestine and renal brush-border membrane vesicles was abolished. No compensatory increase of peptide transport or other neutral amino acid transporters was detected. Mice lacking B(0)AT1 showed a reduced body weight. When adapted to a standard 20% protein diet, B(0)AT1-deficient mice lost body weight rapidly on diets containing 6 or 40% protein. Secretion of insulin in response to food ingestion after fasting was blunted. In the intestine, amino acid signaling to the mammalian target of rapamycin (mTOR) pathway was reduced, whereas the GCN2/ATF4 stress response pathway was activated, indicating amino acid deprivation in epithelial cells. The results demonstrate that epithelial amino acid uptake is essential for optimal growth and body weight regulation.

  17. Impaired Nutrient Signaling and Body Weight Control in a Na+ Neutral Amino Acid Cotransporter (Slc6a19)-deficient Mouse*

    Science.gov (United States)

    Bröer, Angelika; Juelich, Torsten; Vanslambrouck, Jessica M.; Tietze, Nadine; Solomon, Peter S.; Holst, Jeff; Bailey, Charles G.; Rasko, John E. J.; Bröer, Stefan

    2011-01-01

    Amino acid uptake in the intestine and kidney is mediated by a variety of amino acid transporters. To understand the role of epithelial neutral amino acid uptake in whole body homeostasis, we analyzed mice lacking the apical broad-spectrum neutral (0) amino acid transporter B0AT1 (Slc6a19). A general neutral aminoaciduria was observed similar to human Hartnup disorder which is caused by mutations in SLC6A19. Na+-dependent uptake of neutral amino acids into the intestine and renal brush-border membrane vesicles was abolished. No compensatory increase of peptide transport or other neutral amino acid transporters was detected. Mice lacking B0AT1 showed a reduced body weight. When adapted to a standard 20% protein diet, B0AT1-deficient mice lost body weight rapidly on diets containing 6 or 40% protein. Secretion of insulin in response to food ingestion after fasting was blunted. In the intestine, amino acid signaling to the mammalian target of rapamycin (mTOR) pathway was reduced, whereas the GCN2/ATF4 stress response pathway was activated, indicating amino acid deprivation in epithelial cells. The results demonstrate that epithelial amino acid uptake is essential for optimal growth and body weight regulation. PMID:21636576

  18. SLC7 family transporters control the establishment of left-right asymmetry during organogenesis in medaka by activating mTOR signaling.

    Science.gov (United States)

    Asaoka, Yoichi; Nagai, Yoko; Namae, Misako; Furutani-Seiki, Makoto; Nishina, Hiroshi

    2016-05-20

    The precise government of the left-right (LR) specification of an organ is an essential aspect of its morphogenesis. Multiple signaling cascades have been implicated in the establishment of vertebrate LR asymmetry. Recently, mTOR signaling was found to critically regulate the development of LR asymmetry in zebrafish. However, the upstream factor(s) that activate mTOR signaling in the context of LR specification are as yet unknown. In this study, we identify the SLC7 amino acid transporters Slc7a7 and Slc7a8 as novel regulators of LR asymmetry development in the small fish medaka. Knockdown of Slc7a7 and/or Slc7a8 in medaka embryos disrupted LR organ asymmetries. Depletion of Slc7a7 hindered left-sided expression of the southpaw (spaw) gene, which is responsible for LR axis determination. Work at the cellular level revealed that Slc7a7 coordinates ciliogenesis in the epithelium of Kupffer's vesicle and thereby the generation of the nodal fluid flow required for LR asymmetry. Interestingly, knockdown of Slc7a7 depressed mTOR signaling activity in medaka embryos. Treatment with rapamycin, an inhibitor of mTOR signaling, together with Slc7a7 knockdown synergistically perturbed spaw expression, indicating an interaction between Slc7a7 and mTOR signaling affecting gene expression required for LR specification. Taken together, our results demonstrate that Slc7a7 governs the regulation of LR asymmetry development via the activation of mTOR signaling.

  19. Stability analysis of direct current control in current source rectifier

    DEFF Research Database (Denmark)

    Lu, Dapeng; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    Current source rectifier with high switching frequency has a great potential for improving the power efficiency and power density in ac-dc power conversion. This paper analyzes the stability of direct current control based on the time delay effect. Small signal model including dynamic behaviors...... of dc link is developed to identify the control plants of grid ac current control and dc current control. Analysis on the poles and zeros under dq frame is carried out. Base on this model, it turns out that the phase lag caused by the time delay can stabilized the grid ac current control while reduces...... the stable region for dc current control. Simulation and experimental results are presented to validate the theoretical analysis....

  20. The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9.

    Science.gov (United States)

    Bertrand, Carol A; Mitra, Shalini; Mishra, Sanjay K; Wang, Xiaohui; Zhao, Yu; Pilewski, Joseph M; Madden, Dean R; Frizzell, Raymond A

    2017-03-30

    Several members of the SLC26A family of anion transporters associate with CFTR, forming complexes in which CFTR and SLC26A functions are reciprocally regulated. This association is thought to be facilitated by PDZ scaffolding interactions. CFTR has been shown to be positively regulated by NHERF-1, and negatively regulated by CAL in airway epithelia. However, it's unclear which PDZ-domain protein(s) interact with SLC26A9, a SLC26A family member found in airway epithelia. We have previously shown that primary, human bronchial epithelia (HBE) from non-CF donors exhibit constitutive anion secretion attributable to SLC26A9. However, constitutive anion secretion is absent in HBE from CF donors. We examined whether changes in SLC26A9 constitutive activity could be attributed to a loss of CFTR trafficking, and what role PDZ interactions played. HEK293 co-expressing SLC26A9 with the trafficking mutant F508del CFTR exhibited a significant reduction in constitutive current compared to cells co-expressing SLC26A9 and wt CFTR. We found that SLC26A9 exhibits complex glycosylation when co-expressed with F508del CFTR, but its expression at the plasma membrane is decreased. SLC26A9 interacted with both NHERF-1 and CAL, and its interaction with both significantly increased with co-expression of wt CFTR. However, co-expression with F508del CFTR only increased SLC26A9's interaction with CAL. Mutation of SLC26A9's PDZ motif decreased this association with CAL, and restored its constitutive activity. Correcting aberrant F508del CFTR trafficking in CF HBE with corrector VX-809 also restored SLC26A9 activity. We conclude that when SLC26A9 is co-expressed with F508del CFTR, its trafficking defect leads to a PDZ motif-sensitive intracellular retention of SLC26A9.

  1. Glycemic control with insulin prevents progression of dental caries and caries-related periodontitis in diabetic WBN/KobSlc rats.

    Science.gov (United States)

    Nakahara, Yutaka; Sano, Tomoya; Kodama, Yasushi; Ozaki, Kiyokazu; Matsuura, Tetsuro

    2013-07-01

    We have previously reported that dental caries progress in spontaneously and chemically induced diabetic rodent models. The aim of this study was to clarify the relationship between hyperglycemia and dental caries by evaluating the preventive effect of glycemic control with insulin on the progression of the lesions in diabetic rats. Male WBN/KobSlc rats aged 15 weeks were divided into groups of spontaneously diabetic rats (intact group), spontaneously diabetic rats with insulin treatment (INS group), alloxan-induced prolonged diabetic rats (AL group), and alloxan-induced prolonged diabetic rats with insulin treatment (AL + INS group). The animals were killed at 90 weeks of age, and their oral tissue was examined. Dental caries and periodontitis were frequently detected in the intact group, and the lesions were enhanced in the AL group (in which there was an increased duration of diabetes). Meanwhile, glycemic control with insulin reduced the incidence and severity of dental caries and periodontitis in the INS group, and the effects became more pronounced in the AL + INS group. In conclusion, glycemic control by insulin prevented the progression of dental caries and caries-related periodontitis in the diabetic rats.

  2. Dicty_cDB: SLC413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC413 (Link to dictyBase) - - - Contig-U15735-1 SLC413P (Link to Original site) SLC...413F 686 SLC413Z 466 SLC413P 1152 - - Show SLC413 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC413Q.Seq.d/ Representative seq. ID SLC...413P (Link to Original site) Representative DNA sequence >SLC413 (SLC413Q) /CSM/SL/SLC4-A/SLC...ATGDKEKNILVYDLGGGTFDVSVLSIEDGVFEVRSTNGDTHL--- ---sryrsygqrscrcr**r*scqrtcrsqeylgklhlsn*nhhw**r*drw*nrir**r nh*nryl*cpflvgc*llc

  3. Dicty_cDB: SLC469 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC469 (Link to dictyBase) - - - Contig-U16584-1 SLC469P (Link to Original site) SLC...469F 676 SLC469Z 397 SLC469P 1073 - - Show SLC469 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC469Q.Seq.d/ Representative seq. ID SLC...469P (Link to Original site) Representative DNA sequence >SLC469 (SLC469Q) /CSM/SL/SLC4-C/SLC...WPLYLSTKNTILKR--- ---ldsws*isc*ir*q**iikilscs*sflyrcc*iwfhd*rfsnlc*rfs*kcktyrl lk

  4. Dicty_cDB: SLC345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC345 (Link to dictyBase) - - - Contig-U14962-1 SLC345P (Link to Original site) SLC...345F 696 SLC345Z 618 SLC345P 1314 - - Show SLC345 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-B/SLC345Q.Seq.d/ Representative seq. ID SLC...345P (Link to Original site) Representative DNA sequence >SLC345 (SLC345Q) /CSM/SL/SLC3-B/SLC...EQSIVIAQKACEPMRQLSAATKKQILLNIANDLEKRADEFAKAIVVEVGKPLV DANAEVGRAIDTFTCAAEESIRQYGEQIPLDISSRNLGFQGITKRFPVGPISMIAPFNFP LNLC

  5. Dicty_cDB: SLC258 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC258 (Link to dictyBase) - - - Contig-U10207-1 SLC258P (Link to Original site) SLC...258F 729 SLC258Z 443 SLC258P 1172 - - Show SLC258 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-C/SLC258Q.Seq.d/ Representative seq. ID SLC...258P (Link to Original site) Representative DNA sequence >SLC258 (SLC258Q) /CSM/SL/SLC2-C/SLC...n*vyhssisinhslliivqslmikfkeninyivvlvmlnsi sslivvlnlvfslkvvlnqslchylqfvngniiinqkkillkqiy*lf*dqeig*tkikx ikinl

  6. Dicty_cDB: SLC767 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC767 (Link to dictyBase) - - - Contig-U15118-1 SLC767P (Link to Original site) SLC...767F 315 SLC767Z 271 SLC767P 586 - - Show SLC767 Library SL (Link to library) Clone ID SLC... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-C/SLC767Q.Seq.d/ Representative seq. ID SLC...767P (Link to Original site) Representative DNA sequence >SLC767 (SLC767Q) /CSM/SL/SLC7-C/SLC7...nsncc**tiqryrrlfc* sfkrtrchlimer*fsqcy*ifpnsss*lclqr*iqeilrqthc--- ---SLYSSTWDCWVKIAPREGPTAFFKGALSNANRXSGDAL

  7. Dicty_cDB: SLC236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC236 (Link to dictyBase) - - - Contig-U16540-1 SLC236P (Link to Original site) SLC...236F 531 SLC236Z 704 SLC236P 1235 - - Show SLC236 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC236Q.Seq.d/ Representative seq. ID SLC...236P (Link to Original site) Representative DNA sequence >SLC236 (SLC236Q) /CSM/SL/SLC2-B/SLC...twtt*cthtwywvnpftnsstcft*llitsfisnliii*kw*iwst*tpnlincigf *ifhtt*wsisttisiifytkeflcttt*nkr*ilttriwcftlvl*qti

  8. Dicty_cDB: SLC878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC878 (Link to dictyBase) - - - Contig-U14938-1 SLC878P (Link to Original site) SLC...878F 654 SLC878Z 676 SLC878P 1330 - - Show SLC878 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-D/SLC878Q.Seq.d/ Representative seq. ID SLC...878P (Link to Original site) Representative DNA sequence >SLC878 (SLC878Q) /CSM/SL/SLC8-D/SLC...ARLVKERDAARSALANARNIVQ QQQQQTNNNNNNNNNKDVEMSSASTPSSSEDNLLDST--- ---SPSKKTYTQYKSTYQFAHKASVTDISLHVLGDYIISSSLDKSLNMYDIVNGTHLTSF GQSQQLC

  9. Network Upgrade for the SLC: PEP II Network

    Energy Technology Data Exchange (ETDEWEB)

    Crane, M.; Call, M.; Clark, S.; Coffman, F.; Himel, T.; Lahey, T.; Miller, E.; Sass, R.; /SLAC

    2011-09-09

    The PEP-II control system required a new network to support the system functions. This network, called CTLnet, is an FDDI/Ethernet based network using only TCP/IP protocols. An upgrade of the SLC Control System micro communications to use TCP/IP and SLCNET would allow all PEP-II control system nodes to use TCP/IP. CTLnet is private and separate from the SLAC public network. Access to nodes and control system functions is provided by multi-homed application servers with connections to both the private CTLnet and the SLAC public network. Monitoring and diagnostics are provided using a dedicated system. Future plans and current status information is included.

  10. Hardware upgrade for klystrons in the SLC

    Energy Technology Data Exchange (ETDEWEB)

    Jobe, R.K.; Browne, M.J.; Slattery, K.P.

    1985-05-01

    The control and monitoring of the klystrons in the first third of the SLAC linear accelerator has been commissioned, and a program to complete installation by summer 1985 is in progress. A general overview of the new control system for SLAC klystrons is presented along with a detailed description of the Modulator Klystron Support Unit. The MKSU contains all the devices necessary to interface klystron monitoring and control to the SLC control system through a dedicated intelligent CAMAC module. Controlled devices include RF phase and drive controls, the high power modulator status, associated RF signals, waterflow and magnet controls.

  11. Lack of association between four SNPs in the SLC22A3-LPAL2-LPA gene cluster and coronary artery disease in a Chinese Han population: a case control study

    Directory of Open Access Journals (Sweden)

    Lv Xiaofei

    2012-10-01

    Full Text Available Abstract Background Lipoprotein (a (Lp [a] is known being correlated with coronary artery disease (CAD. The SLC22A3-LPAL2-LPA gene cluster, relating with modulating the level of plasma Lp (a, has recently been reported to be associated with CAD in Caucasians. The purpose of this study was to verify whether this finding can be expanded to the Chinese Han population. Methods and Results Using a Chinese Han sample, which consisted of 1012 well-characterized CAD patients and 889 healthy controls, we tested the associations of four SNPs (rs2048327, rs3127599, rs7767084 and rs10755578 in the SLC22A3-LPAL2-LPA gene cluster, and their inferred haplotypes with the risk of CAD. Allelic, genotypic and haplotype association analyses all showed that the gene cluster was not associated with CAD in this Chinese Han sample. Conclusions We for the first time explored the association of the four SNPs in the SLC22A3-LPAL2-LPA gene cluster with CAD in a large Chinese Han sample. Nevertheless, this study did not reveal any significant evidence of this gene cluster to increase the risk of CAD in this population.

  12. Dicty_cDB: SLC239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC239 (Link to dictyBase) - - - - SLC239Z (Link to Original site) - - SLC...239Z 598 - - - - Show SLC239 Library SL (Link to library) Clone ID SLC239 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC...239Q.Seq.d/ Representative seq. ID SLC239Z (Link to Original site) R...epresentative DNA sequence >SLC239 (SLC239Q) /CSM/SL/SLC2-B/SLC239Q.Seq.d/ XXXXXXXXXXACAACGTCTCATTTTCGCTGGTA

  13. Dicty_cDB: SLC745 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC745 (Link to dictyBase) - - - Contig-U15436-1 SLC745Z (Link... to Original site) - - SLC745Z 596 - - - - Show SLC745 Library SL (Link to library) Clone ID SLC745 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-B/SLC745Q.Seq.d/ Representative seq. ID SLC74...5Z (Link to Original site) Representative DNA sequence >SLC745 (SLC745Q) /CSM/SL/SLC7-B/SLC745Q.Seq.d/ XXXXX...IVSGSWDNKVKIWDIKSFKCNHTLTDHT GYVNTVTISPDGSLCASGGKDTFACLWELSSGKPLYKLEARNTINALAFSPNKYWLSAAT DDKIIIWDLLTKQVLAEI

  14. Dicty_cDB: SLC149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC149 (Link to dictyBase) - - - Contig-U16260-1 SLC149Z (Link... to Original site) - - SLC149Z 624 - - - - Show SLC149 Library SL (Link to library) Clone ID SLC149 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-C/SLC149Q.Seq.d/ Representative seq. ID SLC14...9Z (Link to Original site) Representative DNA sequence >SLC149 (SLC149Q) /CSM/SL/SLC1-C/SLC149Q.Seq.d/ XXXXX...---n*rffrwcfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhpncssctlc c*inclpnslrtnllsrnycprkrywwyllctqss*rycyw*rtsyrfpiilc

  15. Dicty_cDB: SLC762 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC762 (Link to dictyBase) - - - Contig-U16382-1 SLC762Z (Link... to Original site) - - SLC762Z 513 - - - - Show SLC762 Library SL (Link to library) Clone ID SLC762 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-C/SLC762Q.Seq.d/ Representative seq. ID SLC76...2Z (Link to Original site) Representative DNA sequence >SLC762 (SLC762Q) /CSM/SL/SLC7-C/SLC762Q.Seq.d/ XXXXX...---tspstlklkckllphhqpsknhtnyqtvkssplvtnvsvvqkpssnhhs*vwnqlvs tkppttps*nvmlisvkiytvtssypvvqlcsqvlliv*tkn*ll*p

  16. Dicty_cDB: SLC351 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC351 (Link to dictyBase) - - - Contig-U16382-1 SLC351Z (Link... to Original site) - - SLC351Z 490 - - - - Show SLC351 Library SL (Link to library) Clone ID SLC351 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-C/SLC351Q.Seq.d/ Representative seq. ID SLC35...1Z (Link to Original site) Representative DNA sequence >SLC351 (SLC351Q) /CSM/SL/SLC3-C/SLC351Q.Seq.d/ XXXXX...tfplprsplptiilrygicwyprnhlqlhhem* c*yp*rfir*rrlirwynyvpryc*syeqrincfspinhen*nhcstrt*ilc

  17. Dicty_cDB: SLC473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC473 (Link to dictyBase) - - - Contig-U16054-1 SLC473F (Link to Original site) SLC...473F 698 - - - - - - Show SLC473 Library SL (Link to library) Clone ID SLC473 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC473Q.Seq.d/ Representative seq. ID SLC47...3F (Link to Original site) Representative DNA sequence >SLC473 (SLC473Q) /CSM/SL/SLC4-D/SLC473Q.Seq.d/ AGAAA...mimvskvlsi*hfspmirmppsnh*qtlskrlnklkvlglvnllvvlqinqlssiihn si*kylplikmksspfn*fkiqplpmkvlvslfylvililnh*llkisk

  18. Dicty_cDB: SLC318 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC318 (Link to dictyBase) - - - Contig-U16382-1 SLC318Z (Link... to Original site) - - SLC318Z 530 - - - - Show SLC318 Library SL (Link to library) Clone ID SLC318 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-A/SLC318Q.Seq.d/ Representative seq. ID SLC31...8Z (Link to Original site) Representative DNA sequence >SLC318 (SLC318Q) /CSM/SL/SLC3-A/SLC318Q.Seq.d/ XXXXX...*vwnq lvstkppttps*nvmlisvkiytvmssylvvqlcsqvlliv*tkn*ll*phqp*klksll hqnvntlsglvdls*lhsqlsnkcgspkknmtnqvhqlste

  19. Dicty_cDB: SLC823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC823 (Link to dictyBase) - - - Contig-U09872-1 SLC823Z (Link... to Original site) - - SLC823Z 168 - - - - Show SLC823 Library SL (Link to library) Clone ID SLC823 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-A/SLC823Q.Seq.d/ Representative seq. ID SLC82...3Z (Link to Original site) Representative DNA sequence >SLC823 (SLC823Q) /CSM/SL/SLC8-A/SLC823Q.Seq.d/ XXXXX...slated Amino Acid sequence (All Frames) Frame A: ---iyifiylfiylinklkfefiiy*tihllfilcvdkyiyiyiytqkkkkkkkkkkk

  20. Dicty_cDB: SLC119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fk*r silclk*csiiisfkfsciiscklrklrklishfinktlikk Frame C: ---FNSRNGPHCLANNVFPQLC...SL (Link to library) SLC119 (Link to dictyBase) - - - Contig-U16368-1 SLC119Z (Link... to Original site) - - SLC119Z 659 - - - - Show SLC119 Library SL (Link to library) Clone ID SLC119 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-A/SLC119Q.Seq.d/ Representative seq. ID SLC11...9Z (Link to Original site) Representative DNA sequence >SLC119 (SLC119Q) /CSM/SL/SLC1-A/SLC119Q.Seq.d/ XXXXX

  1. Dicty_cDB: SLC751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC751 (Link to dictyBase) - - - Contig-U16382-1 SLC751F (Link to Original site) SLC...751F 613 - - - - - - Show SLC751 Library SL (Link to library) Clone ID SLC751 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-C/SLC751Q.Seq.d/ Representative seq. ID SLC75...1F (Link to Original site) Representative DNA sequence >SLC751 (SLC751Q) /CSM/SL/SLC7-C/SLC751Q.Seq.d/ GAAGA...prrtpssln*spikskgqqrkndpny v*nlqhpshvrrhssrliliclwsyhrycygfr*wclphctnl*rlcfttchltfrfsws *syrlhdenfn*twllihhh

  2. Dicty_cDB: SLC293 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC293 (Link to dictyBase) - - - Contig-U08154-1 SLC293F (Link to Original site) SLC...293F 664 - - - - - - Show SLC293 Library SL (Link to library) Clone ID SLC293 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-D/SLC293Q.Seq.d/ Representative seq. ID SLC29...3F (Link to Original site) Representative DNA sequence >SLC293 (SLC293Q) /CSM/SL/SLC2-D/SLC293Q.Seq.d/ GTAGT... 1.11 Translated Amino Acid sequence SLVDCYTPKCKKGYYLKKPEGQCCQICQRECSAIQCGIPKCAPGYISQVPVGECCPTCVK KPVNPCALVLC

  3. Dicty_cDB: SLC849 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC849 (Link to dictyBase) - - - Contig-U16272-1 SLC849Z (Link... to Original site) - - SLC849Z 501 - - - - Show SLC849 Library SL (Link to library) Clone ID SLC849 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-C/SLC849Q.Seq.d/ Representative seq. ID SLC84...9Z (Link to Original site) Representative DNA sequence >SLC849 (SLC849Q) /CSM/SL/SLC8-C/SLC849Q.Seq.d/ XXXXX...c*yhrpkswstrlpsscrkkqedlqnrssstrrr*tnlnr*d*irfn* kdyqsngwfrslryg*t*ilna*rlccwskke

  4. Dicty_cDB: SLC389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC389 (Link to dictyBase) - - - Contig-U13983-1 SLC389F (Link to Original site) SLC...389F 641 - - - - - - Show SLC389 Library SL (Link to library) Clone ID SLC389 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-D/SLC389Q.Seq.d/ Representative seq. ID SLC38...9F (Link to Original site) Representative DNA sequence >SLC389 (SLC389Q) /CSM/SL/SLC3-D/SLC389Q.Seq.d/ ANAAA...KVVLRVEGGASHFLTV--- Frame B: xkknnkkkkrhln*kfnkkkdilvevraavvvvavvvvrll*kyvigrqtplcvyiv*kk *rnlkkkrkkk*arlhlr

  5. Dicty_cDB: SLC122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC122 (Link to dictyBase) - - - Contig-U16325-1 SLC122Z (Link... to Original site) - - SLC122Z 330 - - - - Show SLC122 Library SL (Link to library) Clone ID SLC122 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-A/SLC122Q.Seq.d/ Representative seq. ID SLC12...2Z (Link to Original site) Representative DNA sequence >SLC122 (SLC122Q) /CSM/SL/SLC1-A/SLC122Q.Seq.d/ XXXXX...: ---rlskinl*tswlprkp*mrfktw*tplcir*ttnr*mg**slrfrlqsskc*scn*c l*spkgsktt**ysikqf

  6. Dicty_cDB: SLC650 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC650 (Link to dictyBase) - - - Contig-U16382-1 SLC650Z (Link... to Original site) - - SLC650Z 447 - - - - Show SLC650 Library SL (Link to library) Clone ID SLC650 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-C/SLC650Q.Seq.d/ Representative seq. ID SLC65...0Z (Link to Original site) Representative DNA sequence >SLC650 (SLC650Q) /CSM/SL/SLC6-C/SLC650Q.Seq.d/ XXXXX... (All Frames) Frame A: ---itrrsshhhr**tfplprsplptiilrygiswyprnhlqlhhem*c*yp*rfir*cr liwwynyvpryc*syeqrincfspinhen*nhcstrt*ilc

  7. Dicty_cDB: SLC720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC720 (Link to dictyBase) - - - Contig-U16368-1 SLC720Z (Link... to Original site) - - SLC720Z 633 - - - - Show SLC720 Library SL (Link to library) Clone ID SLC720 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-A/SLC720Q.Seq.d/ Representative seq. ID SLC72...0Z (Link to Original site) Representative DNA sequence >SLC720 (SLC720Q) /CSM/SL/SLC7-A/SLC720Q.Seq.d/ XXXXX...AGCTCAGAAA GCTCAGAAAGCTCATCAGCCACTTCATAAATAAAACTTTGATC sequence update 1998. 5.13 Translated Amino Acid sequence ---STLSANNVFPQLC

  8. Dicty_cDB: SLC820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC820 (Link to dictyBase) - - - Contig-U16272-1 SLC820Z (Link... to Original site) - - SLC820Z 480 - - - - Show SLC820 Library SL (Link to library) Clone ID SLC820 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-A/SLC820Q.Seq.d/ Representative seq. ID SLC82...0Z (Link to Original site) Representative DNA sequence >SLC820 (SLC820Q) /CSM/SL/SLC8-A/SLC820Q.Seq.d/ XXXXX...i Frame C: ---lywcmasipc*yhrpkswstrlpsscrkkqedlqnrssstrrr*tnlnr*d*irfn* kdyqsngwfrslryg*t*ilna*rlc

  9. Dicty_cDB: SLC128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC128 (Link to dictyBase) - - - Contig-U11682-1 SLC128Z (Link... to Original site) - - SLC128Z 368 - - - - Show SLC128 Library SL (Link to library) Clone ID SLC128 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-B/SLC128Q.Seq.d/ Representative seq. ID SLC12...8Z (Link to Original site) Representative DNA sequence >SLC128 (SLC128Q) /CSM/SL/SLC1-B/SLC128Q.Seq.d/ XXXXX...2 Translated Amino Acid sequence ---SLKDGYGIAGWDVKSIHSYRYLKILQTGPNQRDGNELCLCCFEVY

  10. Dicty_cDB: SLC270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC270 (Link to dictyBase) - - - Contig-U15434-1 SLC270Z (Link... to Original site) - - SLC270Z 524 - - - - Show SLC270 Library SL (Link to library) Clone ID SLC270 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-C/SLC270Q.Seq.d/ Representative seq. ID SLC27...0Z (Link to Original site) Representative DNA sequence >SLC270 (SLC270Q) /CSM/SL/SLC2-C/SLC270Q.Seq.d/ XXXXX...fnkyiklf* Frame B: ---fsspppvvvissevntlps*kkmpsfvtlvtlivksmslg*tptpkkipsnhkltvt plptvstsss*lkvvssi*vvvlvihlllc

  11. Dicty_cDB: SLC725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC725 (Link to dictyBase) - - - Contig-U16445-1 SLC725Z (Link... to Original site) - - SLC725Z 538 - - - - Show SLC725 Library SL (Link to library) Clone ID SLC725 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-B/SLC725Q.Seq.d/ Representative seq. ID SLC72...5Z (Link to Original site) Representative DNA sequence >SLC725 (SLC725Q) /CSM/SL/SLC7-B/SLC725Q.Seq.d/ XXXXX...kwmvlknyyhklnfknknnkfflkkkknkkkkkkkkkkk k Frame C: ---ilhlg*plchpipry*lwyrqr*itrryhqrskmg*r*lysnrstkrcryyccpwfi isclc

  12. Dicty_cDB: SLC437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC437 (Link to dictyBase) - - - Contig-U16397-1 SLC437Z (Link... to Original site) - - SLC437Z 622 - - - - Show SLC437 Library SL (Link to library) Clone ID SLC437 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC437Q.Seq.d/ Representative seq. ID SLC43...7Z (Link to Original site) Representative DNA sequence >SLC437 (SLC437Q) /CSM/SL/SLC4-B/SLC437Q.Seq.d/ XXXXX... C: ---h*k*lsiyc*nwfnmfiq*i*ywcnh*rlc*hycrfrdfirewcstwssiccn*cfp **fptlyiwyll*akm

  13. Dicty_cDB: SLC693 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC693 (Link to dictyBase) - - - Contig-U16382-1 SLC693Z (Link... to Original site) - - SLC693Z 694 - - - - Show SLC693 Library SL (Link to library) Clone ID SLC693 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-D/SLC693Q.Seq.d/ Representative seq. ID SLC69...3Z (Link to Original site) Representative DNA sequence >SLC693 (SLC693Q) /CSM/SL/SLC6-D/SLC693Q.Seq.d/ XXXXX...vsvvqkpssnhhs*vwnqlvstkp pttps*nvmlisvkiytvtssypvvqlcsqvlliv*tkn*ll*phqp*klkslphq

  14. Dicty_cDB: SLC207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC207 (Link to dictyBase) - - - - SLC207E (Link to Original site) - - - - - - SLC...207E 637 Show SLC207 Library SL (Link to library) Clone ID SLC207 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC...207Q.Seq.d/ Representative seq. ID SLC207E (Link to Original site) R...epresentative DNA sequence >SLC207 (SLC207Q) /CSM/SL/SLC2-A/SLC207Q.Seq.d/ GGTGTACCACAAGTTGAAGTTCCATTTGATGTT

  15. Dicty_cDB: SLC527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC527 (Link to dictyBase) - - - Contig-U15436-1 SLC527Z (Link... to Original site) - - SLC527Z 573 - - - - Show SLC527 Library SL (Link to library) Clone ID SLC527 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-B/SLC527Q.Seq.d/ Representative seq. ID SLC52...7Z (Link to Original site) Representative DNA sequence >SLC527 (SLC527Q) /CSM/SL/SLC5-B/SLC527Q.Seq.d/ XXXXX...ce update 1998. 5. 8 Translated Amino Acid sequence ---LEGPEAHQDWVSCIRFSPNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGYVNTVT ISPDGSLC

  16. Dicty_cDB: SLC480 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC480 (Link to dictyBase) - - - Contig-U13538-1 SLC480Z (Link... to Original site) - - SLC480Z 455 - - - - Show SLC480 Library SL (Link to library) Clone ID SLC480 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC480Q.Seq.d/ Representative seq. ID SLC48...0Z (Link to Original site) Representative DNA sequence >SLC480 (SLC480Q) /CSM/SL/SLC4-D/SLC480Q.Seq.d/ XXXXX...lqnchpcp*slhpww*wccnl qksfrw*p*krcqtkslcrcqwwkhpllfktitklksh*nrrcqrwsyhhcyrp*rsrq

  17. Dicty_cDB: SLC219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC219 (Link to dictyBase) - - - Contig-U16455-1 SLC219Z (Link... to Original site) - - SLC219Z 708 - - - - Show SLC219 Library SL (Link to library) Clone ID SLC219 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC219Q.Seq.d/ Representative seq. ID SLC21...9Z (Link to Original site) Representative DNA sequence >SLC219 (SLC219Q) /CSM/SL/SLC2-A/SLC219Q.Seq.d/ XXXXX...hqkrnk*iiflnk*hfiiilkkk Frame B: ---itrclqdrwyrycssrscrnwyh*trygrhlcpswsln*sqisrnasrttprspsr* qcrfqr*krfsqrn

  18. Dicty_cDB: SLC304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC304 (Link to dictyBase) - - - Contig-U15154-1 SLC304Z (Link... to Original site) - - SLC304Z 550 - - - - Show SLC304 Library SL (Link to library) Clone ID SLC304 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-A/SLC304Q.Seq.d/ Representative seq. ID SLC30...4Z (Link to Original site) Representative DNA sequence >SLC304 (SLC304Q) /CSM/SL/SLC3-A/SLC304Q.Seq.d/ XXXXX...* Translated Amino Acid sequence (All Frames) Frame A: ---rftrlccslg*trr*k**tiplr

  19. Dicty_cDB: SLC560 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC560 (Link to dictyBase) - - - - SLC560Z (Link to Original site) - - SLC...560Z 556 - - - - Show SLC560 Library SL (Link to library) Clone ID SLC560 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-C/SLC...560Q.Seq.d/ Representative seq. ID SLC560Z (Link to Original site) R...epresentative DNA sequence >SLC560 (SLC560Q) /CSM/SL/SLC5-C/SLC560Q.Seq.d/ XXXXXXXXXXTCTCAATCAGAAAGAAAGAGTAC

  20. Dicty_cDB: SLC201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC201 (Link to dictyBase) - - - Contig-U16325-1 SLC201E (Link... to Original site) - - - - - - SLC201E 510 Show SLC201 Library SL (Link to library) Clone ID SLC201 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC201Q.Seq.d/ Representative seq. ID SLC20...1E (Link to Original site) Representative DNA sequence >SLC201 (SLC201Q) /CSM/SL/SLC2-A/SLC201Q.Seq.d/ AACCA...hqqvdgvmisqi*vtikqvlklqlmlm kpkgvkdhiiifhqtiyikktmiiwvmvfmmvlklvsltevst*tismvf Frame B: tns*tktttpwlssr*lr*r*emylc

  1. Dicty_cDB: SLC295 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC295 (Link to dictyBase) - - - Contig-U16255-1 SLC295Z (Link... to Original site) - - SLC295Z 572 - - - - Show SLC295 Library SL (Link to library) Clone ID SLC295 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-D/SLC295Q.Seq.d/ Representative seq. ID SLC29...5Z (Link to Original site) Representative DNA sequence >SLC295 (SLC295Q) /CSM/SL/SLC2-D/SLC295Q.Seq.d/ XXXXX...e update 1998. 4.25 Translated Amino Acid sequence ---TCKDMHCESNGLLCVLTPQKKTDEECCPIIPICINPSTIAASTIATTTASTRHS

  2. Dicty_cDB: SLC484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC484 (Link to dictyBase) - - - Contig-U15497-1 SLC484Z (Link... to Original site) - - SLC484Z 462 - - - - Show SLC484 Library SL (Link to library) Clone ID SLC484 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC484Q.Seq.d/ Representative seq. ID SLC48...4Z (Link to Original site) Representative DNA sequence >SLC484 (SLC484Q) /CSM/SL/SLC4-D/SLC484Q.Seq.d/ XXXXX...rnlpinsqh*ctkcqqkgihrygcsrwllitlgcww*sqrrscpprr*yw*rnypn vkrr*raisfshlcfr*rrcrlc*

  3. Dicty_cDB: SLC590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC590 (Link to dictyBase) - - - Contig-U16358-1 SLC590Z (Link... to Original site) - - SLC590Z 593 - - - - Show SLC590 Library SL (Link to library) Clone ID SLC590 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-D/SLC590Q.Seq.d/ Representative seq. ID SLC59...0Z (Link to Original site) Representative DNA sequence >SLC590 (SLC590Q) /CSM/SL/SLC5-D/SLC590Q.Seq.d/ XXXXX...iltmllpgimkshkvshlpssqtikrissngldlpdltvv*lt*m *lqtvlklvvplevkkrpevvenlaqtagnsiavvvliqstmvilchyhkvsiltkitkk k

  4. Dicty_cDB: SLC836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC836 (Link to dictyBase) - - - Contig-U15434-1 SLC836Z (Link... to Original site) - - SLC836Z 567 - - - - Show SLC836 Library SL (Link to library) Clone ID SLC836 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-B/SLC836Q.Seq.d/ Representative seq. ID SLC83...6Z (Link to Original site) Representative DNA sequence >SLC836 (SLC836Q) /CSM/SL/SLC8-B/SLC836Q.Seq.d/ XXXXX...lpnrhhgnrrsiikhfrhhhrls*yrqr*tlcrherrchrl*hwsl*l*nrcrlvkr qrqkryrqtts*plhpcqrcphhpls*rssrqfrlwywssifcyvklfl*

  5. Dicty_cDB: SLC155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC155 (Link to dictyBase) - - - Contig-U16382-1 SLC155Z (Link... to Original site) - - SLC155Z 532 - - - - Show SLC155 Library SL (Link to library) Clone ID SLC155 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-C/SLC155Q.Seq.d/ Representative seq. ID SLC15...5Z (Link to Original site) Representative DNA sequence >SLC155 (SLC155Q) /CSM/SL/SLC1-C/SLC155Q.Seq.d/ XXXXX...tiilrygic wyprnhlqlhhem*c*yp*rfir*rrlirwynyvpryc*syeqrincfspinhen*nhcs trt*ilcldwwiylsftlnfptnvdlqrrirrirsin

  6. Dicty_cDB: SLC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC194 (Link to dictyBase) - - - - SLC194Z (Link to Original site) - - SLC...194Z 699 - - - - Show SLC194 Library SL (Link to library) Clone ID SLC194 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-D/SLC...194Q.Seq.d/ Representative seq. ID SLC194Z (Link to Original site) R...epresentative DNA sequence >SLC194 (SLC194Q) /CSM/SL/SLC1-D/SLC194Q.Seq.d/ XXXXXXXXXXTTATGAAGGTGAACGTGCTATGA

  7. Dicty_cDB: SLC729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC729 (Link to dictyBase) - - - Contig-U14971-1 SLC729Z (Link... to Original site) - - SLC729Z 574 - - - - Show SLC729 Library SL (Link to library) Clone ID SLC729 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-B/SLC729Q.Seq.d/ Representative seq. ID SLC72...9Z (Link to Original site) Representative DNA sequence >SLC729 (SLC729Q) /CSM/SL/SLC7-B/SLC729Q.Seq.d/ XXXXX...n*ilvili*f*lvmvfgmlqvtkmqwtlf*mklkhkr* vinyyymh*rkevpitlvlsllfckkrklkpqp*hhtyhnksyqq*ttknnttiq*qkqh nsigiienvlkyk Frame C: ---islc

  8. Dicty_cDB: SLC549 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC549 (Link to dictyBase) - - - Contig-U16382-1 SLC549F (Link to Original site) SLC...549F 709 - - - - - - Show SLC549 Library SL (Link to library) Clone ID SLC549 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-C/SLC549Q.Seq.d/ Representative seq. ID SLC54...9F (Link to Original site) Representative DNA sequence >SLC549 (SLC549Q) /CSM/SL/SLC5-C/SLC549Q.Seq.d/ GATGG...ntvslptgmiwkksgiilstmnsvlhqkntqfs*pklh*iqkptekk*p klclkpstpqpctlpfkpsypymplvvppvl

  9. Dicty_cDB: SLC221 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC221 (Link to dictyBase) - - - Contig-U16381-1 SLC221Z (Link... to Original site) - - SLC221Z 707 - - - - Show SLC221 Library SL (Link to library) Clone ID SLC221 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC221Q.Seq.d/ Representative seq. ID SLC22...1Z (Link to Original site) Representative DNA sequence >SLC221 (SLC221Q) /CSM/SL/SLC2-A/SLC221Q.Seq.d/ XXXXX...mmmtiimvmmtmimigtmimigvmi gimigtmkmviigmmmtskmqmmngtikplif*kkiiiiliqiif*kkkkkkkkkkkk Frame C: ---l*m*nqt*wlqmlc

  10. Dicty_cDB: SLC167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC167 (Link to dictyBase) - - - Contig-U16382-1 SLC167Z (Link... to Original site) - - SLC167Z 668 - - - - Show SLC167 Library SL (Link to library) Clone ID SLC167 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-C/SLC167Q.Seq.d/ Representative seq. ID SLC16...7Z (Link to Original site) Representative DNA sequence >SLC167 (SLC167Q) /CSM/SL/SLC1-C/SLC167Q.Seq.d/ XXXXX...lklkckllphhqpsknhtnyqtvkssp svmnvsvaqkpssnhhs*vwnqlvstkppitps*nvmlisvkiytvmssylvvqlcsqvl liv*tkn*ll*phqp*klk

  11. Dicty_cDB: SLC386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC386 (Link to dictyBase) - - - Contig-U16269-1 SLC386F (Link to Original site) SLC...386F 601 - - - - - - Show SLC386 Library SL (Link to library) Clone ID SLC386 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-D/SLC386Q.Seq.d/ Representative seq. ID SLC38...6F (Link to Original site) Representative DNA sequence >SLC386 (SLC386Q) /CSM/SL/SLC3-D/SLC386Q.Seq.d/ ATCAC...lny*rkstp tlmspksstpnivvlvrvkq--- Frame B: shikndyssicpsl*cpkqscr*s*apkcldhpnpsrfs*lc

  12. Dicty_cDB: SLC442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC442 (Link to dictyBase) - - - Contig-U16430-1 SLC442Z (Link... to Original site) - - SLC442Z 467 - - - - Show SLC442 Library SL (Link to library) Clone ID SLC442 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC442Q.Seq.d/ Representative seq. ID SLC44...2Z (Link to Original site) Representative DNA sequence >SLC442 (SLC442Q) /CSM/SL/SLC4-B/SLC442Q.Seq.d/ XXXXX...viihvikenfriksrspnr*rfsqksrrkk*nfqrlcllii*ncs lnfrflir*tiiicftyssyd*irfkhsr*fisnn

  13. Dicty_cDB: SLC356 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC356 (Link to dictyBase) - - - Contig-U16358-1 SLC356Z (Link... to Original site) - - SLC356Z 571 - - - - Show SLC356 Library SL (Link to library) Clone ID SLC356 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-C/SLC356Q.Seq.d/ Representative seq. ID SLC35...6Z (Link to Original site) Representative DNA sequence >SLC356 (SLC356Q) /CSM/SL/SLC3-C/SLC356Q.Seq.d/ XXXXX...vv*lt*m*lqtvlkl vvplevkkrpevvenlaqtagnsiavvvliqstmvilchyhkvsiltkitkkkkpnvtyi t*ikeyc*ylfii Frame B: ---allkn

  14. Dicty_cDB: SLC680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC680 (Link to dictyBase) - - - Contig-U16603-1 SLC680Z (Link... to Original site) - - SLC680Z 379 - - - - Show SLC680 Library SL (Link to library) Clone ID SLC680 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-D/SLC680Q.Seq.d/ Representative seq. ID SLC68...0Z (Link to Original site) Representative DNA sequence >SLC680 (SLC680Q) /CSM/SL/SLC6-D/SLC680Q.Seq.d/ XXXXX...mmngtilqsyqvmqmlkilytllvqvivli**fqlqyhlqlllkhnklflns sklifkkkk Frame B: ---ik*csickstiwlfipiptisnstmcr*fwyskyvskr*ldnh*iwwy*srtilc

  15. Dicty_cDB: SLC844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC844 (Link to dictyBase) - - - Contig-U15133-1 SLC844Z (Link... to Original site) - - SLC844Z 560 - - - - Show SLC844 Library SL (Link to library) Clone ID SLC844 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-B/SLC844Q.Seq.d/ Representative seq. ID SLC84...4Z (Link to Original site) Representative DNA sequence >SLC844 (SLC844Q) /CSM/SL/SLC8-B/SLC844Q.Seq.d/ XXXXX...8. 5.16 Translated Amino Acid sequence ---IIIRASKTQAVVGPNARRIQELCSLVQKRFNFKEGTVVLFAEKILNRGLCAVAQAES LKLKLLAG

  16. Dicty_cDB: SLC642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC642 (Link to dictyBase) - - - Contig-U15436-1 SLC642E (Link... to Original site) - - - - - - SLC642E 562 Show SLC642 Library SL (Link to library) Clone ID SLC642 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-B/SLC642Q.Seq.d/ Representative seq. ID SLC64...2E (Link to Original site) Representative DNA sequence >SLC642 (SLC642Q) /CSM/SL/SLC6-B/SLC642Q.Seq.d/ GTCCA...Translated Amino Acid sequence PEAHQDWVSCIRFSPNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGYVNTVTISPDGS LCASGGKDTFACLWEL

  17. Dicty_cDB: SLC866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC866 (Link to dictyBase) - - - Contig-U13181-1 SLC866E (Link... to Original site) - - - - - - SLC866E 599 Show SLC866 Library SL (Link to library) Clone ID SLC866 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-C/SLC866Q.Seq.d/ Representative seq. ID SLC86...6E (Link to Original site) Representative DNA sequence >SLC866 (SLC866Q) /CSM/SL/SLC8-C/SLC866Q.Seq.d/ AATAA...kfy*s*k*rsfk*fkyfkiiinttrfi**nytrgggskky hhhhyhhi*eehf*ihnlqqriqlyyhyhimlc*iiyihyqektkfqf*vllivikqsll qqyyin

  18. Dicty_cDB: SLC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC218 (Link to dictyBase) - - - Contig-U16287-1 SLC218E (Link to Original site) SLC2...18F 569 SLC218Z 279 SLC218P 848 SLC218E 701 Show SLC218 Library SL (Link to library) Clone ID SLC2...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC218Q.Seq.d/ Representative seq. ID SLC2...18E (Link to Original site) Representative DNA sequence >SLC218 (SLC218Q) /CSM/SL/SLC2-A/SLC2...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC218 (SLC2

  19. THE CURRENT STATE OF RISK-CONTROLLING

    Directory of Open Access Journals (Sweden)

    Orlov A. I.

    2014-04-01

    Full Text Available The concept of risk-controlling is based on the general theory of risk. The current state of risk-management in our country is reviewed. We also discuss the research on risk-controlling made in the BMSTU Laboratory of economic-mathematical methods in controlling

  20. Analysis the relationship between SLC26A4 mutation and current diagnosis of inner ear malformation in children with sensorineural hearing loss%SLC26A4基因检测在儿童先天性内耳畸形早期诊断中的作用

    Institute of Scientific and Technical Information of China (English)

    孙宝春; 周成勇; 代志瑶

    2014-01-01

    目的:研究儿童感音神经性聋中SLC26A4基因致病性突变与先天性内耳畸形之间的关系,初步探讨SLC26A4基因检测在先天性耳聋早期病因诊断中作用.方法:按DNA测序的方法检测2 094例感音神经性聋患儿SLC26A4基因致病性突变情况,以Sennaroglu分类为标准统计以上患儿内耳CT表型情况,分析SLC26A4基因型与CT表型之间的关系.结果:①2 094例患儿中,CT检查发现内耳畸形685例(耳蜗畸形371例中,Michel畸形6例,耳蜗未发育8例,共同腔畸形12例,IP-Ⅰ畸形27例,耳蜗发育不全30例,Mondini畸形288例;大前庭水管265例;单纯前庭/半规管/内耳道畸形49例),内耳CT正常1 409例;②共检出SLC26A4基因致病性突变465例,其中双等位基因纯合突变135例,复合杂合突变330例;③SLC26A4基因致病性突变100%(465/465)在前庭水管扩大相关内耳畸形中检出.结论:SLC26 A4基因致病性突变与前庭水管扩大相关内耳畸形密切相关,SLC26A4基因检测在儿童感音神经性聋早期病因诊断和干预方面具有一定的作用.

  1. The zinc transporter, Slc39a7 (Zip7 is implicated in glycaemic control in skeletal muscle cells.

    Directory of Open Access Journals (Sweden)

    Stephen A Myers

    Full Text Available Dysfunctional zinc signaling is implicated in disease processes including cardiovascular disease, Alzheimer's disease and diabetes. Of the twenty-four mammalian zinc transporters, ZIP7 has been identified as an important mediator of the 'zinc wave' and in cellular signaling. Utilizing siRNA targeting Zip7 mRNA we have identified that Zip7 regulates glucose metabolism in skeletal muscle cells. An siRNA targeting Zip7 mRNA down regulated Zip7 mRNA 4.6-fold (p = 0.0006 when compared to a scramble control. This was concomitant with a reduction in the expression of genes involved in glucose metabolism including Agl, Dlst, Galm, Gbe1, Idh3g, Pck2, Pgam2, Pgm2, Phkb, Pygm, Tpi1, Gusb and Glut4. Glut4 protein expression was also reduced and insulin-stimulated glycogen synthesis was decreased. This was associated with a reduction in the mRNA expression of Insr, Irs1 and Irs2, and the phosphorylation of Akt. These studies provide a novel role for Zip7 in glucose metabolism in skeletal muscle and highlight the importance of this transporter in contributing to glycaemic control in this tissue.

  2. Study of the serotonin transporter (SLC6A4 and BDNF genes in French patients with non syndromic mental deficiency

    Directory of Open Access Journals (Sweden)

    Mignon Laurence

    2010-02-01

    Full Text Available Abstract Background Mental deficiency has been linked to abnormalities in cortical neuronal network connectivity and plasticity. These mechanisms are in part under the control of two interacting signalling pathways, the serotonergic and the brain-derived neurotrophic (BDNF pathways. The aim of the current paper is to determine whether particular alleles or genotypes of two crucial genes of these systems, the serotonin transporter gene (SLC6A4 and the brain-derived neurotrophic factor gene (BDNF, are associated with mental deficiency (MD. Methods We analyzed four functional polymorphisms (rs25531, 5-HTTLPR, VNTR, rs3813034 of the SLC6A4 gene and one functional polymorphism (Val66 Met of the BDNF gene in 98 patients with non-syndromic mental deficiency (NS-MD and in an ethnically matched control population of 251 individuals. Results We found no significant differences in allele and genotype frequencies in the five polymorphisms studied in the SLC6A4 and BDNF genes of NS-MD patients versus control patients. While the comparison of the patterns of linkage disequilibrium (D' in the control and NS-MD populations revealed a degree of variability it did not, however, reach significance. No significant differences in frequencies of haplotypes and genotypes for VNTR/rs3813034 and rs25531/5-HTTLPR were observed. Conclusion Altogether, results from the present study do not support a role for any of the five functional polymorphisms of SLC6A4 and BDNF genes in the aetiology of NS-RM. Moreover, they suggest no epistatic interaction in NS-MD between polymorphisms in BDNF and SLC6A4. However, we suggest that further studies on these two pathways in NS-MD remain necessary.

  3. Mice lacking neutral amino acid transporter B0AT1 (Slc6a19) have elevated levels of FGF21 and GLP-1 and improved glycaemic control

    OpenAIRE

    Yang Jiang; Adam J. Rose; Sijmonsma, Tjeerd P.; Angelika Bröer; Anja Pfenninger; Stephan Herzig; Dieter Schmoll; Stefan Bröer

    2015-01-01

    Objective: Type 2 diabetes arises from insulin resistance of peripheral tissues followed by dysfunction of β-cells in the pancreas due to metabolic stress. Both depletion and supplementation of neutral amino acids have been discussed as strategies to improve insulin sensitivity. Here we characterise mice lacking the intestinal and renal neutral amino acid transporter B0AT1 (Slc6a19) as a model to study the consequences of selective depletion of neutral amino acids. Methods: Metabolic tests...

  4. Dicty_cDB: SLC241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC241 (Link to dictyBase) - - - Contig-U16252-1 SLC241Z (Link... to Original site) - - SLC241Z 612 - - - - Show SLC241 Library SL (Link to library) Clone ID SLC241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC241Q.Seq.d/ Representative seq. ID SLC24...1Z (Link to Original site) Representative DNA sequence >SLC241 (SLC241Q) /CSM/SL/SLC2-B/SLC241Q.Seq.d/ XXXXX...CSM/SS/SSI4-B/SSI448Q.Seq.d/ 1140 0.0 SLE731 (SLE731Q) /CSM/SL/SLE7-B/SLE731Q.Seq.d/ 1140 0.0 SLC241 (SLC241Q) /CSM/SL/SLC2-B/SLC2

  5. Dicty_cDB: SLC233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC233 (Link to dictyBase) slc233 - - Contig-U12870-1 SLC233P ...(Link to Original site) SLC233F 733 SLC233Z 707 SLC233P 1440 - - Show SLC233 Library SL (Link to library) Clone ID SLC2...33 (Link to dictyBase) Atlas ID slc233 NBRP ID - dictyBase ID - Link to Contig Contig-U12870-1 Or...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC233Q.Seq.d/ R...epresentative seq. ID SLC233P (Link to Original site) Representative DNA sequence >SLC233 (SLC233Q) /CSM/SL/SLC2-B/SLC2

  6. Dicty_cDB: SLC240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC240 (Link to dictyBase) - - - Contig-U16365-1 SLC240Z (Link... to Original site) - - SLC240Z 540 - - - - Show SLC240 Library SL (Link to library) Clone ID SLC240 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC240Q.Seq.d/ Representative seq. ID SLC24...0Z (Link to Original site) Representative DNA sequence >SLC240 (SLC240Q) /CSM/SL/SLC2-B/SLC240Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLC240 (SLC240Q) /CSM/SL/SLC2-B/SLC240Q.Seq.d/ 710 0.0 SLF140 (SLF140Q) /CSM/SL

  7. Dicty_cDB: SLC242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum cDNA clone:ddc24n06, 5' ... 706 0.0 1 ( AU060920 ) Dictyostelium discoideum slug cDNA, clone SLC2...SL (Link to library) SLC242 (Link to dictyBase) - - - Contig-U12013-1 SLC242E (Link to Original site) SLC2...42F 595 SLC242Z 606 SLC242P 1201 SLC242E 751 Show SLC242 Library SL (Link to library) Clone ID SLC2...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC242Q.Seq.d/ Representative seq. ID SLC2...42E (Link to Original site) Representative DNA sequence >SLC242 (SLC242Q) /CSM/SL/SLC2-B/SLC2

  8. Dicty_cDB: SLC285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC285 (Link to dictyBase) - - - Contig-U12865-1 SLC285F (Link to Original site) SLC2...85F 642 - - - - - - Show SLC285 Library SL (Link to library) Clone ID SLC285 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-D/SLC285Q.Seq.d/ Representative seq. ID SLC28...5F (Link to Original site) Representative DNA sequence >SLC285 (SLC285Q) /CSM/SL/SLC2-D/SLC285Q.Seq.d/ CAATT...nces producing significant alignments: (bits) Value SLC285 (SLC285Q) /CSM/SL/SLC2-D/SLC285Q.Seq.d/ 1041 0.0

  9. Dicty_cDB: SLC247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC247 (Link to dictyBase) - - - Contig-U12168-1 SLC247Z (Link... to Original site) - - SLC247Z 562 - - - - Show SLC247 Library SL (Link to library) Clone ID SLC247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC247Q.Seq.d/ Representative seq. ID SLC24...7Z (Link to Original site) Representative DNA sequence >SLC247 (SLC247Q) /CSM/SL/SLC2-B/SLC247Q.Seq.d/ XXXXX...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC247 (SLC247Q) /CSM/SL/SLC2-B/SLC2

  10. Dicty_cDB: SLC104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC104 (Link to dictyBase) slc104 - - Contig-U15892-1 SLC104P ...(Link to Original site) SLC104F 642 SLC104Z 535 SLC104P 1177 - - Show SLC104 Library SL (Link to library) Clone ID SLC...104 (Link to dictyBase) Atlas ID slc104 NBRP ID - dictyBase ID - Link to Contig Contig-U15892-1 Or...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-A/SLC104Q.Seq.d/ R...epresentative seq. ID SLC104P (Link to Original site) Representative DNA sequence >SLC104 (SLC104Q) /CSM/SL/SLC1-A/SLC

  11. Dicty_cDB: SLC636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC636 (Link to dictyBase) - - - Contig-U15792-1 SLC636F (Link to Original site) SLC...636F 649 - - - - - - Show SLC636 Library SL (Link to library) Clone ID SLC636 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-B/SLC636Q.Seq.d/ Representative seq. ID SLC63...6F (Link to Original site) Representative DNA sequence >SLC636 (SLC636Q) /CSM/SL/SLC6-B/SLC636Q.Seq.d/ CATTT...NA Score E Sequences producing significant alignments: (bits) Value SLC636 (SLC636Q) /CSM/SL/SLC6-B/SLC636Q.

  12. Current Control Strategy of Chain Circuit STATCOM

    Institute of Scientific and Technical Information of China (English)

    WANG Xuan; FU Jian; TENG Letian; SUN Lijing; ZHAO Ruibin; WU Shouyuan; DENG Zhanfeng

    2012-01-01

    In order to study the current control strategy based on the chain circuit static synchronous compensator (STATCOM) dynamic model and the design control system with good stability and tracking accuracy, this paper applies the chain circuit STATCOM small signal AC model, and proposes the following assumptions:

  13. Disturbance observer based current controller for vector controlled IM drives

    DEFF Research Database (Denmark)

    Teodorescu, Remus; Dal, Mehmet

    2008-01-01

    In order to increase the accuracy of the current control loop, usually, well known parameter compensation and/or cross decoupling techniques are employed for advanced ac drives. In this paper, instead of using these techniques an observer-based current controller is proposed for vector controlled...... coupling effects and increase robustness against parameters change without requiring any other compensation strategies. The experimental implementation results are provided to demonstrate validity and performance of the proposed control scheme.......In order to increase the accuracy of the current control loop, usually, well known parameter compensation and/or cross decoupling techniques are employed for advanced ac drives. In this paper, instead of using these techniques an observer-based current controller is proposed for vector controlled...

  14. Dicty_cDB: SLC228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC228 (Link to dictyBase) - - - Contig-U12865-1 SLC228F (Link to Original site) SLC2...28F 593 - - - - - - Show SLC228 Library SL (Link to library) Clone ID SLC228 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC228Q.Seq.d/ Representative seq. ID SLC22...8F (Link to Original site) Representative DNA sequence >SLC228 (SLC228Q) /CSM/SL/SLC2-B/SLC228Q.Seq.d/ AAAAA...oducing significant alignments: (bits) Value SSK138 (SSK138Q) /CSM/SS/SSK1-B/SSK138Q.Seq.d/ 1027 0.0 SLC228 (SLC228Q) /CSM/SL/SLC2

  15. Dicty_cDB: SLC235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC235 (Link to dictyBase) - - - Contig-U10207-1 SLC235E (Link to Original site) SLC...235F 708 SLC235Z 582 SLC235P 1290 SLC235E 1198 Show SLC235 Library SL (Link to library) Clone ID SLC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC235Q.Seq.d/ Representative seq. ID SLC...235E (Link to Original site) Representative DNA sequence >SLC235 (SLC235Q) /CSM/SL/SLC2-B/SLC...FGGGVDLTPVYPKLDQVVEFSFNIEKSMRPIWPRGEQNLIRIG*grm*qlflpst *r*npwrwwfixrss*ir*skdlevhlpirfiihrsl*tipc***fnll**sskristis sfslc

  16. Dicty_cDB: SLC313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC313 (Link to dictyBase) - - - Contig-U11543-1 SLC313E (Link to Original site) SLC...313F 759 SLC313Z 599 SLC313P 1358 SLC313E 961 Show SLC313 Library SL (Link to library) Clone ID SLC...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-A/SLC313Q.Seq.d/ Representative seq. ID SLC...313E (Link to Original site) Representative DNA sequence >SLC313 (SLC313Q) /CSM/SL/SLC3-A/SLC...QFD DNQQSFFMAETLKYLYLIFQPSSVIPLNKYVFNTEAHPVKIQYQ*y**y*ky***q**qk *nkikikylepvftflcel Translated Amino Acid s

  17. Dicty_cDB: SLC789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *viwimiv*qfnyif*nvlhwmvkfnflinnkyl tplclff*krciyinn* Frame B: FLLEDGKQICRDFIKTLDNLILERFLLEDNGLCSELTDLYIEQVCS...SL (Link to library) SLC789 (Link to dictyBase) - - - Contig-U15018-1 SLC789E (Link to Original site) SLC...789F 605 SLC789Z 610 SLC789P 1215 SLC789E 1132 Show SLC789 Library SL (Link to library) Clone ID SLC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-D/SLC789Q.Seq.d/ Representative seq. ID SLC...789E (Link to Original site) Representative DNA sequence >SLC789 (SLC789Q) /CSM/SL/SLC7-D/SLC

  18. Dicty_cDB: SLC706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC706 (Link to dictyBase) - - - Contig-U11177-1 SLC706E (Link to Original site) SLC...706F 699 SLC706Z 574 SLC706P 1273 SLC706E 1010 Show SLC706 Library SL (Link to library) Clone ID SLC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-A/SLC706Q.Seq.d/ Representative seq. ID SLC...706E (Link to Original site) Representative DNA sequence >SLC706 (SLC706Q) /CSM/SL/SLC7-A/SLC...rames) Frame A: id*trccqmlssnylcctlly*ggigws*nsir*nrsfesihfrnsih*kwcrsckfnr* ti*t*nhskdiklfpiyketylcdfktrgyl

  19. Dicty_cDB: SLC785 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC785 (Link to dictyBase) - - - Contig-U13001-1 SLC785E (Link to Original site) SLC...785F 524 SLC785Z 429 SLC785P 953 SLC785E 913 Show SLC785 Library SL (Link to library) Clone ID SLC...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-D/SLC785Q.Seq.d/ Representative seq. ID SLC...785E (Link to Original site) Representative DNA sequence >SLC785 (SLC785Q) /CSM/SL/SLC7-D/SLC...ickslgfnkwylykyfgwpfic rqly*tnw*lygfdrfh**ns*tlgs*tslniyi*lly*thwsn*myflsxkewycskw* **wfnhci*lgslesfkylc

  20. Circle Points Discharge Tube Current Controller

    Institute of Scientific and Technical Information of China (English)

    Meng Jinjia; Meng Lisheng

    2005-01-01

    Circle points discharge tube current controller is a new type device to limit theoutput of high voltage discharge current. Circle points uniform corona discharge to form airionization current in the discharge tube. On the outside, even if the discharge electrode is sparkdischarging or the two discharge electrodes are short circuited, the air ionization current in the tuberemains within a stable range, and there is no spark discharge. In this case, when the dischargecurrent only increases slightly, the requirement to limited current is obtained. By installing thecontroller at a discharge pole with a small power but high voltage supply, we can realize the shiftbetween the continuous spark line discharge and corona discharge. This provides a new simpledevice for spark discharge research and is a supplement to the Townsend discharge experiment.

  1. Lessons learned from the SLC

    Energy Technology Data Exchange (ETDEWEB)

    Phinney, N. [Stanford Univ., CA (United States). Stanford Linear Accelerator Center

    1998-07-01

    The SLAC Linear Collider (SLC) is the first example of an entirely new type of lepton collider. Many years of effort were required to develop the understanding and techniques needed to approach design luminosity. This paper discusses some of the key issues and problems encountered in producing a working linear collider. These include the polarized source, techniques for emittance preservation, extensive feedback systems, and refinements in beam optimization in the final focus. The SLC experience has been invaluable for testing concepts and developing designs for a future linear collider.

  2. Brain interstitial fluid glutamine homeostasis is controlled by blood-brain barrier SLC7A5/LAT1 amino acid transporter.

    Science.gov (United States)

    Dolgodilina, Elena; Imobersteg, Stefan; Laczko, Endre; Welt, Tobias; Verrey, Francois; Makrides, Victoria

    2016-11-01

    L-glutamine (Gln) is the most abundant amino acid in plasma and cerebrospinal fluid and a precursor for the main central nervous system excitatory (L-glutamate) and inhibitory (γ-aminobutyric acid (GABA)) neurotransmitters. Concentrations of Gln and 13 other brain interstitial fluid amino acids were measured in awake, freely moving mice by hippocampal microdialysis using an extrapolation to zero flow rate method. Interstitial fluid levels for all amino acids including Gln were ∼5-10 times lower than in cerebrospinal fluid. Although the large increase in plasma Gln by intraperitoneal (IP) injection of (15)N2-labeled Gln (hGln) did not increase total interstitial fluid Gln, low levels of hGln were detected in microdialysis samples. Competitive inhibition of system A (SLC38A1&2; SNAT1&2) or system L (SLC7A5&8; LAT1&2) transporters in brain by perfusion with α-(methylamino)-isobutyric acid (MeAIB) or 2-aminobicyclo-(2,2,1)-heptane-2-carboxylic acid (BCH) respectively, was tested. The data showed a significantly greater increase in interstitial fluid Gln upon BCH than MeAIB treatment. Furthermore, brain BCH perfusion also strongly increased the influx of hGln into interstitial fluid following IP injection consistent with transstimulation of LAT1-mediated transendothelial transport. Taken together, the data support the independent homeostatic regulation of amino acids in interstitial fluid vs. cerebrospinal fluid and the role of the blood-brain barrier expressed SLC7A5/LAT1 as a key interstitial fluid gatekeeper.

  3. Familial manganese-induced neurotoxicity due to mutations in SLC30A10 or SLC39A14.

    Science.gov (United States)

    Mukhopadhyay, Somshuvra

    2017-08-05

    Over the last few years, two rare, familial diseases that lead to the onset of manganese (Mn)-induced neurotoxicity have been discovered. Loss-of-function mutations in SLC30A10, a Mn efflux transporter, or SLC39A14, a Mn influx transporter, increase Mn levels in blood and brain, and induce severe neurotoxicity. The discoveries of these genetic diseases have transformed our understanding of Mn homeostasis, detoxification, and neurotoxicity. Current knowledge about the mechanisms by which mutations in these transporters alter Mn homeostasis to induce human disease is reviewed here. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Current control of light by nonreciprocal magnetoplasmonics

    Energy Technology Data Exchange (ETDEWEB)

    Gong, Yongkang, E-mail: yongkang.gong@southwales.ac.uk; Li, Kang; Carver, Sara; Martinez, Juan Jose; Huang, Jungang; Copner, Nigel [Wireless and Optoelectronics Research and Innovation Centre (WORIC), Faculty of Computing, Engineering and Science, University of South Wales, Cardiff CF37 1DL (United Kingdom); Thueux, Yoann; Avlonitis, Nick [Airbus Group Innovations, Quadrant House, Celtic Springs, Coedkernew, NP10 8FZ Newport (United Kingdom)

    2015-05-11

    The ability to actively control light has long been a major scientific and technological goal. We proposed a scheme that allows for active control of light by utilizing the nonreciprocal magnetoplasmonic effect. As a proof of concept, we applied current signal through an ultrathin metallic film in a magneto-plasmonic multilayer and found that dynamic photonic nonreciprocity appears in magnetic-optical material layer due to the magnetic field being induced from current signal and modulates surface plasmon polaritons trapped in the metal surface and the light reflected. The proposed concept provides a possible way for the active control of light and could find potential applications such as ultrafast optoelectronic signal processing for plasmonic nanocircuit technology and ultrafast/large-aperture free-space electro-optic modulation platform for wireless laser communication technology.

  5. Dicty_cDB: SLC248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC248 (Link to dictyBase) - G20509 DDB0205993 Contig-U15319-1 | Contig-U15640-1 SLC2...48P (Link to Original site) SLC248F 663 SLC248Z 519 SLC248P 1182 - - Show SLC248 Libr...ary SL (Link to library) Clone ID SLC248 (Link to dictyBase) Atlas ID - NBRP ID G20509 dictyBase ID DDB02059...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC248Q.Seq.d/ Representative seq. ID SLC248P (Link to Original site) ...Representative DNA sequence >SLC248 (SLC248Q) /CSM/SL/SLC2-B/SLC248Q.Seq.d/ GAAAAAAGAAGAAAAAGCTAAAATAAAAATCA

  6. Dicty_cDB: SLC232 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC232 (Link to dictyBase) - G24142 DDB0186870 Contig-U16365-1 SLC2...32P (Link to Original site) SLC232F 642 SLC232Z 732 SLC232P 1374 - - Show SLC232 Library SL (Link to library) Clone ID SLC2...Contig-U16365-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC2...32Q.Seq.d/ Representative seq. ID SLC232P (Link to Original site) Representative DNA sequence >SLC232 (SLC232Q) /CSM/SL/SLC2...-B/SLC232Q.Seq.d/ ATAAATAATGAGACTCCTTTTAGTACTATTGGTACTAATTTTTAGTGTTGTTAGTGCTCA ACAAAAT

  7. Dicty_cDB: SLC349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC349 (Link to dictyBase) - G01920 DDB0231707 Contig-U16466-1 SLC...349P (Link to Original site) SLC349F 675 SLC349Z 566 SLC349P 1241 - - Show SLC349 Library SL (Link to library) Clone ID SLC...Contig-U16466-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-C/SLC...349Q.Seq.d/ Representative seq. ID SLC349P (Link to Original site) Representative DNA sequence >SLC349 (SLC349Q) /CSM/SL/SLC...3-C/SLC349Q.Seq.d/ ATATTAATAAAACGAAAATGTCGACACTCTATGATGTTGTTATCGTTGGTGGTGGTTTAG CAGGTTT

  8. Dicty_cDB: SLC432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC432 (Link to dictyBase) - - - Contig-U09715-1 | Contig-U16382-1 SLC...432P (Link to Original site) SLC432F 633 SLC432Z 188 SLC432P 821 - - Show SLC432 Library SL (Link to library) Clone ID SLC...15-1 | Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC...432Q.Seq.d/ Representative seq. ID SLC432P (Link to Original site) Representative DNA sequence >SLC432 (SLC...432Q) /CSM/SL/SLC4-B/SLC432Q.Seq.d/ ATTAAATTAAATAAAAAATAAAAATGGATGGTGAAGATGTTCAAGCTTTAGTTATTGATA

  9. Dicty_cDB: SLC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC256 (Link to dictyBase) - G01081 DDB0191143 Contig-U11921-1 SLC...256P (Link to Original site) SLC256F 738 SLC256Z 555 SLC256P 1293 - - Show SLC256 Library SL (Link to library) Clone ID SLC...Contig-U11921-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-C/SLC...256Q.Seq.d/ Representative seq. ID SLC256P (Link to Original site) Representative DNA sequence >SLC256 (SLC256Q) /CSM/SL/SLC...2-C/SLC256Q.Seq.d/ AAAAAAAAAAATGATTTATAATCAAGCTTTAATTGAAATTACAAAACAAGGTGCGGTGGC TGTAGAA

  10. Dicty_cDB: SLC370 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC370 (Link to dictyBase) - G01084 DDB0183829 Contig-U10208-1 SLC...370P (Link to Original site) SLC370F 584 SLC370Z 526 SLC370P 1110 - - Show SLC370 Library SL (Link to library) Clone ID SLC...Contig-U10208-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-C/SLC...370Q.Seq.d/ Representative seq. ID SLC370P (Link to Original site) Representative DNA sequence >SLC370 (SLC370Q) /CSM/SL/SLC...3-C/SLC370Q.Seq.d/ GAAAAAAAAAAAAAAAAAAAACAAAATGTTAAAACAAACAAGTATTTTGTTTACAATTTT AATTGGA

  11. Dicty_cDB: SLC615 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC615 (Link to dictyBase) slc615 - - Contig-U15579-1 SLC615Z ...(Link to Original site) - - SLC615Z 452 - - - - Show SLC615 Library SL (Link to library) Clone ID SLC615 (Li...nk to dictyBase) Atlas ID slc615 NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-A/SLC615Q.Seq.d/ Representative seq. ID SLC...615Z (Link to Original site) Representative DNA sequence >SLC615 (SLC615Q) /CSM/SL/SLC6-A/SLC615Q.Se

  12. Dicty_cDB: SLC874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC874 (Link to dictyBase) - - - Contig-U16361-1 SLC874P (Link to Original site) SLC...874F 591 SLC874Z 680 SLC874P 1271 - - Show SLC874 Library SL (Link to library) Clone ID SLC...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-D/SLC874Q.Seq.d/ Representative seq. ID SLC...874P (Link to Original site) Representative DNA sequence >SLC874 (SLC874Q) /CSM/SL/SLC8-D/SLC...flwfcwylyfimerrfrfnr *ts*s*kd*ss*vshveleerfrketssl*sfpsn*igq*k**csrikw*t*g*tifpyf kqri*yh*kfktfpskyyplc

  13. Dicty_cDB: SLC783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC783 (Link to dictyBase) - G01932 DDB0233589 Contig-U15416-1 | Contig-U15892-1 SLC...783P (Link to Original site) SLC783F 405 SLC783Z 180 SLC783P 585 - - Show SLC783 Libra...ry SL (Link to library) Clone ID SLC783 (Link to dictyBase) Atlas ID - NBRP ID G01932 dictyBase ID DDB023358...cdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-D/SLC783Q.Seq.d/ Representative seq. ID SLC783P (Link to Original site) R...epresentative DNA sequence >SLC783 (SLC783Q) /CSM/SL/SLC7-D/SLC783Q.Seq.d/ AAAAAAAAAAAAAAAAAAAAGATGGAGGATCGT

  14. Dicty_cDB: SLC807 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC807 (Link to dictyBase) - G20514 DDB0185188 Contig-U15847-1 SLC...807P (Link to Original site) SLC807F 580 SLC807Z 555 SLC807P 1135 - - Show SLC807 Library SL (Link to library) Clone ID SLC...Contig-U15847-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-A/SLC...807Q.Seq.d/ Representative seq. ID SLC807P (Link to Original site) Representative DNA sequence >SLC807 (SLC807Q) /CSM/SL/SLC...8-A/SLC807Q.Seq.d/ GAAAAGTATTTCTTTCACAAAAAACAAGAAAGATTGATTGGAGATATTCTCAATTAAAAG CAATTAA

  15. Dicty_cDB: SLC533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC533 (Link to dictyBase) - G01925 DDB0206553 Contig-U15578-1 SLC...533P (Link to Original site) SLC533F 622 SLC533Z 570 SLC533P 1192 - - Show SLC533 Library SL (Link to library) Clone ID SLC...Contig-U15578-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-B/SLC...533Q.Seq.d/ Representative seq. ID SLC533P (Link to Original site) Representative DNA sequence >SLC533 (SLC533Q) /CSM/SL/SLC...5-B/SLC533Q.Seq.d/ GGTTTTTTTATTTTTTTTTTTTTTTTTTTAAAAAAATATATTTCATAAAAATTCAAAAAT AACTCAA

  16. Dicty_cDB: SLC419 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC419 (Link to dictyBase) - - - Contig-U03801-1 SLC419Z (Link... to Original site) - - SLC419Z 335 - - - - Show SLC419 Library SL (Link to library) Clone ID SLC419 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC419Q.Seq.d/ Representative seq. ID SLC41...9Z (Link to Original site) Representative DNA sequence >SLC419 (SLC419Q) /CSM/SL/SLC4-A/SLC419Q.Seq.d/ XXXXX...I6-A/SSI602Q.Seq.d/ 490 e-138 SSD173 (SSD173Q) /CSM/SS/SSD1-D/SSD173Q.Seq.d/ 490 e-138 SLC419 (SLC

  17. Dicty_cDB: SLC805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC805 (Link to dictyBase) - - - Contig-U01187-1 | Contig-U10933-1 SLC...805P (Link to Original site) SLC805F 500 SLC805Z 168 SLC805P 668 - - Show SLC805 Library SL (Link to library) Clone ID SLC...87-1 | Contig-U10933-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-A/SLC...805Q.Seq.d/ Representative seq. ID SLC805P (Link to Original site) Representative DNA sequence >SLC805 (SLC...805Q) /CSM/SL/SLC8-A/SLC805Q.Seq.d/ ACAAAGATGAATGGNGTATATTTCACACATCTAGAAAGATGTAGTTTATCTTCCATACCA

  18. Dicty_cDB: SLC566 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC566 (Link to dictyBase) - G22409 DDB0216979 Contig-U08448-1 SLC...566E (Link to Original site) SLC566F 553 SLC566Z 431 SLC566P 984 SLC566E 609 Show SLC566 Library SL (Lin...Contig Contig-U08448-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-C/SLC...566Q.Seq.d/ Representative seq. ID SLC566E (Link to Original site) Representative DNA sequence >SLC566 (SLC...566Q) /CSM/SL/SLC5-C/SLC566Q.Seq.d/ ATGGTAGTGATTTAGTATTTTTAAATGATTTATTCGAGTATAATACTATAGAGAATAAAT

  19. Dicty_cDB: SLC405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC405 (Link to dictyBase) - - - Contig-U11279-1 | Contig-U16243-1 SLC...405P (Link to Original site) SLC405F 536 SLC405Z 439 SLC405P 975 - - Show SLC405 Library SL (Link to library) Clone ID SLC...79-1 | Contig-U16243-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC...405Q.Seq.d/ Representative seq. ID SLC405P (Link to Original site) Representative DNA sequence >SLC405 (SLC...405Q) /CSM/SL/SLC4-A/SLC405Q.Seq.d/ ATAACTAATAAAATGTCATTCAATTCAAGAATTGAAACTATTTCTCGCCACTTAAGCACT

  20. Dicty_cDB: SLC611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC611 (Link to dictyBase) - G24143 DDB0218086 Contig-U11419-1 | Contig-U13205-1 SLC...611P (Link to Original site) SLC611F 643 SLC611Z 568 SLC611P 1211 - - Show SLC611 Libr...ary SL (Link to library) Clone ID SLC611 (Link to dictyBase) Atlas ID - NBRP ID G24143 dictyBase ID DDB02180...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-A/SLC611Q.Seq.d/ Representative seq. ID SLC611P (Link to Original site) ...Representative DNA sequence >SLC611 (SLC611Q) /CSM/SL/SLC6-A/SLC611Q.Seq.d/ AAAAGGTCTTTGTGATGATAAAGATCCATGTA

  1. Dicty_cDB: SLC243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC243 (Link to dictyBase) - G01919 DDB0204742 Contig-U13931-1 SLC...243P (Link to Original site) SLC243F 1119 SLC243Z 565 SLC243P 1674 - - Show SLC243 Library SL (Link to library) Clone ID SLC... Contig-U13931-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC...243Q.Seq.d/ Representative seq. ID SLC243P (Link to Original site) Representative DNA sequence >SLC243 (SLC243Q) /CSM/SL/SLC...2-B/SLC243Q.Seq.d/ ATAATTTTTTTTATTGTTGATCATTTGGTATATTAAGTGTTATTGTTTATATAATATATA TTTAAG

  2. Dicty_cDB: SLC738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC738 (Link to dictyBase) - G01930 DDB0232384 Contig-U13927-1 SLC...738P (Link to Original site) SLC738F 502 SLC738Z 1031 SLC738P 1523 - - Show SLC738 Library SL (Link to library) Clone ID SLC... Contig-U13927-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC7-B/SLC...738Q.Seq.d/ Representative seq. ID SLC738P (Link to Original site) Representative DNA sequence >SLC738 (SLC738Q) /CSM/SL/SLC...7-B/SLC738Q.Seq.d/ AACAAACTAGAAATGTCTAAAGATACAACAGTTTCATTAGAACAACTCTTTAAAGAGTTA GATGAA

  3. Dicty_cDB: SLC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC263 (Link to dictyBase) - G01082 DDB0233929 Contig-U11371-1 SLC...263P (Link to Original site) SLC263F 621 SLC263Z 574 SLC263P 1195 - - Show SLC263 Library SL (Link to library) Clone ID SLC...Contig-U11371-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-C/SLC...263Q.Seq.d/ Representative seq. ID SLC263P (Link to Original site) Representative DNA sequence >SLC263 (SLC263Q) /CSM/SL/SLC...2-C/SLC263Q.Seq.d/ CTAAATCAATAATAAACAATTAATCAAAAATGACAATCTTTGATAGCGACGAAGAAGAGT TAGTTAC

  4. Current limiting remote power control module

    Science.gov (United States)

    Hopkins, Douglas C.

    1990-01-01

    The power source for the Space Station Freedom will be fully utilized nearly all of the time. As such, any loads on the system will need to operate within expected limits. Should any load draw an inordinate amount of power, the bus voltage for the system may sag and disrupt the operation of other loads. To protect the bus and loads some type of power interface between the bus and each load must be provided. This interface is most crucial when load faults occur. A possible system configuration is presented. The proposed interface is the Current Limiting Remote Power Controller (CL-RPC). Such an interface should provide the following power functions: limit overloading and resulting undervoltage; prevent catastrophic failure and still provide for redundancy management within the load; minimize cable heating; and provide accurate current measurement. A functional block diagram of the power processing stage of a CL-RPC is included. There are four functions that drive the circuit design: rate control of current; current sensing; the variable conductance switch (VCS) technology; and the algorithm used for current limiting. Each function is discussed separately.

  5. Digitally Controllable Current Amplifier and Current Conveyors in Practical Application of Controllable Frequency Filter

    Science.gov (United States)

    Polak, Josef; Jerabek, Jan; Langhammer, Lukas; Sotner, Roman; Dvorak, Jan; Panek, David

    2016-07-01

    This paper presents the simulations results in comparison with the measured results of the practical realization of the multifunctional second order frequency filter with a Digitally Adjustable Current Amplifier (DACA) and two Dual-Output Controllable Current Conveyors (CCCII +/-). This filter is designed for use in current mode. The filter was designed of the single input multiple outputs (SIMO) type, therefore it has only one input and three outputs with individual filtering functions. DACA element used in a newly proposed circuit is present in form of an integrated chip and the current conveyors are implemented using the Universal Current Conveyor (UCC) chip with designation UCC-N1B. Proposed frequency filter enables independent control of the pole frequency using parameters of two current conveyors and also independent control of the quality factor by change of a current gain of DACA.

  6. System Development of Monitoring and Network Platform Via AB SLC500 Programmable Logic Controller%基于可编程逻辑控制器对网络应用程序的系统开发

    Institute of Scientific and Technical Information of China (English)

    罗霄华

    2014-01-01

    Remote access to control and monitor various devices in industrial and other environments is very important and big challenge for engineers and automation institutes. The Internet technology is providing this accessibility with great benefits to the industry. One such demand is to access an Allen-Bradley SLC 500 family Programmable Logic Controller(PLC)through the Internet using any available standard web browser. This remote access capability provides real-time data acquisition to monitor and control devices that are connected to the Inputs/Outputs modules of the PLC. This paper presents a novel scheme to provide real-time accessibility to Allen Bradley PLC to control equipment without using any dedicated licensed software that runs as a tool for the web server.%在目前的工业体系中,如何实现远程监测和控制各种设备是工程师和自动化产业面临的巨大挑战。其中,网络科技扮演着重要的角色。通过结合艾伦布拉德利SLC500系列中的可编程逻辑控制器(PLC),可利用网络服务器和浏览器远程监控设备。这种远程获取信息的方式为监控器提供了实时数据。就在不利用任何付费型软件的情况下,讨论如何通过Allen Bradley PLC和网络服务器远程获取实时数据。

  7. Dicty_cDB: SLC529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC529 (Link to dictyBase) - G03203 DDB0191194 Contig-U16271-1 SLC...529E (Link to Original site) SLC529F 741 SLC529Z 539 SLC529P 1280 SLC529E 1259 Show SLC529 Library SL (L...ink to library) Clone ID SLC529 (Link to dictyBase) Atlas ID - NBRP ID G03203 dictyBase ID DDB0191194 Link t...o Contig Contig-U16271-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-B/SLC...529Q.Seq.d/ Representative seq. ID SLC529E (Link to Original site) Representative DNA sequence >SLC529 (SLC

  8. Dicty_cDB: SLC539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC539 (Link to dictyBase) - - - Contig-U12910-1 SLC539Z (Link... to Original site) - - SLC539Z 560 - - - - Show SLC539 Library SL (Link to library) Clone ID SLC539 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-B/SLC539Q.Seq.d/ Representative seq. ID SLC53...9Z (Link to Original site) Representative DNA sequence >SLC539 (SLC539Q) /CSM/SL/SLC5-B/SLC539Q.Seq.d/ XXXXX...krrsfqqwcfpiqlqe*q*p*s*ww**iq*q*kqw**rsrwlqrysr s*rw*qiqq*qqrrrl*qrwlww*s*ww**rkksirwfpkklr*qqk*sskrrt*tirik s*lc

  9. Dicty_cDB: SLC418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC418 (Link to dictyBase) - G01921 DDB0191271 Contig-U15820-1 SLC...418E (Link to Original site) SLC418F 604 SLC418Z 554 SLC418P 1158 SLC418E 1076 Show SLC418 Library SL (L...ink to library) Clone ID SLC418 (Link to dictyBase) Atlas ID - NBRP ID G01921 dictyBase ID DDB0191271 Link t...o Contig Contig-U15820-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC...418Q.Seq.d/ Representative seq. ID SLC418E (Link to Original site) Representative DNA sequence >SLC418 (SLC

  10. Dicty_cDB: SLC601 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC601 (Link to dictyBase) - G01088 DDB0186974 Contig-U14173-1 SLC...601E (Link to Original site) SLC601F 1278 SLC601Z 524 SLC601P 1792 SLC601E 1630 Show SLC601 Library SL (...Link to library) Clone ID SLC601 (Link to dictyBase) Atlas ID - NBRP ID G01088 dictyBase ID DDB0186974 Link ...to Contig Contig-U14173-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-A/SLC...601Q.Seq.d/ Representative seq. ID SLC601E (Link to Original site) Representative DNA sequence >SLC601 (SLC

  11. Molecular analysis of the human SLC13A4 sulfate transporter gene promoter

    Energy Technology Data Exchange (ETDEWEB)

    Jefferis, J. [Mater Medical Research Institute, South Brisbane, Queensland (Australia); Rakoczy, J. [Mater Medical Research Institute, South Brisbane, Queensland (Australia); School of Biomedical Sciences, University of Queensland, St. Lucia, Queensland (Australia); Translational Research Institute, Woolloongabba, Queensland (Australia); Simmons, D.G. [School of Biomedical Sciences, University of Queensland, St. Lucia, Queensland (Australia); Dawson, P.A., E-mail: paul.dawson@mmri.mater.org.au [Mater Medical Research Institute, South Brisbane, Queensland (Australia); Translational Research Institute, Woolloongabba, Queensland (Australia)

    2013-03-29

    Highlights: ► Basal promoter activity of SLC13A4 −57 to −192 nt upstream of transcription initiation site. ► Human SLC13A4 5′-flanking region has conserved motifs with other placental species. ► Putative NFY, SP1 and KLF7 motifs in SLC13A4 5′-flanking region enhance transcription. -- Abstract: The human solute linked carrier (SLC) 13A4 gene is primarily expressed in the placenta where it is proposed to mediate the transport of nutrient sulfate from mother to fetus. The molecular mechanisms involved in the regulation of SLC13A4 expression remain unknown. To investigate the regulation of SLC13A4 gene expression, we analysed the transcriptional activity of the human SLC13A4 5′-flanking region in the JEG-3 placental cell line using luciferase reporter assays. Basal transcriptional activity was identified in the region −57 to −192 nucleotides upstream of the SLC13A4 transcription initiation site. Mutational analysis of the minimal promoter region identified Nuclear factor Y (NFY), Specificity protein 1 (SP1) and Krüppel like factor 7 (KLF7) motifs which conferred positive transcriptional activity, as well as Zinc finger protein of the cerebellum 2 (ZIC2) and helix–loop–helix protein 1 (HEN1) motifs that repressed transcription. The conserved NFY, SP1, KLF7, ZIC2 and HEN1 motifs in the SLC13A4 promoter of placental species but not in non-placental species, suggests a potential role for these putative transcriptional factor binding motifs in the physiological control of SLC13A4 mRNA expression.

  12. SLC23A1 polymorphism rs6596473 in the vitamin C transporter SVCT1 is associated with aggressive periodontitis

    NARCIS (Netherlands)

    de Jong, T.M.H.; Jochens, A.; Jockel-Schneider, Y.; Harks, I.; Dommisch, H.; Graetz, C.; Flachsbart, F.; Staufenbiel, I.; Eberhard, J.; Folwaczny, M.; Noack, B.; Meyle, J.; Eikholz, P.; Gieger, C.; Grallert, H.; Lieb, W.; Franke, A.; Nebel, A.; Schreiber, S.; Doerfer, C.; Jepsen, S.; Bruckmann, C.; van der Velden, U.; Loos, B.G.; Schaefer, A.S.

    2014-01-01

    Aim Identification of variants within genes SLC23A1 and SLC23A2 coding for vitamin C transporter proteins associated with aggressive (AgP) and chronic periodontitis (CP). Material and Methods Employment of three independent case-control samples of AgP (I. 283 cases, 979 controls; II. 417 cases, 1912

  13. Sliding Mode Control of Induction Motor Phase Currents

    DEFF Research Database (Denmark)

    Hansen, R.B.; Hattel, T.; Bork, J

    1995-01-01

    Sliding mode control of induction motor phase currents are investigated through development of two control concepts.......Sliding mode control of induction motor phase currents are investigated through development of two control concepts....

  14. Sliding Mode Control of Induction Motor Phase Currents

    DEFF Research Database (Denmark)

    Hansen, R.B.; Hattel, T.; Bork, J

    1995-01-01

    Sliding mode control of induction motor phase currents are investigated through development of two control concepts.......Sliding mode control of induction motor phase currents are investigated through development of two control concepts....

  15. Dicty_cDB: SLC647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC647 (Link to dictyBase) - - - Contig-U16255-1 SLC647Z (Link... to Original site) - - SLC647Z 536 - - - - Show SLC647 Library SL (Link to library) Clone ID SLC647 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC6-B/SLC647Q.Seq.d/ Representative seq. ID SLC64...7Z (Link to Original site) Representative DNA sequence >SLC647 (SLC647Q) /CSM/SL/SLC6-B/SLC647Q.Seq.d/ XXXXX...nnclishwyhkwwwwy gfiwwsir*rik*skcytwsl*rryflg****il***lplc**rry**rfqw***i*n*c *r*fprr*frrricilln*tffhfkiiiii

  16. Dicty_cDB: SLC105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC105 (Link to dictyBase) - - - Contig-U16399-1 SLC105Z (Link... to Original site) - - SLC105Z 655 - - - - Show SLC105 Library SL (Link to library) Clone ID SLC105 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-A/SLC105Q.Seq.d/ Representative seq. ID SLC10...5Z (Link to Original site) Representative DNA sequence >SLC105 (SLC105Q) /CSM/SL/SLC1-A/SLC105Q.Seq.d/ XXXXX...rame A: ---ecdiir**rgwlkfttrcmctidq*yh*scq*lnvcihl*tt*ikqfh*fnfkk*fl nlc*ygtcyssklhsks*tts*tss**rssnqi*ckftlc

  17. Dicty_cDB: SLC276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC276 (Link to dictyBase) - - - Contig-U12910-1 SLC276Z (Link... to Original site) - - SLC276Z 542 - - - - Show SLC276 Library SL (Link to library) Clone ID SLC276 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-D/SLC276Q.Seq.d/ Representative seq. ID SLC27...6Z (Link to Original site) Representative DNA sequence >SLC276 (SLC276Q) /CSM/SL/SLC2-D/SLC276Q.Seq.d/ XXXXX...qrysrs*rw*q iqq*qqrrrl*qrwlww*s*ww**rkksirwfpkklr*qqk*sskrrt*tiriks*lc** lekpi*rcih*ciqqtkktsiq*qq*akkl*q**q

  18. Dicty_cDB: SLC450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC450 (Link to dictyBase) - - - Contig-U16382-1 SLC450Z (Link... to Original site) - - SLC450Z 416 - - - - Show SLC450 Library SL (Link to library) Clone ID SLC450 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC450Q.Seq.d/ Representative seq. ID SLC45...0Z (Link to Original site) Representative DNA sequence >SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ XXXXX...sdesashtnkyi*m ynnnki*lflmvvdlyptik Translated Amino Acid sequence (All Frames) Frame A: ---ttytps*nvmlisvkiytvmssylvvqlc

  19. Dicty_cDB: SLC245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC245 (Link to dictyBase) - - - Contig-U15493-1 SLC245Z (Link... to Original site) - - SLC245Z 597 - - - - Show SLC245 Library SL (Link to library) Clone ID SLC245 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC245Q.Seq.d/ Representative seq. ID SLC24...5Z (Link to Original site) Representative DNA sequence >SLC245 (SLC245Q) /CSM/SL/SLC2-B/SLC245Q.Seq.d/ XXXXX...o Acid sequence (All Frames) Frame A: ---lnpiqirqtiihrprryahwsicfrw*kshphhw*hppnw*tprryhhlqr*rktr* lwcccslfr*lc

  20. Dicty_cDB: SLC559 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC559 (Link to dictyBase) - - - Contig-U12055-1 SLC559Z (Link... to Original site) - - SLC559Z 555 - - - - Show SLC559 Library SL (Link to library) Clone ID SLC559 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-C/SLC559Q.Seq.d/ Representative seq. ID SLC55...9Z (Link to Original site) Representative DNA sequence >SLC559 (SLC559Q) /CSM/SL/SLC5-C/SLC559Q.Seq.d/ XXXXX...n*krn qqtliivi*kfifpmknlklysivnvln*llcqpgreii*klnlvyskkk*****lkklk kkktlii Frame C: ---nqkervq*snw*sitskrl***tnhfnlc

  1. Dicty_cDB: SLC852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC852 (Link to dictyBase) - - - Contig-U16255-1 SLC852Z (Link... to Original site) - - SLC852Z 333 - - - - Show SLC852 Library SL (Link to library) Clone ID SLC852 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-C/SLC852Q.Seq.d/ Representative seq. ID SLC85...2Z (Link to Original site) Representative DNA sequence >SLC852 (SLC852Q) /CSM/SL/SLC8-C/SLC852Q.Seq.d/ XXXXX...nnlitnhyhq**hynitlitilffniqrly Translated Amino Acid sequence (All Frames) Frame A: ---r*rik*skcytwsl*rryflg****il***lplc

  2. Dicty_cDB: SLC887 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC887 (Link to dictyBase) - - - Contig-U16325-1 SLC887Z (Link... to Original site) - - SLC887Z 597 - - - - Show SLC887 Library SL (Link to library) Clone ID SLC887 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC8-D/SLC887Q.Seq.d/ Representative seq. ID SLC88...7Z (Link to Original site) Representative DNA sequence >SLC887 (SLC887Q) /CSM/SL/SLC8-D/SLC887Q.Seq.d/ XXXXX...mmvlklvsltevst*tismvfkkkkkiii kflkl*iiifl*kkkkkkkki Frame C: ---ns*tktttpwlssr*lr*r*emylctw*dllyskdhl*sstlsk

  3. Dicty_cDB: SLC586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC586 (Link to dictyBase) - - - Contig-U16276-1 SLC586Z (Link... to Original site) - - SLC586Z 495 - - - - Show SLC586 Library SL (Link to library) Clone ID SLC586 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC5-D/SLC586Q.Seq.d/ Representative seq. ID SLC58...6Z (Link to Original site) Representative DNA sequence >SLC586 (SLC586Q) /CSM/SL/SLC5-D/SLC586Q.Seq.d/ XXXXX...FLAWEDKNGGFAGKKFLQGKLYK*inlnli*nff Translated Amino Acid sequence (All Frames) Frame A: ---inlcsg*iqtyllqq*slhvhsmvl*tl*qgrflc

  4. Dicty_cDB: SLC378 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC378 (Link to dictyBase) - - - Contig-U16603-1 SLC378Z (Link... to Original site) - - SLC378Z 355 - - - - Show SLC378 Library SL (Link to library) Clone ID SLC378 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-D/SLC378Q.Seq.d/ Representative seq. ID SLC37...8Z (Link to Original site) Representative DNA sequence >SLC378 (SLC378Q) /CSM/SL/SLC3-D/SLC378Q.Seq.d/ XXXXX...me A: ---fwyskyvskr*ldnh*iwwy*srtilc**ylickwfk**maqscnltr*ckc*kyfi hywykslc*yddsnfsitsnscssttnyf*ihps*clkkkk

  5. Dicty_cDB: SLC364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC364 (Link to dictyBase) - - - Contig-U16325-1 SLC364Z (Link... to Original site) - - SLC364Z 654 - - - - Show SLC364 Library SL (Link to library) Clone ID SLC364 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC3-C/SLC364Q.Seq.d/ Representative seq. ID SLC36...4Z (Link to Original site) Representative DNA sequence >SLC364 (SLC364Q) /CSM/SL/SLC3-C/SLC364Q.Seq.d/ XXXXX...ame A: ---tnlstnlstnlstntttksimr*c*mskrlpl*m*slgkcc*mckkrrtns*tkttt pwlssr*lr*r*emylctw*dllyskdhl*sstlskktpl*mq*krssflc

  6. DFIG Harmonic Current Controlling with the Grid Low Harmonic Voltage

    Directory of Open Access Journals (Sweden)

    Huan Wang

    2014-01-01

    Full Text Available This study presents a vector control strategy based on stator harmonic current closed-loop, it adds individually the control loop about of each stator harmonic current to restrain the stator harmonic current, in order to meet the THD criteria. The control strategy of restraining the harmonic current presents the design of the stator harmonic current restrains the current controller. It influences the rotor voltage of the stator harmonic current restraining strategies.

  7. Additive composite ABCG2, SLC2A9 and SLC22A12 scores of high-risk alleles with alcohol use modulate gout risk.

    Science.gov (United States)

    Tu, Hung-Pin; Chung, Chia-Min; Min-Shan Ko, Albert; Lee, Su-Shin; Lai, Han-Ming; Lee, Chien-Hung; Huang, Chung-Ming; Liu, Chiu-Shong; Ko, Ying-Chin

    2016-09-01

    The aim of the present study was to evaluate the contribution of urate transporter genes and alcohol use to the risk of gout/tophi. Eight variants of ABCG2, SLC2A9, SLC22A12, SLC22A11 and SLC17A3 were genotyped in male individuals in a case-control study with 157 gout (33% tophi), 106 asymptomatic hyperuricaemia and 295 control subjects from Taiwan. The multilocus profiles of the genetic risk scores for urate gene variants were used to evaluate the risk of asymptomatic hyperuricaemia, gout and tophi. ABCG2 Q141K (T), SLC2A9 rs1014290 (A) and SLC22A12 rs475688 (C) under an additive model and alcohol use independently predicted the risk of gout (respective odds ratio for each factor=2.48, 2.03, 1.95 and 2.48). The additive composite Q141K, rs1014290 and rs475688 scores of high-risk alleles were associated with gout risk (P<0.0001). We observed the supramultiplicative interaction effect of genetic urate scores and alcohol use on gout and tophi risk (P for interaction=0.0452, 0.0033). The synergistic effect of genetic urate score 5-6 and alcohol use indicates that these combined factors correlate with gout and tophi occurrence.

  8. Methylation of the SLC6a2 gene promoter in major depression and panic disorder.

    Directory of Open Access Journals (Sweden)

    Richard Bayles

    Full Text Available Reduced function of the noradrenaline transporter (NET has been demonstrated in patients with major depressive disorder (MDD and panic disorder. Attempts to explain NET dysfunction in MDD and panic disorder by genetic variation in the NET gene SLC6a2 have been inconclusive. Transcriptional silencing of the SLC6a2 gene may be an alternative mechanism which can lead to NET dysfunction independent of DNA sequence. The objective of this study was to characterise the DNA methylation state of the SLC6a2 gene promoter in patients with MDD and panic disorder. SLC6a2 promoter methylation was also analysed before and after antidepressant treatment. This study was performed with DNA from blood, using bisulphite sequencing and EpiTYPER methylation analyses. Patients with MDD or panic disorder were not found to differ significantly from healthy controls in the pattern of methylation of the SLC6a2 gene promotor. While significant correlations between methylation levels at some CpG sites and physiological measures were identified, overall the variation in DNA methylation between patients was small, and the significance of this variation remains equivocal. No significant changes in SLC6a2 promoter methylation were observed in response to antidepressant treatment. Further in-depth analysis of alternative mechanisms of transcriptional regulation of the SLC6a2 gene in human health and disease would be of value.

  9. Instantaneous Current Feedback Control Strategy on Buck Mode Inverter

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Control strategies for Buck mode inverter have important effect on static and dynamic characteristics, reliability, load capacity, and short-circuit resistance. Instantaneous current feedback control strategies include instantaneous inductor current feedback control and instantaneous capacitor current feedback control, both of which have essential difference. When the Buck mode inverter respectively adopts instantaneous inductor current and capacitor current feedback control strategies, characteristics of stability, output voltage and power, short circuit, nonlinear load and dynamic are fully investigated in this paper.

  10. Circuit Controls Turn-On Current

    Science.gov (United States)

    Holmes, K. G.

    1972-01-01

    Single choke used in primary circuit with diode arrangement, maintaining dc current flow through choke and setting up a unidirectional magnetic field, limits turn-on current of transformer-rectifier power supply. Technique reduces number and weight of components and minimizes effect of initial inrush surge current on source.

  11. Controlling local currents in molecular junctions

    CERN Document Server

    Yadalam, Hari Kumar

    2016-01-01

    The effect of non-equilibrium constraints and dephasing on the circulating currents in molecular junctions are analyzed. Circulating currents are manifestations of quantum effects and can be induced either by externally applied bias or an external magnetic field through the molecular system. In symmetric Aharonov-Bohm ring, bond currents have two contributions, bias driven and magnetic field driven. We analyze the competition between these two contributions and show that, as a consequence, current through one of the branches can be completely suppressed. We then study the effect of asymmetry (as a result of chemical substitution) on the current pathways inside the molecule and study asymmetry induced circulating currents (without magnetic field) by tuning the coupling strength of the substituent (at finite bias).

  12. Upregulation of the Creatine Transporter Slc6A8 by Klotho

    Directory of Open Access Journals (Sweden)

    Ahmad Almilaji

    2014-11-01

    Full Text Available Background/Aims: The transmembrane Klotho protein contributes to inhibition of 1,25(OH2D3 formation. The extracellular domain of Klotho protein could function as an enzyme with e.g. β-glucuronidase activity, be cleaved off and be released into blood and cerebrospinal fluid. Klotho regulates several cellular transporters. Klotho protein deficiency accelerates the appearance of age related disorders including neurodegeneration and muscle wasting and eventually leads to premature death. The main site of Klotho protein expression is the kidney. Klotho protein is also appreciably expressed in other tissues including chorioid plexus. The present study explored the effect of Klotho protein on the creatine transporter CreaT (Slc6A8, which participates in the maintenance of neuronal function and survival. Methods: To this end cRNA encoding Slc6A8 was injected into Xenopus oocytes with and without additional injection of cRNA encoding Klotho protein. Creatine transporter CreaT (Slc6A8 activity was estimated from creatine induced current determined by two-electrode voltage-clamp. Results: Coexpression of Klotho protein significantly increased creatine-induced current in Slc6A8 expressing Xenopus oocytes. Coexpression of Klotho protein delayed the decline of creatine induced current following inhibition of carrier insertion into the cell membrane by brefeldin A (5 µM. The increase of creatine induced current by coexpression of Klotho protein in Slc6A8 expressing Xenopus oocytes was reversed by β-glucuronidase inhibitor (DSAL. Similarly, treatment of Slc6A8 expressing Xenopus oocytes with recombinant human alpha Klotho protein significantly increased creatine induced current. Conclusion: Klotho protein up-regulates the activity of creatine transporter CreaT (Slc6A8 by stabilizing the carrier protein in the cell membrane, an effect requiring β-glucuronidase activity of Klotho protein.

  13. Precision measurements of the SLC reference magnets

    Energy Technology Data Exchange (ETDEWEB)

    Watson, S.; Levi, M.; Nash, J.

    1989-03-01

    Two spectrometers, one on each extraction line of the SLC, have been installed to momentum analyse each SLC beam pulse and determine the electron and positron beam energies. A method of determining and monitoring the absolute magnetic field strength for these dipoles has been developed. A total error on the magnetic field integral of {delta}{integral}Bdl/{integral}Bdl = 1 {times} 10{sup {minus}4} has been achieved. The field integral can be monitored continuously during SLC beam operation using radiation hardened equipment. The laboratory field mapping techniques and the field monitoring methods are described. 6 refs., 4 figs., 5 tabs.

  14. Chloride Anions Regulate Kinetics but Not Voltage-Sensor Qmax of the Solute Carrier SLC26a5.

    Science.gov (United States)

    Santos-Sacchi, Joseph; Song, Lei

    2016-06-07

    In general, SLC26 solute carriers serve to transport a variety of anions across biological membranes. However, prestin (SLC26a5) has evolved, now serving as a motor protein in outer hair cells (OHCs) of the mammalian inner ear and is required for cochlear amplification, a mechanical feedback mechanism to boost auditory performance. The mechanical activity of the OHC imparted by prestin is driven by voltage and controlled by anions, chiefly intracellular chloride. Current opinion is that chloride anions control the Boltzmann characteristics of the voltage sensor responsible for prestin activity, including Qmax, the total sensor charge moved within the membrane, and Vh, a measure of prestin's operating voltage range. Here, we show that standard narrow-band, high-frequency admittance measures of nonlinear capacitance (NLC), an alternate representation of the sensor's charge-voltage (Q-V) relationship, is inadequate for assessment of Qmax, an estimate of the sum of unitary charges contributed by all voltage sensors within the membrane. Prestin's slow transition rates and chloride-binding kinetics adversely influence these estimates, contributing to the prevalent concept that intracellular chloride level controls the quantity of sensor charge moved. By monitoring charge movement across frequency, using measures of multifrequency admittance, expanded displacement current integration, and OHC electromotility, we find that chloride influences prestin kinetics, thereby controlling charge magnitude at any particular frequency of interrogation. Importantly, however, this chloride dependence vanishes as frequency decreases, with Qmax asymptoting at a level irrespective of the chloride level. These data indicate that prestin activity is significantly low-pass in the frequency domain, with important implications for cochlear amplification. We also note that the occurrence of voltage-dependent charge movements in other SLC26 family members may be hidden by inadequate

  15. Comparison between SLC3A1 and SLC7A9 cystinuria patients and carriers: a need for a new classification.

    Science.gov (United States)

    Dello Strologo, Luca; Pras, Elon; Pontesilli, Claudia; Beccia, Ercole; Ricci-Barbini, Vittorino; de Sanctis, Luisa; Ponzone, Alberto; Gallucci, Michele; Bisceglia, Luigi; Zelante, Leopoldo; Jimenez-Vidal, Maite; Font, Mariona; Zorzano, Antonio; Rousaud, Ferran; Nunes, Virginia; Gasparini, Paolo; Palacín, Manuel; Rizzoni, Gianfranco

    2002-10-01

    Recent developments in the genetics and physiology of cystinuria do not support the traditional classification, which is based on the excretion of cystine and dibasic amino acids in obligate heterozygotes. Mutations of only two genes (SLC3A1 and SLC7A9), identified by the International Cystinuria Consortium (ICC), have been found to be responsible for all three types of the disease. The ICC set up a multinational database and collected genetic and clinical data from 224 patients affected by cystinuria, 125 with full genotype definition. Amino acid urinary excretion patterns of 189 heterozygotes with genetic definition and of 83 healthy controls were also included. All SLC3A1 carriers and 14% of SLC7A9 carriers showed a normal amino acid urinary pattern (i.e., type I phenotype). The rest of the SLC7A9 carriers showed phenotype non-I (type III, 80.5%; type II, 5.5%). This makes the traditional classification imprecise. A new classification is needed: type A, due to two mutations of SLC3A1 (rBAT) on chromosome 2 (45.2% in our database); type B, due to two mutations of SLC7A9 on chromosome 19 (53.2% in this series); and a possible third type, AB (1.6%), with one mutation on each of the above-mentioned genes. Clinical data show that cystinuria is more severe in males than in females. The two types of cystinuria (A and B) had a similar outcome in this retrospective study, but the effect of the treatment could not be analyzed. Stone events do not correlate with amino acid urinary excretion. Renal function was clearly impaired in 17% of the patients.

  16. SLC2A9 is a high-capacity urate transporter in humans.

    Directory of Open Access Journals (Sweden)

    Mark J Caulfield

    2008-10-01

    0.98, 95% confidence interval [CI] 0.9 to 1.05, p > 0.33 by meta-analysis of an SLC2A9 variant in six case-control studies including 11,897 participants. In a separate meta-analysis of four population studies including 11,629 participants we found no association of SLC2A9 with systolic (effect size -0.12 mm Hg, 95% CI -0.68 to 0.43, p = 0.664 or diastolic blood pressure (effect size -0.03 mm Hg, 95% CI -0.39 to 0.31, p = 0.82. CONCLUSIONS: This study provides evidence that SLC2A9 splice variants act as high-capacity urate transporters and is one of the first functional characterisations of findings from genome-wide association scans. We did not find an association of the SLC2A9 gene with blood pressure in this study. Our findings suggest potential pathogenic mechanisms that could offer a new drug target for gout.

  17. Characterization of the isoforms of type IIb sodium-dependent phosphate cotransporter (Slc34a2) in yellow catfish, Pelteobagrus fulvidraco, and their vitamin D3-regulated expression under low-phosphate conditions.

    Science.gov (United States)

    Chen, Pei; Huang, Yanqing; Bayir, Abdulkadir; Wang, Chunfang

    2017-02-01

    In this study, two isoforms slc34a2 genes (type IIb sodium-dependent phosphate cotransporter), slc34a2a2 and slc34a2b, were cloned from intestine and kidney of yellow catfish (Pelteobagrus fulvidraco), with rapid amplification of cDNA ends. The structure differences and the regulation effects of dietary VD3 under low phosphorus were compared among three isoforms of slc34a2 in yellow catfish. The predicted Slc34a2a2 and Slc34a2b proteins match 65 % and 53.8 % sequence identity, with Slc34a2a1, respectively. The membrane-spanning domains were different among these three isoforms. Intestinal Slc34a2a1 and Slc34a2a2 proteins had eight and eleven transmembrane domains, while renal Slc34a2b protein had nine. The tissue distribution study showed that same as slc34a2a1, slc34a2a2 mRNA was mainly distributed in intestine and slc34a2b mRNA in kidney. The effect of vitamin D3 (VD3) level on slc34a2 subfamily expression under low-phosphate conditions, induced by the addition of 0 (VD0), 324 (VD1), 1243 (VD2), 3621 (VD3), 8040 (VD4), or 22700 (VD5) IU VD3/kg feed, was assessed by qPCR. The dose-responsive expression of intestinal slc34a2a2 and high expression of intestinal slc34a2a2 in VD5 together with peak expression of kidney slc34a2b in VD3 coincided with the accumulation of body phosphate content. These data suggested that appropriate level of dietary VD3 up-regulated slc34a2a1, slc34a2a2, and slc34a2b mRNA levels, which increased phosphate retention. In conclusion, the current study provided another possible approach to improve dietary phosphate utilization by adding appropriate level of VD3 to a low-phosphate diet to regulate intestinal and renal slc34a2 gene expression and thus minimize the excretion of phosphorus in yellow catfish.

  18. SLC6A15, a novel stress vulnerability candidate, modulates anxiety and depressive-like behavior: involvement of the glutamatergic system.

    Science.gov (United States)

    Santarelli, S; Wagner, K V; Labermaier, C; Uribe, A; Dournes, C; Balsevich, G; Hartmann, J; Masana, M; Holsboer, F; Chen, A; Müller, M B; Schmidt, M V

    2016-01-01

    Major depression is a multifactorial disease, involving both environmental and genetic risk factors. Recently, SLC6A15 - a neutral amino acid transporter mainly expressed in neurons - was proposed as a new candidate gene for major depression and stress vulnerability. Risk allele carriers for a single nucleotide polymorphism (SNP) in a SLC6A15 regulatory region display altered hippocampal volume, glutamate levels, and hypothalamus-pituitary-adrenal axis activity, all markers associated with major depression. Despite this genetic link between SLC6A15 and depression, its functional role with regard to the development and maintenance of depressive disorder is still unclear. The aim of the current study was therefore to characterize the role of mouse slc6a15 in modulating brain function and behavior, especially in relation to stress as a key risk factor for the development of mood disorders. We investigated the effects of slc6a15 manipulation using two mouse models, a conventional slc6a15 knock-out mouse line (SLC-KO) and a virus-mediated hippocampal slc6a15 overexpression (SLC-OE) model. Mice were tested under basal conditions and following chronic social stress. We found that SLC-KO animals displayed a similar behavioral profile to wild-type littermates (SLC-WT) under basal conditions. Interestingly, following chronic social stress SLC-KO animals showed lower levels of anxiety- and depressive-like behavior compared to stressed WT littermates. In support of these findings, SLC-OE animals displayed increased anxiety-like behavior already under basal condition. We also provide evidence that GluR1 expression in the dentate gyrus, but not GluR2 or NR1, are regulated by slc6a15 expression, and may contribute to the difference in stress responsiveness observed between SLC-KO and SLC-WT animals. Taken together, our data demonstrate that slc6a15 plays a role in modulating emotional behavior, possibly mediated by its impact on glutamatergic neurotransmission.

  19. Malaria vector control: current and future strategies

    NARCIS (Netherlands)

    Takken, W.; Knols, B.G.J.

    2009-01-01

    The recently announced call for malaria eradication represents a new page in the history of this disease. This has been triggered by remarkable reductions in malaria resulting from combined application of effective drugs and vector control. However, this strategy is threatened by development of inse

  20. Inductor Current Sampled Feedback Control of Chaos in Current-Mode Boost Converter

    Institute of Scientific and Technical Information of China (English)

    Bo-Cheng Bao; Jian-Ping Xu; Yan Liang

    2008-01-01

    A chaos control strategy for chaotic current-mode boost converter is presented by using inductor current sampled feedback control technique. The quantitative analysis of control mechanism is performed by establishing a discrete alterative map of the controlled system. The stability criterion, feedback gain, and corresponding critical duty ratio are obtained from the eigenvalue of the map. The simulation results verify the theoretical analysis results of the control strategy.

  1. Adaptive slope compensation for high bandwidth digital current mode controller

    DEFF Research Database (Denmark)

    Taeed, Fazel; Nymand, Morten

    2015-01-01

    An adaptive slope compensation method for digital current mode control of dc-dc converters is proposed in this paper. The compensation slope is used for stabilizing the inner current loop in peak current mode control. In this method, the compensation slope is adapted with the variations...... in converter duty cycle. The adaptive slope compensation provides optimum controller operation in term of bandwidth over wide range of operating points. In this paper operation principle of the controller is discussed. The proposed controller is implemented in an FPGA to control a 100 W buck converter...

  2. Vitamin C transporter gene (SLC23A1 and SLC23A2) polymorphisms, plasma vitamin C levels, and gastric cancer risk in the EPIC cohort

    DEFF Research Database (Denmark)

    Duell, Eric J; Lujan-Barroso, Leila; Llivina, Claudia

    2013-01-01

    Vitamin C is known to protect mucosal tissues from oxidative stress and inhibit nitrosamine formation in the stomach. High consumption of fruits, particularly citrus, and higher circulating vitamin C concentrations may be inversely associated with gastric cancer (GC) risk. We investigated 20...... polymorphisms in vitamin C transporter genes SCL23A1 and SCL23A2 and GC risk in 365 cases and 1,284 controls nested within the European Prospective Investigation into Cancer and Nutrition cohort. We also evaluated the association between these polymorphisms and baseline plasma vitamin C levels in a subset...... of participants. Four SNPs were predictors of plasma vitamin C levels (SLC23A1 rs11950646 and rs33972313; SLC23A2 rs6053005 and rs6133175) in multivariable linear regression models. One SNP (SLC23A2 rs6116569) was associated with GC risk, in particular non-cardia GC (OR = 1.63, 95 % CI = 1.11-2.39, based on 178...

  3. Standardized, systemic phenotypic analysis of Slc12a1I299F mutant mice.

    Science.gov (United States)

    Kemter, Elisabeth; Rathkolb, Birgit; Becker, Lore; Bolle, Ines; Busch, Dirk H; Dalke, Claudia; Elvert, Ralf; Favor, Jack; Graw, Jochen; Hans, Wolfgang; Ivandic, Boris; Kalaydjiev, Svetoslav; Klopstock, Thomas; Rácz, Ildikó; Rozman, Jan; Schrewe, Anja; Schulz, Holger; Zimmer, Andreas; Fuchs, Helmut; Gailus-Durner, Valérie; Hrabe de Angelis, Martin; Wolf, Eckhard; Aigner, Bernhard

    2014-08-02

    Type I Bartter syndrome is a recessive human nephropathy caused by loss-of-function mutations in the SLC12A1 gene coding for the Na+-K+-2Cl- cotransporter NKCC2. We recently established the mutant mouse line Slc12a1I299F exhibiting kidney defects highly similar to the late-onset manifestation of this hereditary human disease. Besides the kidney defects, low blood pressure and osteopenia were revealed in the homozygous mutant mice which were also described in humans. Beside its strong expression in the kidney, NKCC2 has been also shown to be expressed in other tissues in rodents i.e. the gastrointestinal tract, pancreatic beta cells, and specific compartments of the ear, nasal tissue and eye. To examine if, besides kidney defects, further organ systems and/or metabolic pathways are affected by the Slc12a1I299F mutation as primary or secondary effects, we describe a standardized, systemic phenotypic analysis of the mutant mouse line Slc12a1I299F in the German Mouse Clinic. Slc12a1I299F homozygous mutant mice and Slc12a1I299F heterozygous mutant littermates as controls were tested at the age of 4-6 months. Beside the already published changes in blood pressure and bone metabolism, a significantly lower body weight and fat content were found as new phenotypes for Slc12a1I299F homozygous mutant mice. Small additional effects included a mild erythropenic anemia in homozygous mutant males as well as a slight hyperalgesia in homozygous mutant females. For other functions, such as immunology, lung function and neurology, no distinct alterations were observed. In this systemic analysis no clear primary effects of the Slc12a1I299F mutation appeared for the organs other than the kidneys where Slc12a1 expression has been described. On the other hand, long-term effects additional and/or secondary to the kidney lesions might also appear in humans harboring SLC12A1 mutations.

  4. Multi-channel pulser for the SLC thermionic electron source

    Energy Technology Data Exchange (ETDEWEB)

    Browne, M.J.; Clendenin, J.E.; Corredoura, P.L.; Jobe, R.K.; Koontz, R.F.; Sodja, J.

    1985-01-01

    A new pulser developed for the SLC thermionic gun has been operational since September 1984. It consists of two planar triode amplifiers with a common output triode driving the gun cathode to produce two independent pulses of up to 9A with a 3 nsec FWHM pulse width. Three long-pulse amplifiers are also connected to the cathode to produce pulses with widths controllable between 100 nsec and 1.6 ..mu..sec. Each amplifier has independent timing and amplitude control through a fiber optic link to the high voltage plane of the gun cathode-grid structure. The pulser and its operating characteristics are described. 15 refs., 3 figs.

  5. SLC26A4 gene copy number variations in Chinese patients with non-syndromic enlarged vestibular aqueduct

    Directory of Open Access Journals (Sweden)

    Zhao Jiandong

    2012-05-01

    Full Text Available Abstract Background Many patients with enlarged vestibular aqueduct (EVA have either only one allelic mutant of the SLC26A4 gene or lack any detectable mutation. In this study, multiplex ligation-dependent probe amplification (MLPA was used to screen for copy number variations (CNVs of SLC26A4 and to reveal the pathogenic mechanisms of non-syndromic EVA (NSEVA. Methods Between January 2003 and March 2010, 923 Chinese patients (481 males, 442 females with NSEVA were recruited. Among these, 68 patients (7.4% were found to carry only one mutant allele of SLC26A4 and 39 patients (4.2% lacked any detectable mutation in SLC26A4; these 107 patients without double mutant alleles were assigned to the patient group. Possible copy number variations in SLC26A4 were detected by SALSA MLPA. Results Using GeneMapper, no significant difference was observed between the groups, as compared with the standard probe provided in the assay. The results of the capillary electrophoresis showed no significant difference between the patients and controls. Conclusion Our results suggest that CNVs and the exon deletion in SLC26A4 are not important factors in NSEVA. However, it would be premature to conclude that CNVs have no role in EVA. Genome-wide studies to explore CNVs within non-coding regions of the SLC26A4 gene and neighboring regions are warranted, to elucidate their roles in NSEVA etiology.

  6. Hysteretic Current Controlled Zvs Dc/Dc Converter For Automobile

    DEFF Research Database (Denmark)

    Cernat, M.; Scortarul, P.; Tanase, A.

    2007-01-01

    A novel bi-directional dc-dc converter with ZVS and interleaving for dual voltage systems in automobiles is presented. A variable frequency extended band hysteretic current control method is proposed. In comparison with classical fixed frequency current control PWM, the reverse polarity peak curr...

  7. An optimal current observer for predictive current controlled buck DC-DC converters.

    Science.gov (United States)

    Min, Run; Chen, Chen; Zhang, Xiaodong; Zou, Xuecheng; Tong, Qiaoling; Zhang, Qiao

    2014-05-19

    In digital current mode controlled DC-DC converters, conventional current sensors might not provide isolation at a minimized price, power loss and size. Therefore, a current observer which can be realized based on the digital circuit itself, is a possible substitute. However, the observed current may diverge due to the parasitic resistors and the forward conduction voltage of the diode. Moreover, the divergence of the observed current will cause steady state errors in the output voltage. In this paper, an optimal current observer is proposed. It achieves the highest observation accuracy by compensating for all the known parasitic parameters. By employing the optimal current observer-based predictive current controller, a buck converter is implemented. The converter has a convergently and accurately observed inductor current, and shows preferable transient response than the conventional voltage mode controlled converter. Besides, costs, power loss and size are minimized since the strategy requires no additional hardware for current sensing. The effectiveness of the proposed optimal current observer is demonstrated experimentally.

  8. Controlling ultrafast currents by the non-linear photogalvanic effect

    CERN Document Server

    Wachter, Georg; Lemell, Christoph; Tong, Xiao-Min; Yabana, Kazuhiro; Burgdörfer, Joachim

    2015-01-01

    We theoretically investigate the effect of broken inversion symmetry on the generation and control of ultrafast currents in a transparent dielectric (SiO2) by strong femto-second optical laser pulses. Ab-initio simulations based on time-dependent density functional theory predict ultrafast DC currents that can be viewed as a non-linear photogalvanic effect. Most surprisingly, the direction of the current undergoes a sudden reversal above a critical threshold value of laser intensity I_c ~ 3.8*10^13 W/cm2. We trace this switching to the transition from non-linear polarization currents to the tunneling excitation regime. We demonstrate control of the ultrafast currents by the time delay between two laser pulses. We find the ultrafast current control by the non-linear photogalvanic effect to be remarkably robust and insensitive to laser-pulse shape and carrier-envelope phase.

  9. Stimulation of the amino acid transporter SLC6A19 by JAK2

    Energy Technology Data Exchange (ETDEWEB)

    Bhavsar, Shefalee K.; Hosseinzadeh, Zohreh; Merches, Katja; Gu, Shuchen [Department of Physiology I, University of Tuebingen (Germany); Broeer, Stefan [Research School of Biology, Australian National University (Australia); Lang, Florian, E-mail: florian.lang@uni-tuebingen.de [Department of Physiology I, University of Tuebingen (Germany)

    2011-10-28

    Highlights: Black-Right-Pointing-Pointer The amino acid transporter SLC6A19 is upregulated by Janus kinase-2 JAK2. Black-Right-Pointing-Pointer The {sup V617F}JAK2 mutant, causing myeloproliferative disease, is more effective. Black-Right-Pointing-Pointer JAK2 inhibitor AG490 reverses stimulation of SLC6A19 by {sup V617F}JAK2. Black-Right-Pointing-Pointer JAK2 enhances SLC6A19 protein insertion into the cell membrane. Black-Right-Pointing-Pointer SLC6A19 may contribute to amino acid uptake into {sup V617F}JAK2 expressing tumor cells. -- Abstract: JAK2 (Janus kinase-2) is expressed in a wide variety of cells including tumor cells and contributes to the proliferation and survival of those cells. The gain of function mutation {sup V617F}JAK2 mutant is found in the majority of myeloproliferative diseases. Cell proliferation depends on the availability of amino acids. Concentrative cellular amino acid uptake is in part accomplished by Na{sup +} coupled amino acid transport through SLC6A19 (B(0)AT). The present study thus explored whether JAK2 activates SLC6A19. To this end, SLC6A19 was expressed in Xenopus oocytes with or without wild type JAK2, {sup V617F}JAK2 or inactive {sup K882E}JAK2 and electrogenic amino acid transport determined by dual electrode voltage clamp. In SLC6A19-expressing oocytes but not in oocytes injected with water or JAK2 alone, the addition of leucine (2 mM) to the bath generated a current (I{sub le}), which was significantly increased following coexpression of JAK2 or {sup V617F}JAK2, but not by coexpression of {sup K882E}JAK2. Coexpression of JAK2 enhanced the maximal transport rate without significantly modifying the affinity of the carrier. Exposure of the oocytes to the JAK2 inhibitor AG490 (40 {mu}M) resulted in a gradual decline of I{sub le}. According to chemiluminescence JAK2 enhanced the carrier protein abundance in the cell membrane. The decline of I{sub le} following inhibition of carrier insertion by brefeldin A (5 {mu}M) was similar

  10. Discrete-Time LPV Current Control of an Induction Motor

    DEFF Research Database (Denmark)

    Bendtsen, Jan Dimon; Trangbæk, Klaus

    2003-01-01

    further complications. The synthesis method is applied to the model, yielding an LPV discrete-time controller. Finally, the efficiency of the control scheme is validated via simulations as well as on the actual induction motor, both in open-loop current control and when an outer speed control loop......In this paper we apply a new method for gain-scheduled output feedback control of nonlinear systems to current control of an induction motor. The method relies on recently developed controller synthesis results for linear parameter-varying (LPV) systems, where the controller synthesis is formulated...... as a set of linear matrix inequalities with full-block multipliers. A standard nonlinear model of the motor is constructed and written on LPV form. We then show that, although originally developed in continuous time, the controller synthesis results can be applied to a discrete-time model as well without...

  11. Discrete-Time LPV Current Control of an Induction Motor

    DEFF Research Database (Denmark)

    Bendtsen, Jan Dimon; Trangbæk, Klaus

    2003-01-01

    In this paper we apply a new method for gain-scheduled output feedback control of nonlinear systems to current control of an induction motor. The method relies on recently developed controller synthesis results for linear parameter-varying (LPV) systems, where the controller synthesis is formulated...... as a set of linear matrix inequalities with full-block multipliers. A standard nonlinear model of the motor is constructed and written on LPV form. We then show that, although originally developed in continuous time, the controller synthesis results can be applied to a discrete-time model as well without...... further complications. The synthesis method is applied to the model, yielding an LPV discrete-time controller. Finally, the efficiency of the control scheme is validated via simulations as well as on the actual induction motor, both in open-loop current control and when an outer speed control loop...

  12. Adaptive Current Control Method for Hybrid Active Power Filter

    Science.gov (United States)

    Chau, Minh Thuyen

    2016-09-01

    This paper proposes an adaptive current control method for Hybrid Active Power Filter (HAPF). It consists of a fuzzy-neural controller, identification and prediction model and cost function. The fuzzy-neural controller parameters are adjusted according to the cost function minimum criteria. For this reason, the proposed control method has a capability on-line control clings to variation of the load harmonic currents. Compared to the single fuzzy logic control method, the proposed control method shows the advantages of better dynamic response, compensation error in steady-state is smaller, able to online control is better and harmonics cancelling is more effective. Simulation and experimental results have demonstrated the effectiveness of the proposed control method.

  13. Momentum slits, collimators and masks in the SLC

    Energy Technology Data Exchange (ETDEWEB)

    Walz, D.R.; McFarlane, A.; Lewandowski, E.; Zabdyr, J.

    1989-04-01

    The high specific power densities in the SLC give rise to a multitude of challenging problems in collimation and momentum analysis, beam containment, machine protection and background control. The results of an extensive program to develop most of the devices deemed necessary for operation of the arcs matching sections and the final focus region are presented. Emphasis is placed on materials selection and on unique features of remotely adjustable slits and halo clipper collimators which have to operate with great precision in a high-radiation, ultra-high vacuum environment. Also covered are solutions for a few fixed aperture machine protection collimators. 7 refs., 5 figs.

  14. Improved Four-Switch BLDCM Direct Current Control

    Directory of Open Access Journals (Sweden)

    Pan Lei

    2013-08-01

    Full Text Available The main purpose of this study is to describe a low cost four-switch brushless dc motor (BLDCM drive. An improved direct current controlled scheme is designed and implemented to produce the desired dynamic and static current and speed characteristics. Eight voltage vectors are summarized, which are selected to control BLDCM in SVPWM pattern. This method avoids the undesired current distortion which is caused by uncontrollable phase. The operational principle of the four-switch BLDC motor drive and the developed control scheme are theoretically analyzed and the performance is demonstrated by both simulation and experimental results.

  15. Eddy current quality control of soldered current-carrying busbar splices of superconducting magnets

    CERN Document Server

    Kogan, L; Savary, F; Principe, R; Datskov, V; Rozenfel'd, E; Khudjakov, B

    2015-01-01

    The eddy current technique associated with a U-shaped transducer is studied for the quality control of soldered joints between superconducting busbars ('splices'). Two other quality control techniques, based on X-rays and direct measurement of the electrical resistance, are also studied for comparison. A comparative analysis of the advantages and disadvantages of these three methods in relation to the quality control of soldered superconducting busbar cables enclosed in copper shells is used for benchmarking. The results of inspections with the U-shaped eddy current transducer carried out on several sample joints presenting different types of soldering defects show the potential of this type of nondestructive (ND) quality control technique.

  16. SLC30A9 mutation affecting intracellular zinc homeostasis causes a novel cerebro-renal syndrome.

    Science.gov (United States)

    Perez, Yonatan; Shorer, Zamir; Liani-Leibson, Keren; Chabosseau, Pauline; Kadir, Rotem; Volodarsky, Michael; Halperin, Daniel; Barber-Zucker, Shiran; Shalev, Hanna; Schreiber, Ruth; Gradstein, Libe; Gurevich, Evgenia; Zarivach, Raz; Rutter, Guy A; Landau, Daniel; Birk, Ohad S

    2017-02-09

    A novel autosomal recessive cerebro-renal syndrome was identified in consanguineous Bedouin kindred: neurological deterioration was evident as of early age, progressing into severe intellectual disability, profound ataxia, camptocormia and oculomotor apraxia. Brain MRI was normal. Four of the six affected individuals also had early-onset nephropathy with features of tubulo-interstitial nephritis, hypertension and tendency for hyperkalemia, though none had rapid deterioration of renal function. Genome wide linkage analysis identified an ∼18 Mb disease-associated locus on chromosome 4 (maximal logarithm of odds score 4.4 at D4S2971; θ = 0). Whole exome sequencing identified a single mutation in SLC30A9 within this locus, segregating as expected within the kindred and not found in a homozygous state in 300 Bedouin controls. We showed that SLC30A9 (solute carrier family 30 member 9; also known as ZnT-9) is ubiquitously expressed with high levels in cerebellum, skeletal muscle, thymus and kidney. Confocal analysis of SH-SY5Y cells overexpressing SLC30A9 fused to enhanced green fluorescent protein demonstrated vesicular cytosolic localization associated with the endoplasmic reticulum, not co-localizing with endosomal or Golgi markers. SLC30A9 encodes a putative zinc transporter (by similarity) previously associated with Wnt signalling. However, using dual-luciferase reporter assay in SH-SY5Y cells we showed that Wnt signalling was not affected by the mutation. Based on protein modelling, the identified mutation is expected to affect SLC30A9's highly conserved cation efflux domain, putatively disrupting its transmembrane helix structure. Cytosolic Zn2+ measurements in HEK293 cells overexpressing wild-type and mutant SLC30A9 showed lower zinc concentration within mutant rather than wild-type SLC30A9 cells. This suggests that SLC30A9 has zinc transport properties affecting intracellular zinc homeostasis, and that the molecular mechanism of the disease is through

  17. Discrete-Time LPV Current Control of an Induction Motor

    DEFF Research Database (Denmark)

    Bendtsen, Jan Dimon; Trangbæk, Klaus

    2001-01-01

    In this paper we apply a new method for gain-scheduled output feedback control of nonlinear systems to current control of an induction motor. The method relies on recently developed controller synthesis results for linear parameter-varying (LPV) systems, where the controller synthesis is formulated...... as a set of linear matrix inequalities with full-block multipliers. A standard nonlinear model of the motor is then constructed and written on LPV form. We then show that, although originally developed in continuous time, the controller synthesis results can be applied to a discrete-time model as well...... without further complications. The synthesis method is applied to the model, yielding an LPV discrete-time controller. Finally, the efficiency of the control scheme is validated via simulations as well as experimentally on the actual induction motor, both in open-loop current control and when an outer...

  18. Evaluation of Current Controllers for Distributed Power Generation Systems

    DEFF Research Database (Denmark)

    Timbus, Adrian; Liserre, Marco; Teodorescu, Remus

    2009-01-01

    This paper discusses the evaluation of different current controllers employed for grid-connected distributed power generation systems having variable input power, such as wind turbines and photovoltaic systems. The focus is mainly set on linear controllers such as proportional....... First, in steady-state conditions, the contribution of controllers to the total harmonic distortion of the grid current is pursued. Further on, the behavior of controllers in the case of transient conditions like input power variations and grid voltage faults is also examined. Experimental results...

  19. Discrete Current Control Strategy of Permanent Magnet Synchronous Motors

    Directory of Open Access Journals (Sweden)

    Yan Dong

    2013-01-01

    Full Text Available A control strategy of permanent magnet synchronous motors (PMSMs, which is different from the traditional vector control (VC and direct torque control (DTC, is proposed. Firstly, the circular rotating magnetic field is analyzed on the simplified model and discredited into stepping magnetic field. The stepping magnetomotive force will drive the rotor to run as the stepping motor. Secondly, the stator current orientation is used to build the control model instead of rotor flux orientation. Then, the discrete current control strategy is set and adopted in positioning control. Three methods of the strategy are simulated in computer and tested on the experiment platform of PMSM. The control precision is also verified through the experiment.

  20. Regulators of Slc4 bicarbonate transporter activity

    Directory of Open Access Journals (Sweden)

    Ian M. Thornell

    2015-06-01

    Full Text Available The Slc4 family of transporters is comprised of anion exchangers (AE1-4, Na-coupled bicarbonate transporters (NCBTs including electrogenic Na/bicarbonate cotransporters (NBCe1 and NBCe2, electroneutral Na/bicarbonate cotransporters (NBCn1 and NBCn2, and the electroneutral Na-driven Cl-bicarbonate exchanger (NDCBE, as well as a borate transporter (BTR1. These transporters regulate intracellular pH (pHi and contribute to steady-state pHi, but are also involved in other physiological processes including CO2 carriage by red blood cells and solute secretion/reabsorption across epithelia. Acid-base transporters function as either acid extruders or acid loaders, with the Slc4 proteins moving HCO3– either into or out of cells. According to results from both molecular and functional studies, multiple Slc4 proteins and/or associated splice variants with similar expected effects on pHi are often found in the same tissue or cell. Such apparent redundancy is likely to be physiologically important. In addition to regulating pHi, a HCO3– transporter contributes to a cell’s ability to fine tune the intracellular regulation of the cotransported/exchanged ion(s (e.g., Na+ or Cl–. In addition, functionally similar transporters or splice variants with different regulatory profiles will optimize pH physiology and solute transport under various conditions or within subcellular domains. Such optimization will depend on activated signaling pathways and transporter expression profiles. In this review, we will summarize and discuss both classical and more recently identified regulators of the Slc4 proteins. Some of these regulators include traditional second messengers, lipids, binding proteins, autoregulatory domains, and less conventional regulators. The material presented will provide insight into the diversity and physiological significance of multiple members within the Slc4 gene family.

  1. Na(+) dependent acid-base transporters in the choroid plexus; insights from slc4 and slc9 gene deletion studies.

    Science.gov (United States)

    Christensen, Henriette L; Nguyen, An T; Pedersen, Fredrik D; Damkier, Helle H

    2013-10-22

    The choroid plexus epithelium (CPE) is located in the ventricular system of the brain, where it secretes the majority of the cerebrospinal fluid (CSF) that fills the ventricular system and surrounds the central nervous system. The CPE is a highly vascularized single layer of cuboidal cells with an unsurpassed transepithelial water and solute transport rate. Several members of the slc4a family of bicarbonate transporters are expressed in the CPE. In the basolateral membrane the electroneutral Na(+) dependent Cl(-)/HCO3 (-) exchanger, NCBE (slc4a10) is expressed. In the luminal membrane, the electrogenic Na(+):HCO3 (-) cotransporter, NBCe2 (slc4a5) is expressed. The electroneutral Na(+):HCO3 (-) cotransporter, NBCn1 (slc4a7), has been located in both membranes. In addition to the bicarbonate transporters, the Na(+)/H(+) exchanger, NHE1 (slc9a1), is located in the luminal membrane of the CPE. Genetically modified mice targeting slc4a2, slc4a5, slc4a7, slc4a10, and slc9a1 have been generated. Deletion of slc4a5, 7 or 10, or slc9a1 has numerous impacts on CP function and structure in these mice. Removal of the transporters affects brain ventricle size (slc4a5 and slc4a10) and intracellular pH regulation (slc4a7 and slc4a10). In some instances, removal of the proteins from the CPE (slc4a5, 7, and 10) causes changes in abundance and localization of non-target transporters known to be involved in pH regulation and CSF secretion. The focus of this review is to combine the insights gathered from these knockout mice to highlight the impact of slc4 gene deletion on the CSF production and intracellular pH regulation resulting from the deletion of slc4a5, 7 and 10, and slc9a1. Furthermore, the review contains a comparison of the described human mutations of these genes to the findings in the knockout studies. Finally, the future perspective of utilizing these proteins as potential targets for the treatment of CSF disorders will be discussed.

  2. MODEL STUDY OF THE DOUBLE FED MACHINE WITH CURRENT CONTROL

    Directory of Open Access Journals (Sweden)

    A. S. Lyapin

    2016-07-01

    Full Text Available The paper deals with modeling results of the double fed induction machine with current control in the rotor circuit. We show the most promising applications of electric drives on the basis of the double fed induction machine and their advantages. We present and consider functional scheme of the electric drive on the basis of the double fed induction machine with current control. Equations are obtained for creation of such machine mathematical model. Expressions for vector projections of rotor current are given. According to the obtained results, the change of the vector projections of rotor current ensures operation of the double fed induction machine with the specified values of active and reactive stator power throughout the variation range of sliding motion. We consider static characteristics of double fed machine with current control. Energy processes proceeding in the machine are analyzed. We confirm the operationpossibility of double fed induction machine with current controlin the rotor circuit with given values of active and reactive stator power. The presented results can be used for creation of mathematical models and static characteristics of double fed machines with current control of various capacities.

  3. The astrocytic transporter SLC7A10 (Asc-1) mediates glycinergic inhibition of spinal cord motor neurons

    Science.gov (United States)

    Ehmsen, Jeffrey T.; Liu, Yong; Wang, Yue; Paladugu, Nikhil; Johnson, Anna E.; Rothstein, Jeffrey D.; du Lac, Sascha; Mattson, Mark P.; Höke, Ahmet

    2016-01-01

    SLC7A10 (Asc-1) is a sodium-independent amino acid transporter known to facilitate transport of a number of amino acids including glycine, L-serine, L-alanine, and L-cysteine, as well as their D-enantiomers. It has been described as a neuronal transporter with a primary role related to modulation of excitatory glutamatergic neurotransmission. We find that SLC7A10 is substantially enriched in a subset of astrocytes of the caudal brain and spinal cord in a distribution corresponding with high densities of glycinergic inhibitory synapses. Accordingly, we find that spinal cord glycine levels are significantly reduced in Slc7a10-null mice and spontaneous glycinergic postsynaptic currents in motor neurons show substantially diminished amplitudes, demonstrating an essential role for SLC7A10 in glycinergic inhibitory function in the central nervous system. These observations establish the etiology of sustained myoclonus (sudden involuntary muscle movements) and early postnatal lethality characteristic of Slc7a10-null mice, and implicate SLC7A10 as a candidate gene and auto-antibody target in human hyperekplexia and stiff person syndrome, respectively. PMID:27759100

  4. Controlling ultrafast currents by the nonlinear photogalvanic effect

    Science.gov (United States)

    Wachter, Georg; Sato, Shunsuke A.; Floss, Isabella; Lemell, Christoph; Tong, Xiao-Min; Yabana, Kazuhiro; Burgdörfer, Joachim

    2015-12-01

    We investigate the effect of broken inversion symmetry on the generation and control of ultrafast currents in a transparent dielectric (SiO2) by strong femtosecond optical laser pulses. Ab initio simulations based on time-dependent density functional theory predict ultrafast direct currents that can be viewed as a nonlinear photogalvanic effect. Most surprisingly, the direction of the current undergoes a sudden reversal above a critical threshold value of laser intensity of about {I}{{c}}˜ 3× {10}13 W cm-2. We trace this switching to the transition from nonlinear polarisation currents to the tunnelling excitation regime. The latter is found to be sensitive to the relative orientation between laser polarisation and chemical bonds. We demonstrate control of the ultrafast currents by the time delay between two laser pulses. While two temporally separated laser pulses lead to currents along one direction their temporal overlap can reverse the current. We find the ultrafast current control by the nonlinear photogalvanic effect to be remarkably robust and insensitive to the laser-pulse shape and the carrier-envelope phase.

  5. Designed patterns: flexible control of precipitation through electric currents.

    Science.gov (United States)

    Bena, I; Droz, M; Lagzi, I; Martens, K; Rácz, Z; Volford, A

    2008-08-15

    Understanding and controlling precipitation patterns formed in reaction-diffusion processes is of fundamental importance with high potential for technical applications. Here we present a theory showing that precipitation resulting from reactions among charged agents can be controlled by an appropriately designed, time-dependent electric current. Examples of current dynamics yielding periodic bands of prescribed wavelength, as well as more complicated structures are given. The pattern control is demonstrated experimentally using the reaction-diffusion process 2AgNO3 + K2Cr2O7-->under Ag2Cr2O7 + 2KNO3.

  6. Discrete-Time LPV Current Control of an Induction Motor

    DEFF Research Database (Denmark)

    Bendtsen, Jan Dimon; Trangbæk, Klaus

    2003-01-01

    In this paper we apply a new method for gain-scheduled output feedback control of nonlinear systems to current control of an induction motor. The method relies on recently developed controller synthesis results for linear parameter-varying (LPV) systems, where the controller synthesis is formulated...... as a set of linear matrix inequalities with full-block multipliers. A standard nonlinear model of the motor is constructed and written on LPV form. We then show that, although originally developed in continuous time, the controller synthesis results can be applied to a discrete-time model as well without...

  7. Missense mutation in exon 2 of SLC36A1 responsible for champagne dilution in horses.

    Directory of Open Access Journals (Sweden)

    Deborah Cook

    2008-09-01

    Full Text Available Champagne coat color in horses is controlled by a single, autosomal-dominant gene (CH. The phenotype produced by this gene is valued by many horse breeders, but can be difficult to distinguish from the effect produced by the Cream coat color dilution gene (CR. Three sires and their families segregating for CH were tested by genome scanning with microsatellite markers. The CH gene was mapped within a 6 cM region on horse chromosome 14 (LOD = 11.74 for theta = 0.00. Four candidate genes were identified within the region, namely SPARC [Secreted protein, acidic, cysteine-rich (osteonectin], SLC36A1 (Solute Carrier 36 family A1, SLC36A2 (Solute Carrier 36 family A2, and SLC36A3 (Solute Carrier 36 family A3. SLC36A3 was not expressed in skin tissue and therefore not considered further. The other three genes were sequenced in homozygotes for CH and homozygotes for the absence of the dilution allele (ch. SLC36A1 had a nucleotide substitution in exon 2 for horses with the champagne phenotype, which resulted in a transition from a threonine amino acid to an arginine amino acid (T63R. The association of the single nucleotide polymorphism (SNP with the champagne dilution phenotype was complete, as determined by the presence of the nucleotide variant among all 85 horses with the champagne dilution phenotype and its absence among all 97 horses without the champagne phenotype. This is the first description of a phenotype associated with the SLC36A1 gene.

  8. Hysteresis Current Control of Switched Reluctance Motor in Aircraft Applications

    Directory of Open Access Journals (Sweden)

    Maged N. F. Nashed

    2014-05-01

    Full Text Available The switched reluctance motor (SRM drives have been widely used in aircraft applications due to the motor advantages like high speed operation, simple construction, no windings on rotor. But high torque ripples and acoustic noise are main disadvantages. The current hysteresis chopping control is one of the important control methods for SRM drives. These disadvantages can be limited using the hysteresis or chopping current control. This control strategy makes the torque of SRM maintained within a set of hysteresis bands by applying suitable source voltage. This paper introduces two hysteresis control modes; hard chopping and soft chopping mode. The SRM drive system is modeled in Simulink model using MATLAB/SIMULINK software package.

  9. Adaptive Current Control with PI-Fuzzy Compound Controller for Shunt Active Power Filter

    Directory of Open Access Journals (Sweden)

    Juntao Fei

    2013-01-01

    Full Text Available An adaptive control technology and PI-fuzzy compound control technology are proposed to control an active power filter (APF. AC side current compensation and DC capacitor voltage tracking control strategy are discussed and analyzed. Model reference adaptive controller for the AC side current compensation is derived and established based on Lyapunov stability theory; proportional and integral (PI fuzzy compound controller is designed for the DC side capacitor voltage control. The adaptive current controller based on PI-fuzzy compound system is compared with the conventional PI controller for active power filter. Simulation results demonstrate the feasibility and satisfactory performance of the proposed control strategies. It is shown that the proposed control method has an excellent dynamic performance such as small current tracking error, reduced total harmonic distortion (THD, and strong robustness in the presence of parameters variation and nonlinear load.

  10. The density matrix picture of laser coherent control current

    Institute of Scientific and Technical Information of China (English)

    SHOU Qian; ZHANG Haichao; LIU Luning; LIN Weizhu

    2004-01-01

    The physical substance of the coherent control current and the optical rectification have been analyzed based on density matrix perturbation theory. The analytical results demonstrate that they arise from the real and virtual manifestations of the same nonlinear process associated with diagonal and non-diagonal density matrix.And in terms of polarization, they respectively arise from the intraband and interband polarizations. Both the evolution of the coherent control current exited by ultrafast laser pulse and its dependence on frequency have been studied in time and frequency domains. In order to get an explicit knowledge of intraband polarization and the origination of the coherent control current, we have investigated the initial photo-carriers momentum distribution. The ultrafast decay of the polar momentum population in order of tens of femtosends is given to illustrate its instantaneous optical response.

  11. Design of a Novel Current Balanced Voltage Controlled Delay Element

    Directory of Open Access Journals (Sweden)

    Pooja Saxena

    2014-04-01

    Full Text Available This paper presents a design of fast voltage controlled delay element based on modified version of low noise Current Balanced Logic (CBL. This delay element provides identical rising and falling edge delays controlled by the single control voltage. The post layout tunable delay range is from 140 ps to 800 ps over control voltage range of 0 to 2.1 V. An analysis for the delay element is also presented, which is in agreement with the simulated delays. A Delay Lock Loop (DLL is designed using this delay element to verify its performance.

  12. Generalized space vector control for current source inverters and rectifiers

    Directory of Open Access Journals (Sweden)

    Roseline J. Anitha

    2016-06-01

    Full Text Available Current source inverters (CSI is one of the widely used converter topology in medium voltage drive applications due to its simplicity, motor friendly waveforms and reliable short circuit protection. The current source inverters are usually fed by controlled current source rectifiers (CSR with a large inductor to provide a constant supply current. A generalized control applicable for both CSI and CSR and their extension namely current source multilevel inverters (CSMLI are dealt in this paper. As space vector pulse width modulation (SVPWM features the advantages of flexible control, faster dynamic response, better DC utilization and easy digital implementation it is considered for this work. This paper generalizes SVPWM that could be applied for CSI, CSR and CSMLI. The intense computation involved in framing a generalized space vector control are discussed in detail. The algorithm includes determination of band, region, subregions and vectors. The algorithm is validated by simulation using MATLAB /SIMULINK for CSR 5, 7, 13 level CSMLI and for CSR fed CSI.

  13. Controllability of driven current profile in ECCD on ITER

    Energy Technology Data Exchange (ETDEWEB)

    Hamamatsu, K.; Fukuyama, A

    2001-01-01

    The controllability of current profile driven by the fundamental resonance of the O-mode wave is examined for the parameters of the Intermediate Aspect ratio Machine option of the International Thermonuclear Experimental Reactor (ITER). The driven current is numerically evaluated by using the full relativistic adjoint method which we have extended from the non-relativistic one. By changing both the toroidal and poloidal injection angles, the optimum direction to drive a current with maximum current density at the aimed position is obtained. The position of wave launching affects the optimum injection angles and the driven current profile. The dependence of driven current profile on beam divergence is also examined. When the beam is injected from the equatorial plane, the maximum current density is reduced and the width of current profile becomes wide in the outer region of r{>=}0.5a. The localized current profile is kept well within the region of r{>=}0.4a by injection from a location away from the equatorial plane.

  14. Dynamics and stabilization of peak current-mode controlled buck converter with constant current load

    Institute of Scientific and Technical Information of China (English)

    冷敏瑞; 周国华; 张凯暾; 李振华

    2015-01-01

    The discrete iterative map model of peak current-mode controlled buck converter with constant current load (CCL), containing the output voltage feedback and ramp compensation, is established in this paper. Based on this model the com-plex dynamics of this converter is investigated by analyzing bifurcation diagrams and the Lyapunov exponent spectrum. The effects of ramp compensation and output voltage feedback on the stability of the converter are investigated. Experimental results verify the simulation and theoretical analysis. The stability boundary and chaos boundary are obtained under the theoretical conditions of period-doubling bifurcation and border collision. It is found that there are four operation regions in the peak current-mode controlled buck converter with CCL due to period-doubling bifurcation and border-collision bifur-cation. Research results indicate that ramp compensation can extend the stable operation range and transfer the operating mode, and output voltage feedback can eventually eliminate the coexisting fast-slow scale instability.

  15. Power electronic converters PWM strategies and current control techniques

    CERN Document Server

    Monmasson, Eric

    2013-01-01

    A voltage converter changes the voltage of an electrical power source and is usually combined with other components to create a power supply. This title is devoted to the control of static converters, which deals with pulse-width modulation (PWM) techniques, and also discusses methods for current control. Various application cases are treated. The book is ideal for professionals in power engineering, power electronics, and electric drives industries, as well as practicing engineers, university professors, postdoctoral fellows, and graduate students.

  16. Large Antenna Control Methods: Current Status and Future Trends

    Science.gov (United States)

    Rodriguez, G.; Lin, Y. H.; Milman, M. H.

    1985-01-01

    Current methods for control of large antennas, as well as future trends required for improved performance are addressed. Some of the target missions in which these methods would be used are: the Land Mobile Satellite System (LMSS) for communications; the Satellite Surveillance (SSS) for aircraft traffic control; the orbiting Very Long Baseline Interferometer (VLBI), or QUASAT, for radio astronomy; and the Large Deployable Reflector (LDR) for IR and submillimeter astronomy.

  17. Optimal control of stochastic magnetization dynamics by spin current

    Science.gov (United States)

    Wang, Yong; Zhang, Fu-Chun

    2013-05-01

    Fluctuation-induced stochastic magnetization dynamics plays an important role in spintronics devices. Here we propose that it can be optimally controlled by spin currents to minimize or maximize the Freidlin-Wentzell action functional of the system hence to increase or decrease the probability of the large fluctuations. We apply this method to study the thermally activated magnetization switching problem and to demonstrate the merits of the optimal control strategy.

  18. Prevalence of SLC22A4, SLC22A5 and CARD15 gene mutations in Hungarian pediatric patients with Crohn's disease

    Institute of Scientific and Technical Information of China (English)

    Judit Bene; Lili Magyari; Gábor Talián; Katalin Komlósi; Beáta Gasztonyi; Beáta Tari; (A)gnes Várkonyi; Gyula Mózsik; Béla Melegh

    2006-01-01

    AIM: To investigate the frequency of the common NOD2/CARD15 susceptibility variants and two functional polymorphisms of OCTN cation transporter genes inHungarian pediatric patients with Crohn's disease (CD).METHODS: A cohort of 19 unrelated pediatric and 55 unrelated adult patients with Crohn's disease and 49 healthy controls were studied. Genotyping of the threecommon CD-associated CARD15 variants (Arg702Trp, Gly908Arg and 1007finsC changes) with the SLC22A4 1672C→T, and SLC22A5 -207G→C mutations was performed by direct sequencing of the specific regions of these genes.RESULTS: At least one CARD15 mutation was present in 52.6% of the children and in 34.5% of the adults compared to 14.3% in controls. Surprisingly, strongly different mutation profile was detected in the pediatric versus adult patients. While the G908R and 1007finsC variants were 18.4% and 21.1% in the pediatric group, they were 1.82% and 11.8% in the adults, and were 1.02% and 3.06% in the controls, respectively. The R702W allele was increased approximately two-fold in the adult subjects, while in the pediatric group it was only approximately 64% of the controls (9.09% in the adults, 2.63% in pediatric patients, and 4.08% in the controls). No accumulation of the OCTN variants was observed in any patient group versus the controls. CONCLUSION: The frequency of the NOD2/CARD15susceptibility variants in the Hungarian pediatric CD population is high and the profile differs from the adult CD patients, whereas the results for SLC22A4 and SLC22A5 mutation screening do not confirm the assumption that the carriage of these genotypes means an obligatory susceptibility to CD.

  19. Brushless DC motor Drive during Speed regulation with Current Controller

    Directory of Open Access Journals (Sweden)

    Bhikshalu Manchala

    2015-04-01

    Full Text Available Brushless DC Motor (BLDC is one of the best electrical drives that have increasing popularity, due to their high efficiency, reliability, good dynamic response and very low maintenance. Due to the increasing demand for compact & reliable motors and the evolution of low cost power semiconductor switches and permanent magnet (PM materials, brushless DC motors become popular in every application from home appliances to aerospace industry. The conventional techniques for controlling the stator phase current in a brushless DC drive are practically effective in low speed and cannot reduce the commutation torque ripple in high speed range. This paper presents the PI controller for speed control of BLDC motor. The output of the PI controllers is summed and is given as the input to the current controller. The BLDC motor is fed from the inverter where the rotor position and current controller is the input. The complete model of the proposed drive system is developed and simulated using MATLAB/Simulink software. The operation principle of using component is analysed and the simulation results are presented in this to verify the theoretical analysis.

  20. Deficiency in the manganese efflux transporter SLC30A10 induces severe hypothyroidism in mice.

    Science.gov (United States)

    Hutchens, Steven; Liu, Chunyi; Jursa, Thomas; Shawlot, William; Chaffee, Beth K; Yin, Weiling; Gore, Andrea C; Aschner, Michael; Smith, Donald R; Mukhopadhyay, Somshuvra

    2017-06-09

    Manganese is an essential metal that becomes toxic at elevated levels. Loss-of-function mutations in SLC30A10, a cell-surface-localized manganese efflux transporter, cause a heritable manganese metabolism disorder resulting in elevated manganese levels and parkinsonian-like movement deficits. The underlying disease mechanisms are unclear; therefore, treatment is challenging. To understand the consequences of loss of SLC30A10 function at the organism level, we generated Slc30a10 knock-out mice. During early development, knock-outs were indistinguishable from controls. Surprisingly, however, after weaning and compared with controls, knock-out mice failed to gain weight, were smaller, and died prematurely (by ∼6-8 weeks of age). At 6 weeks, manganese levels in the brain, blood, and liver of the knock-outs were ∼20-60-fold higher than controls. Unexpectedly, histological analyses revealed that the brain and liver of the knock-outs were largely unaffected, but their thyroid exhibited extensive alterations. Because hypothyroidism leads to growth defects and premature death in mice, we assayed for changes in thyroid and pituitary hormones. At 6 weeks and compared with controls, the knock-outs had markedly reduced thyroxine levels (∼50-80%) and profoundly increased thyroid-stimulating hormone levels (∼800-1000-fold), indicating that Slc30a10 knock-out mice develop hypothyroidism. Importantly, a low-manganese diet produced lower tissue manganese levels in the knock-outs and rescued the phenotype, suggesting that manganese toxicity was the underlying cause. Our unanticipated discovery highlights the importance of determining the role of thyroid dysfunction in the onset and progression of manganese-induced disease and identifies Slc30a10 knock-out mice as a new model for studying thyroid biology. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  1. Investigation of SLC6A4 gene expression in autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Elif Funda Şener

    2015-06-01

    Full Text Available Objective: Autism is defined as a complex neurodevelopmental disorder. Genetics plays a major role in the etiology of autism spectrum disorders (ASD. The role of the serotonin in the development of autism has been widely investigated. SLC6A4 gene (SERT or 5-HT has an important role reuptaking of serotonin. Because of this, our study examined the expression level of SLC6A4 gene in autism patients. Methods: Thirty-four patients (26 male, 8 female who diagnosed as autism firstly according to DSM-V criteria in the Department of child psychiatry, Erciyes University Medical Faculty and healthy 23 controls (16 male, 7 female were enrolled in this study. Total RNA was isolated from peripheral blood samples using TRIzol. Quantitative Real-time PCR (qRT-PCR was performed to detect SLC6A4 gene expression. Results: SLC6A4 gene expression was found statistically significant and low in autism group compared with controls (p=0,027. Conclusion: The low gene expression in the patient group implied that there is an abnormality of serotonin reuptake. According to our results, we suggest that much more studies may be planned with the expression and methylation profile of this gene combined with gene polymorphisms especially affecting the expression in larger sample sizes. J Clin Exp Invest 2015; 6 (2: 165-169

  2. Control of bootstrap current in the pedestal region of tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Shaing, K. C. [Institute for Space and Plasma Sciences, National Cheng Kung University, Tainan City 70101, Taiwan (China); Department of Engineering Physics, University of Wisconsin, Madison, Wisconsin 53796 (United States); Lai, A. L. [Institute for Space and Plasma Sciences, National Cheng Kung University, Tainan City 70101, Taiwan (China)

    2013-12-15

    The high confinement mode (H-mode) plasmas in the pedestal region of tokamaks are characterized by steep gradient of the radial electric field, and sonic poloidal U{sub p,m} flow that consists of poloidal components of the E×B flow and the plasma flow velocity that is parallel to the magnetic field B. Here, E is the electric field. The bootstrap current that is important for the equilibrium, and stability of the pedestal of H-mode plasmas is shown to have an expression different from that in the conventional theory. In the limit where ‖U{sub p,m}‖≫ 1, the bootstrap current is driven by the electron temperature gradient and inductive electric field fundamentally different from that in the conventional theory. The bootstrap current in the pedestal region can be controlled through manipulating U{sub p,m} and the gradient of the radial electric. This, in turn, can control plasma stability such as edge-localized modes. Quantitative evaluations of various coefficients are shown to illustrate that the bootstrap current remains finite when ‖U{sub p,m}‖ approaches infinite and to provide indications how to control the bootstrap current. Approximate analytic expressions for viscous coefficients that join results in the banana and plateau-Pfirsch-Schluter regimes are presented to facilitate bootstrap and neoclassical transport simulations in the pedestal region.

  3. Missense mutations in SLC26A8, encoding a sperm-specific activator of CFTR, are associated with human asthenozoospermia.

    Science.gov (United States)

    Dirami, Thassadite; Rode, Baptiste; Jollivet, Mathilde; Da Silva, Nathalie; Escalier, Denise; Gaitch, Natacha; Norez, Caroline; Tuffery, Pierre; Wolf, Jean-Philippe; Becq, Frédéric; Ray, Pierre F; Dulioust, Emmanuel; Gacon, Gérard; Bienvenu, Thierry; Touré, Aminata

    2013-05-02

    The cystic fibrosis transmembrane conductance regulator (CFTR) is present in mature sperm and is required for sperm motility and capacitation. Both these processes are controlled by ions fluxes and are essential for fertilization. We have shown that SLC26A8, a sperm-specific member of the SLC26 family of anion exchangers, associates with the CFTR channel and strongly stimulates its activity. This suggests that the two proteins cooperate to regulate the anion fluxes required for correct sperm motility and capacitation. Here, we report on three heterozygous SLC26A8 missense mutations identified in a cohort of 146 men presenting with asthenozoospermia: c.260G>A (p.Arg87Gln), c.2434G>A (p.Glu812Lys), and c.2860C>T (p.Arg954Cys). These mutations were not present in 121 controls matched for ethnicity, and statistical analysis on a control population of 8,600 individuals (from dbSNP and 1000 Genomes) showed them to be associated with asthenozoospermia with a power > 95%. By cotransfecting Chinese hamster ovary (CHO)-K1 cells with SLC26A8 variants and CFTR, we showed that the physical interaction between the two proteins was partly conserved but that the capacity to activate CFTR-dependent anion transport was completely abolished for all mutants. Biochemical studies revealed the presence of much smaller amounts of protein for all variants, but these amounts were restored to wild-type levels upon treatment with the proteasome inhibitor MG132. Immunocytochemistry also showed the amounts of SLC26A8 in sperm to be abnormally small in individuals carrying the mutations. These mutations might therefore impair formation of the SLC26A8-CFTR complex, principally by affecting SLC26A8 stability, consistent with an impairment of CFTR-dependent sperm-activation events in affected individuals.

  4. SLC11A1 — EDRN Public Portal

    Science.gov (United States)

    SLC11A1 is a membrane associated divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. SLC11A1 is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family. Mutations in the SLC11A1 gene are involved in susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Several alternatively spliced variants have been identified.

  5. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  6. High performance current controller for particle accelerator magnets supply

    DEFF Research Database (Denmark)

    Maheshwari, Ram Krishan; Bidoggia, Benoit; Munk-Nielsen, Stig;

    2013-01-01

    The electromagnets in modern particle accelerators require high performance power supply whose output is required to track the current reference with a very high accuracy (down to 50 ppm). This demands very high bandwidth controller design. A converter based on buck converter topology is used in ...

  7. Real-time control for long ohmic alternate current discharges

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Ivo S., E-mail: ivoc@ipfn.ist.utl.pt; Duarte, Paulo; Fernandes, Horácio; Valcárcel, Daniel F.; Carvalho, Pedro J.; Silva, Carlos; Duarte, André S.; Neto, André; Sousa, Jorge; Batista, António J.N.; Hekkert, Tiago; Carvalho, Bernardo B.; Gomes, Rui B.

    2014-05-15

    Highlights: • 40 Alternate plasma current (AC) semi-cycles without loss of ionization, more than 1 s of operation. • AC discharges automatic control: feedback loops, time-windows control strategy, goal oriented time-windows and exception handling. • Energy deposition and Carbon radiation evolution during the AC discharges. - Abstract: The ISTTOK tokamak has a long tradition on alternate plasma current (AC) discharges, but the old control system was limiting and lacked full system integration. In order to improve the AC discharges performance the ISTTOK fast control system was updated. This control system developed on site based on the Advanced Telecommunications Computing Architecture (ATCA) standard now integrates the information gathered by all the tokamak real-time diagnostics to produce an accurate observation of the plasma parameters. The real-time actuators were also integrated, allowing a Multiple Input Multiple Output (MIMO) control environment with several synchronization strategies available. The control system software was developed in C++ on top of a Linux system with the Multi-threaded Application Real-Time executor (MARTe) Framework to synchronize the real-time code execution under a 100μs control cycle. In addition, to simplify the discharge programming, a visual Human–Machine Interface (HMI) was also developed using the BaseLib2 libraries included in the MARTe Framework. This paper presents the ISTTOK control system and the optimizations that extended the AC current discharges duration to more than 1 s, corresponding to 40 semi-cycles without apparent degradation of the plasma parameters. This upgrade allows ISTTOK to be used as a low-cost material testing facility with long time exposures to nuclear fusion relevant plasmas, comparable (in duration) with medium size tokamaks.

  8. Dynamic Feedback Controlling Chaos in Current-Mode Boost Converter

    Institute of Scientific and Technical Information of China (English)

    LU Wei-Guo; ZHOU Luo-Wei; LUO Quan-Ming

    2007-01-01

    A method for the control of chaos in the current-mode boost converter is presented by using the first-order dynamic feedback control. The feedback part consists of a resistance and a capacitance in series. The system to be controlled is treated as a third-order model, and then the discrete mapping model is obtained by using the data-sampling method. By analysing the position of the maximum norm eigenvalue, the stable range of feedback gain is ascertained out and its optimization is also carried out. Finally, the results of simulation and experiment confirm the correctness of the theoretical analysis and the validity of the proposed means.

  9. Development of a current-controlled defibrillator for clinical tests.

    Science.gov (United States)

    Fischer, M; Schönegg, M; Schöchlin, J; Bolz, A

    2002-01-01

    The work presented here is only a part of the development for a new current-controlled defibrillator. In the diploma thesis "Development and construction of a current-controlled defibrillator for clinical tests" the most important part was the control and safety of the defibrillator. To ensure a safe circuit design, a risk-analysis and a Failure Mode and Effects Analysis (FMEA) were necessary. Another major part was the programming of a microcontroller in embedded C and a programmable logic device in Very High Speed Integrated Circuit Description Language (VHDL). The circuit had to be constructed, and the defibrillator was optically decoupled from the laptop for safety reasons. The waveform-data can be transmitted to the microcontroller from the laptop, and the logged data is then transmitted back.

  10. Alternating Current All-electrical Gun Control System in Tanks

    Directory of Open Access Journals (Sweden)

    Zang Kemao

    2004-07-01

    Full Text Available The ac all-electrical gun control system is composed of permanent magnetic synchronous machine-drive control systems and the ball-screw by replacing the complicated electrohydraulic systems. At the same time, the variable-structure system with sliding modes makes the gun control systems to have higher performances using the only rate flexure gyroscope. Thereby, vehicle hull gyroscope and angular gyroscope are left out.The new ac all-electrical gun control systems developed are reduced by 40 per cent in weight, decreased by 30 per cent in volume, increased by 35 per cent in efficiency, and enhanced by three times in service life as compared to the current gun control systems.

  11. Investigation of the fatty acid transporter-encoding genes SLC27A3 and SLC27A4 in autism

    OpenAIRE

    Motoko Maekawa; Yoshimi Iwayama; Tetsuo Ohnishi; Manabu Toyoshima; Chie Shimamoto; Yasuko Hisano; Tomoko Toyota; Shabeesh Balan; Hideo Matsuzaki; Yasuhide Iwata; Shu Takagai; Kohei Yamada; Motonori Ota; Satoshi Fukuchi; Yohei Okada

    2015-01-01

    The solute carrier 27A (SLC27A) gene family encodes fatty acid transport proteins (FATPs) and includes 6 members. During fetal and postnatal periods of development, the growing brain requires a reliable supply of fatty acids. Because autism spectrum disorders (ASD) are now recognized as disorders caused by impaired early brain development, it is possible that functional abnormalities of SLC27A genes may contribute to the pathogenesis of ASD. Here, we confirmed the expression of SLC27A3 and SL...

  12. The bridge-type fault current controller--a new facts controller

    Energy Technology Data Exchange (ETDEWEB)

    Boenig, Heinrich J.; Mielke, C. H. (Charles H.); Burley, B. L. (Burt L.); Chen, Hong; Waynert, J. A. (Joseph A.); Willis, J. O. (Jeffrey O.)

    2002-01-01

    The operation of a novel current controller, which can also function as a fault current limiter and as a solid-state ac circuit breaker, is presented. The controller, which consists of a thyristor bridge, an inductor, and an optional bias power supply, is installed in series with the voltage source and the load, For load current values smaller than a preset value, the inductor of the current controller presents no impedance to the ac current flow. For values higher than the preset current value, the inductor is switched automatically into the ac circuit and limits the amount of current flow. Theoretical results in the form of circuit simulations and experimental results with a single-phase unit, operating on a 13.7 kV three-phase system with peak short-circuit currents of 3140 Arms, are presented.

  13. Stator Current Harmonic Control with Resonant Controller for Doubly Fed Induction Generator

    DEFF Research Database (Denmark)

    Liu, Changjin; Blaabjerg, Frede; Chen, Wenjie;

    2012-01-01

    Voltage harmonics in the grid can introduce stator current harmonics in a doubly fed induction generator (DFIG) wind turbine system, which may potentially impact the generated power quality. Therefore, wind turbine current controllers need to be designed to eliminate the impact of grid voltage...... rotor current control loop for harmonic suppression. The overall control scheme is implemented in dq frame. Based on a mathematical model of the DFIG control system, the effects on system stability using the resonant controller, an analysis of the steady-state error, and the dynamic performance...

  14. Advanced induction motor drive control with single current sensor

    Directory of Open Access Journals (Sweden)

    Adžić Evgenije M.

    2016-01-01

    Full Text Available This paper proposes induction motor drive control method which uses minimal number of sensors, providing only DC-link current as a feedback signal. Improved DC-link current sampling scheme and modified asymmetrical switching pattern cancels characteristic waveform errors which exist in all three reconstructed motor line-currents. Motor linecurrent harmonic content is reduced to an acceptable level, eliminating torque and speed oscillations which were inherent for conventional single sensor drives. Consequently, use of single current sensor and line-current reconstruction technique is no longer acceptable only for low and medium performance drives, but also for drives where priority is obtaining a highly accurate, stable and fast response. Proposed control algorithm is validated using induction motor drive hardware prototype based on TMS320F2812 digital signal processor. [Projekat Ministarstva nauke Republike Srbije, br. III 042004 and by the Provincial Secretariat for Science and Technological Development of AP Vojvodina under contract No. 114-451-3508/2013-04

  15. Control of optically induced currents in semiconductor crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kohli, Kapil Kumar

    2010-06-01

    The generation and control of optically induced currents has the potential to become an important building block for optical computers. Here, shift and rectification currents are investigated that emerge from a divergence of the optical susceptibility. It is known that these currents react to the shape of the impinging laser pulse, and especially to the shape of the pulse envelope. The main goal is the systematic manipulation of the pulse envelope with an optical pulse shaper that is integrated into a standard THz emission setup. The initial approach, the chirping of the laser pulse only has a weak influence on the envelope and the currents. Instead, a second approach is suggested that uses the combined envelope of a phase-stable pulse-pair as a parameter. In a laser pulse, the position of the maxima of the electrical field and the pulse envelope are shifted relative to each other. This shift is known as the Carrier-Envelope Phase (CEP). It is a new degree of freedom that is usually only accessible in specially stabilized systems. It is shown, that in a phase-stable pulse-pair, at least the relative CEP is usable as a new degree of freedom. It has a great influence on the shape of the pulse envelope and thus on the current density. It is shown that this approach enables the coherent control of the current density. The experiments are corroborated by a theoretical model of the system. The potential of this approach is demonstrated in an application. A framework is presented that uses an iterative genetic algorithm to create arbitrarily shaped THz traces. The algorithm controls the optical pulse shaper, and varies the phase of the impinging laser pulses until the desired target trace is found. (orig.)

  16. Active current control in wind power plants during grid faults

    DEFF Research Database (Denmark)

    Martinez, Jorge; Kjær, Phillip C.; Rodriguez, Pedro

    2010-01-01

    , wind turbines usually have solutions that enable the turbines to control the generation of reactive power during faults. This paper addresses the importance of using an optimal injection of active current during faults in order to fulfil these grid codes. This is of relevant importance for severe......Modern wind power plants are required and designed to ride through faults in electrical networks, subject to fault clearing. Wind turbine fault current contribution is required from most countries with a high amount of wind power penetration. In order to comply with such grid code requirements...

  17. Late-onset episodic ataxia associated with SLC1A3 mutation.

    Science.gov (United States)

    Choi, Kwang-Dong; Jen, Joanna C; Choi, Seo Young; Shin, Jin-Hong; Kim, Hyang-Sook; Kim, Hyo-Jung; Kim, Ji-Soo; Choi, Jae-Hwan

    2017-03-01

    Episodic ataxia type 6 (EA6) is caused by mutations in SLC1A3 that encodes excitatory amino acid transporter 1 (EAAT1), a glial glutamate transporter. EAAT1 regulates the extent and durations of glutamate-mediated signal by the clearance of glutamate after synaptic release. In addition, EAAT1 also has an anion channel activity that prevents additional glutamate release. We identified a missense mutation in SLC1A3 in a family with EA. The proband exhibited typical EA2-like symptoms such as recurrent ataxia, slurred speech with a duration of several hours, interictal nystagmus and response to acetazolamide, but had late-onset age of sixth decade. Whole-exome sequencing detected a heterozygous c.1177G>A mutation in SLC1A3. This mutation predicted a substitution of isoleucine for a highly conserved valine residue in the seventh transmembrane domain of EAAT1. The mutation was not present in 100 controls, a large panel of in-house genome data and various mutation databases. Most functional prediction scores revealed to be deleterious. Same heterozygous mutation was identified in one clinically affected family member and two asymptomatic members. Our data expand the mutation spectrum of SLC1A3 and the clinical phenotype of EA6.

  18. A current-mode buck DC-DC controller with adaptive on-time control

    Energy Technology Data Exchange (ETDEWEB)

    Li Yanming; Lai Xinquan; Ye Qiang; Yuan Bing; Chen Fuji [Institute of Electronic CAD, Xidian University, Xi' an 710071 (China); Jia Xinzhang, E-mail: ymli2004@126.co, E-mail: xqlai@mail.xidian.edu.c [Microelectronics Institute, Xidian University, Xi' an 710071 (China)

    2009-02-15

    A current-mode buck DC-DC controller based on adaptive on-time (AOT) control is presented. The on-time is obtained by the techniques of input feedforward and output feedback, and the adaptive control is achieved by a sample-hold and time-ahead circuit. The AOT current-mode control scheme not only obtains excellent transient response speed, but also achieves the independence of loop stability on output capacitor ESR. In addition, the AOT current-mode control does not have subharmonic oscillation phenomenon seen in fixed frequency peak current-mode control, so there is no need of the slope compensation circuit. The auto-skip pulse frequency modulation (PFM) mode improves the conversion efficiency of light load effectively. The controller has been fabricated with UMC 0.6-mum BCD process successfully and the detailed experimental results are shown.

  19. Myoelectric hand prosthesis force control through servo motor current feedback.

    Science.gov (United States)

    Sono, Tálita Saemi Payossim; Menegaldo, Luciano Luporini

    2009-10-01

    This paper presents the prehension force closed-loop control design of a mechanical finger commanded by electromyographic signal (EMG) from a patient's arm. The control scheme was implemented and tested in a mechanical finger prototype with three degrees of freedom and one actuator, driven by arm muscles EMG of normal volunteers. Real-time indirect estimation of prehension force was assessed by measuring the DC servo motor actuator current. A model of the plant comprising finger, motor, and grasped object was proposed. Model parameters were identified experimentally and a classical feedback phase-lead compensator was designed. The controlled mechanical finger was able to provide a more accurate prehension force modulation of a compliant object when compared to open-loop control.

  20. Electric Machine with Boosted Inductance to Stabilize Current Control

    Science.gov (United States)

    Abel, Steve

    2013-01-01

    High-powered motors typically have very low resistance and inductance (R and L) in their windings. This makes the pulse-width modulated (PWM) control of the current very difficult, especially when the bus voltage (V) is high. These R and L values are dictated by the motor size, torque (Kt), and back-emf (Kb) constants. These constants are in turn set by the voltage and the actuation torque-speed requirements. This problem is often addressed by placing inductive chokes within the controller. This approach is undesirable in that space is taken and heat is added to the controller. By keeping the same motor frame, reducing the wire size, and placing a correspondingly larger number of turns in each slot, the resistance, inductance, torque constant, and back-emf constant are all increased. The increased inductance aids the current control but ruins the Kt and Kb selections. If, however, a fraction of the turns is moved from their "correct slot" to an "incorrect slot," the increased R and L values are retained, but the Kt and Kb values are restored to the desired values. This approach assumes that increased resistance is acceptable to a degree. In effect, the heat allocated to the added inductance has been moved from the controller to the motor body, which in some cases is preferred.

  1. Expression of organic cation transporter SLC22A16 in human epithelial ovarian cancer: a possible role of the adriamycin importer.

    Science.gov (United States)

    Ota, Kyoko; Ito, Kiyoshi; Akahira, Jun-ichi; Sato, Naoko; Onogawa, Tohru; Moriya, Takuya; Unno, Michiaki; Abe, Takaaki; Niikura, Hitoshi; Takano, Tadao; Yaegashi, Nobuo

    2007-07-01

    The SLC22A16 is one of the newly isolated organic cation transporters, which is responsible for uptake and transport of adriamycin into cells. Adriamycin is considered to be an active agent for ovarian cancer. Recently, the benefit of adding adriamycin to the current standard regimen, paclitaxel and platinum, is evaluated to improve the outcome of patients with ovarian cancer. Therefore, we examined the expression of SLC22A16 in ovarian cancers. Twelve ovarian carcinoma cell lines were used for immunoblotting and reverse transcription-polymerase chain reaction to confirm the expression of SLC22A16 mRNA and protein. Five normal ovaries, 12 ovarian adenomas, and 94 ovarian cancer cases were obtained from patients after surgical therapy. The specimens were used for immunohistochemistry. The median value of relative SLC22A16 gene expression in cell lines derived from clear-cell adenocarcinoma was significantly higher than that in cell lines from other histologies (P < 0.001). Expression of SLC22A16 protein was also detected in cell lines derived from clear-cell adenocarcinoma. The SLC22A16 immunoreactivity was detected in 15 (16%) of 94 epithelial ovarian cancer, 1 (8.3%) of 12 benign adenomas, but 0 (0%) of 5 normal ovary cases. In ovarian cancer tissues, SLC22A16 immunoreactivity was detected in 2 (5%) of 38 serous adenocarcinoma, 1 (6.7%) of 15 endometrioid adenocarcinoma, 0 (0%) of 14 mucinous adenocarcinoma, and 12 (46.2%) of 26 clear-cell adenocarcinoma (P < 0.0001, clear-cell vs other histologies). In conclusion, SLC22A16 was abundantly expressed in clear-cell adenocarcinoma. Our results suggest that adriamycin-related chemicals that are taken up via SLC22A16 may have the potential to be effective against clear-cell adenocarcinoma.

  2. Simple Augmented Current Controller with OHC Technique for grid current compensation in the Distribution System

    Directory of Open Access Journals (Sweden)

    S. Rajalingam

    2014-05-01

    Full Text Available This paper presents a novel control technique on four leg inverter with which the distribution grid is interconnected with the domestic houses. Most of the houses in the distribution side possess inverter for the usage of Electricity. With the advancement in Solar & wind, it will become easy to see houses, often with solar & a small Wind power system. The excess power generated can be exchanged with the Electricity Board for providing uninterruptible power supply. During this exchange there may be a deterioration in the quality of power, most often the grid current gets affected with a large harmonic distortion, and also there exists unbalanced grid currents. Thus, it is necessary to provide uninterruptible power supply with good quality of power. In spite of several controllers, the proposed augmented controller has its own reliability & quick response with Overall Harmonic Compensation (OHC technique which relies on DSP based filter. This Augmented based control technique with OHC is demonstrated extensively with MATLAB/Simulink simulation.

  3. Current Situation of International Nuclear Arms Control and Nuclear Disarmament

    Institute of Scientific and Technical Information of China (English)

    Gong; Xianfu

    2014-01-01

    <正>Currently,international nuclear arms control and nuclear disarmament process is showing both encouraging and frustrating signs,with a stress on the latter.The following is a general picture:First,the new U.S.-Russian nuclear disarmament process faces challenges and prospect of a new round of nuclear disarmament negotiation is grim.As a result of implementing the New START signed in February 2011,as of March 1,2014,the United States has 1585

  4. Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.

    Science.gov (United States)

    Williams, Amy L; Jacobs, Suzanne B R; Moreno-Macías, Hortensia; Huerta-Chagoya, Alicia; Churchhouse, Claire; Márquez-Luna, Carla; García-Ortíz, Humberto; Gómez-Vázquez, María José; Burtt, Noël P; Aguilar-Salinas, Carlos A; González-Villalpando, Clicerio; Florez, Jose C; Orozco, Lorena; Haiman, Christopher A; Tusié-Luna, Teresa; Altshuler, David

    2014-02-06

    Performing genetic studies in multiple human populations can identify disease risk alleles that are common in one population but rare in others, with the potential to illuminate pathophysiology, health disparities, and the population genetic origins of disease alleles. Here we analysed 9.2 million single nucleotide polymorphisms (SNPs) in each of 8,214 Mexicans and other Latin Americans: 3,848 with type 2 diabetes and 4,366 non-diabetic controls. In addition to replicating previous findings, we identified a novel locus associated with type 2 diabetes at genome-wide significance spanning the solute carriers SLC16A11 and SLC16A13 (P = 3.9 × 10(-13); odds ratio (OR) = 1.29). The association was stronger in younger, leaner people with type 2 diabetes, and replicated in independent samples (P = 1.1 × 10(-4); OR = 1.20). The risk haplotype carries four amino acid substitutions, all in SLC16A11; it is present at ~50% frequency in Native American samples and ~10% in east Asian, but is rare in European and African samples. Analysis of an archaic genome sequence indicated that the risk haplotype introgressed into modern humans via admixture with Neanderthals. The SLC16A11 messenger RNA is expressed in liver, and V5-tagged SLC16A11 protein localizes to the endoplasmic reticulum. Expression of SLC16A11 in heterologous cells alters lipid metabolism, most notably causing an increase in intracellular triacylglycerol levels. Despite type 2 diabetes having been well studied by genome-wide association studies in other populations, analysis in Mexican and Latin American individuals identified SLC16A11 as a novel candidate gene for type 2 diabetes with a possible role in triacylglycerol metabolism.

  5. Development of Low-Cost Current Controlled Stimulator for Paraplegics

    Directory of Open Access Journals (Sweden)

    Aizan Masdar

    2012-12-01

    Full Text Available A spinal cord injury (SCI has a severe impact on human life in general as well as on the physical status and condition. The use of electrical signals to restore the function of paralyzed muscles is called functional electrical stimulation (FES. FES is a promising way to restore mobility to SCI by applying low-level electrical current to the paralyzed muscles so as to enhance that person’s ability to function and live independently. However, due to the limited number of commercially available FES assisted exerciser systems and their rather high cost, the conventional devices are unaffordable for most peoples. It is also inconvenient because of wired based system that creates a limitation in performing exercise. Thus, this project is concerned with the development of low-cost current controlled stimulator mainly for the paraplegic subjects. The developed device is based on a microcontroller, wireless based system using Zigbee module, voltage-to-current converter circuit and should produce proper monopolar and bipolar current pulses, pulse trains, arbitrary current waveforms, and a trigger output for FES applications. This device has been developed as in the new technique of the stimulator development with low cost and one of the contributing factors in Rehabilitation Engineering for patients with SCI.

  6. Dynamics and stabilization of peak current-mode controlled buck converter with constant current load

    Science.gov (United States)

    Leng, Min-Rui; Zhou, Guo-Hua; Zhang, Kai-Tun; Li, Zhen-Hua

    2015-10-01

    The discrete iterative map model of peak current-mode controlled buck converter with constant current load (CCL), containing the output voltage feedback and ramp compensation, is established in this paper. Based on this model the complex dynamics of this converter is investigated by analyzing bifurcation diagrams and the Lyapunov exponent spectrum. The effects of ramp compensation and output voltage feedback on the stability of the converter are investigated. Experimental results verify the simulation and theoretical analysis. The stability boundary and chaos boundary are obtained under the theoretical conditions of period-doubling bifurcation and border collision. It is found that there are four operation regions in the peak current-mode controlled buck converter with CCL due to period-doubling bifurcation and border-collision bifurcation. Research results indicate that ramp compensation can extend the stable operation range and transfer the operating mode, and output voltage feedback can eventually eliminate the coexisting fast-slow scale instability. Project supported by the National Natural Science Foundation of China (Grant No. 61371033), the Fok Ying-Tung Education Foundation for Young Teachers in the Higher Education Institutions of China (Grant No. 142027), the Sichuan Provincial Youth Science and Technology Fund, China (Grant Nos. 2014JQ0015 and 2013JQ0033), and the Fundamental Research Funds for the Central Universities, China (Grant No. SWJTU11CX029).

  7. SLC27 fatty acid transport proteins.

    Science.gov (United States)

    Anderson, Courtney M; Stahl, Andreas

    2013-01-01

    The uptake and metabolism of long chain fatty acids (LCFA) are critical to many physiological and cellular processes. Aberrant accumulation or depletion of LCFA underlie the pathology of numerous metabolic diseases. Protein-mediated transport of LCFA has been proposed as the major mode of LCFA uptake and activation. Several proteins have been identified to be involved in LCFA uptake. This review focuses on the SLC27 family of fatty acid transport proteins, also known as FATPs, with an emphasis on the gain- and loss-of-function animal models that elucidate the functions of FATPs in vivo and how these transport proteins play a role in physiological and pathological situations.

  8. Improved control strategy for PI-R current of DFIG considering voltage and current harmonics compensation

    Science.gov (United States)

    Song, S. Y.; Liu, Q. H.; Zhao, Y. N.; Liu, S. Y.

    2016-08-01

    With the rapid development of wind power generation, the related research of wind power control and integration issues has attracted much attention, and the focus of the research are shifting away from the ideal power grid environment to the actual power grid environment. As the main stream wind turbine generator, a doubly-fed induction generator (DFIG) is connected to the power grid directly by its stator, so it is particularly sensitive to the power grid. This paper studies the improvement of DFIG control technology in the power grid harmonic environment. Based on the DFIG dynamic model considering the power grid harmonic environment, this paper introduces the shortcomings of the common control strategy of DFIG, and puts forward the enhanced method. The decoupling control of the system is realized by compensating the coupling between the rotor harmonic voltage and harmonic current, improving the control performance. In addition, the simulation experiments on PSCAD/EMTDC are carried out to verify the correctness and effectiveness of the improved scheme.

  9. High-Speed Current dq PI Controller for Vector Controlled PMSM Drive

    Directory of Open Access Journals (Sweden)

    Mohammad Marufuzzaman

    2014-01-01

    Full Text Available High-speed current controller for vector controlled permanent magnet synchronous motor (PMSM is presented. The controller is developed based on modular design for faster calculation and uses fixed-point proportional-integral (PI method for improved accuracy. Current dq controller is usually implemented in digital signal processor (DSP based computer. However, DSP based solutions are reaching their physical limits, which are few microseconds. Besides, digital solutions suffer from high implementation cost. In this research, the overall controller is realizing in field programmable gate array (FPGA. FPGA implementation of the overall controlling algorithm will certainly trim down the execution time significantly to guarantee the steadiness of the motor. Agilent 16821A Logic Analyzer is employed to validate the result of the implemented design in FPGA. Experimental results indicate that the proposed current dq PI controller needs only 50 ns of execution time in 40 MHz clock, which is the lowest computational cycle for the era.

  10. Precision electronic speed controller for an alternating-current motor

    Science.gov (United States)

    Bolie, V.W.

    A high precision controller for an alternating-current multi-phase electrical motor that is subject to a large inertial load. The controller was developed for controlling, in a neutron chopper system, a heavy spinning rotor that must be rotated in phase-locked synchronism with a reference pulse train that is representative of an ac power supply signal having a meandering line frequency. The controller includes a shaft revolution sensor which provides a feedback pulse train representative of the actual speed of the motor. An internal digital timing signal generator provides a reference signal which is compared with the feedback signal in a computing unit to provide a motor control signal. The motor control signal is a weighted linear sum of a speed error voltage, a phase error voltage, and a drift error voltage, each of which is computed anew with each revolution of the motor shaft. The speed error signal is generated by a novel vernier-logic circuit which is drift-free and highly sensitive to small speed changes. The phase error is also computed by digital logic, with adjustable sensitivity around a 0 mid-scale value. The drift error signal, generated by long-term counting of the phase error, is used to compensate for any slow changes in the average friction drag on the motor. An auxillary drift-byte status sensor prevents any disruptive overflow or underflow of the drift-error counter. An adjustable clocked-delay unit is inserted between the controller and the source of the reference pulse train to permit phase alignment of the rotor to any desired offset angle. The stator windings of the motor are driven by two amplifiers which are provided with input signals having the proper quadrature relationship by an exciter unit consisting of a voltage controlled oscillator, a binary counter, a pair of read-only memories, and a pair of digital-to-analog converters.

  11. Current control in inertial Brownian motors by noise recycling

    Science.gov (United States)

    Jia, Zheng-Lin; Li, Kai-Yi; Li, Chun; Yang, Chun-Yan; Mei, Dong-Cheng

    2015-03-01

    The transport properties of an inertial Brownian motor were numerically studied in the presence of recycled noise, which is obtained by re-injecting a fraction of the primary white noise after a processing time, being introduced into the system in a multiplicative way. The simulation results indicate that various parameters such as the external driving force, the friction coefficient, the mass of the particle, the recycling strength, and the delay time can induce the current reversal phenomenon when the sign of the recycling strength is in agreement with the sign of the external bias force, otherwise the current reversal cannot be observed. Additionally, the asymptotic mean velocity as a function of the delay time of the recycled noise always shows a resonance-like behavior with the presence of a maximum current. These results demonstrate that the delay time and the recycling strength of the recycled noise can be used as the feasible and flexible control parameters for the amplitude and direction of the current.

  12. Na(+) dependent acid-base transporters in the choroid plexus; insights from slc4 and slc9 gene deletion studies

    DEFF Research Database (Denmark)

    Christensen, Henriette L; Nguyen, An T; Pedersen, Fredrik D

    2013-01-01

    H regulation (slc4a7 and slc4a10). In some instances, removal of the proteins from the CPE (slc4a5, 7, and 10) causes changes in abundance and localization of non-target transporters known to be involved in pH regulation and CSF secretion. The focus of this review is to combine the insights gathered from...... with an unsurpassed transepithelial water and solute transport rate. Several members of the slc4a family of bicarbonate transporters are expressed in the CPE. In the basolateral membrane the electroneutral Na(+) dependent Cl(-)/HCO3 (-) exchanger, NCBE (slc4a10) is expressed. In the luminal membrane, the electrogenic...... Na(+):HCO3 (-) cotransporter, NBCe2 (slc4a5) is expressed. The electroneutral Na(+):HCO3 (-) cotransporter, NBCn1 (slc4a7), has been located in both membranes. In addition to the bicarbonate transporters, the Na(+)/H(+) exchanger, NHE1 (slc9a1), is located in the luminal membrane of the CPE...

  13. RNA sequencing of creatine transporter (SLC6A8) deficient fibroblasts reveals impairment of the extracellular matrix.

    Science.gov (United States)

    Nota, Benjamin; Ndika, Joseph D T; van de Kamp, Jiddeke M; Kanhai, Warsha A; van Dooren, Silvy J M; van de Wiel, Mark A; Pals, Gerard; Salomons, Gajja S

    2014-09-01

    Creatine transporter (SLC6A8) deficiency is the most common cause of cerebral creatine syndromes, and is characterized by depletion of creatine in the brain. Manifestations of this X-linked disorder include intellectual disability, speech/language impairment, behavior abnormalities, and seizures. At the moment, no effective treatment is available. In order to investigate the molecular pathophysiology of this disorder, we performed RNA sequencing on fibroblasts derived from patients. The transcriptomes of fibroblast cells from eight unrelated individuals with SLC6A8 deficiency and three wild-type controls were sequenced. SLC6A8 mutations with different effects on the protein product resulted in different gene expression profiles. Differential gene expression analysis followed by gene ontology term enrichment analysis revealed that especially the expression of genes encoding components of the extracellular matrix and cytoskeleton are altered in SLC6A8 deficiency, such as collagens, keratins, integrins, and cadherins. This suggests an important novel role for creatine in the structural development and maintenance of cells. It is likely that the (extracellular) structure of brain cells is also impaired in SLC6A8-deficient patients, and future studies are necessary to confirm this and to reveal the true functions of creatine in the brain. © 2014 WILEY PERIODICALS, INC.

  14. Controlled Levitation of Colloids through Direct Current Electric Fields.

    Science.gov (United States)

    Silvera Batista, Carlos A; Rezvantalab, Hossein; Larson, Ronald G; Solomon, Michael J

    2017-07-07

    We report the controlled levitation of surface-modified colloids in direct current (dc) electric fields at distances as far as 75 μm from an electrode surface. Instead of experiencing electrophoretic deposition, colloids modified through metallic deposition or the covalent bonding of poly(ethylene glycol) (PEG) undergo migration and focusing that results in levitation at these large distances. The levitation is a sensitive function of the surface chemistry and magnitude of the field, thus providing the means to achieve control over the levitation height. Experiments with particles of different surface charge show that levitation occurs only when the absolute zeta potential is below a threshold value. An electrodiffusiophoretic mechanism is proposed to explain the observed large-scale levitation.

  15. Chaos control by electric current in an enzymatic reaction.

    Science.gov (United States)

    Lekebusch, A; Förster, A; Schneider, F W

    1996-09-01

    We apply the continuous delayed feedback method of Pyragas to control chaos in the enzymatic Peroxidase-Oxidase (PO) reaction, using the electric current as the control parameter. At each data point in the time series, a time delayed feedback function applies a small amplitude perturbation to inert platinum electrodes, which causes redox processes on the surface of the electrodes. These perturbations are calculated as the difference between the previous (time delayed) signal and the actual signal. Unstable periodic P1, 1(1), and 1(2) orbits (UPOs) were stabilized in the CSTR (continuous stirred tank reactor) experiments. The stabilization is demonstrated by at least three conditions: A minimum in the experimental dispersion function, the equality of the delay time with the period of the stabilized attractor and the embedment of the stabilized periodic attractor in the chaotic attractor.

  16. SLC26A Gene Family Participate in pH Regulation during Enamel Maturation.

    Directory of Open Access Journals (Sweden)

    Kaifeng Yin

    Full Text Available The bicarbonate transport activities of Slc26a1, Slc26a6 and Slc26a7 are essential to physiological processes in multiple organs. Although mutations of Slc26a1, Slc26a6 and Slc26a7 have not been linked to any human diseases, disruption of Slc26a1, Slc26a6 or Slc26a7 expression in animals causes severe dysregulation of acid-base balance and disorder of anion homeostasis. Amelogenesis, especially the enamel formation during maturation stage, requires complex pH regulation mechanisms based on ion transport. The disruption of stage-specific ion transporters frequently results in enamel pathosis in animals. Here we present evidence that Slc26a1, Slc26a6 and Slc26a7 are highly expressed in rodent incisor ameloblasts during maturation-stage tooth development. In maturation-stage ameloblasts, Slc26a1, Slc26a6 and Slc26a7 show a similar cellular distribution as the cystic fibrosis transmembrane conductance regulator (Cftr to the apical region of cytoplasmic membrane, and the distribution of Slc26a7 is also seen in the cytoplasmic/subapical region, presumably on the lysosomal membrane. We have also examined Slc26a1 and Slc26a7 null mice, and although no overt abnormal enamel phenotypes were observed in Slc26a1-/- or Slc26a7-/- animals, absence of Slc26a1 or Slc26a7 results in up-regulation of Cftr, Ca2, Slc4a4, Slc4a9 and Slc26a9, all of which are involved in pH homeostasis, indicating that this might be a compensatory mechanism used by ameloblasts cells in the absence of Slc26 genes. Together, our data show that Slc26a1, Slc26a6 and Slc26a7 are novel participants in the extracellular transport of bicarbonate during enamel maturation, and that their functional roles may be achieved by forming interaction units with Cftr.

  17. Predictive current control of permanent magnet synchronous motor based on linear active disturbance rejection control

    Science.gov (United States)

    Li, Kunpeng

    2017-01-01

    The compatibility problem between rapidity and overshooting in the traditional predictive current control structure is inevitable and difficult to solve by reason of using PI controller. A novel predictive current control (PCC) algorithm for permanent magnet synchronous motor (PMSM) based on linear active disturbance rejection control (LADRC) is presented in this paper. In order to displace PI controller, the LADRC strategy which consisted of linear state error feedback (LSEF) control algorithm and linear extended state observer (LESO), is designed based on the mathematic model of PMSM. The purpose of LSEF is to make sure fast response to load mutation and system uncertainties, and LESO is designed to estimate the uncertain disturbances. The principal structures of the proposed system are speed outer loop based on LADRC and current inner loop based on predictive current control. Especially, the instruction value of qaxis current in inner loop is derived from the control quantity which is designed in speed outer loop. The simulation is carried out in Matlab/Simulink software, and the results illustrate that the dynamic and static performances of proposed system are satisfied. Moreover the robust against model parameters mismatch is enhanced obviously.

  18. Anodisation with dynamic current control for tailored alumina coatings

    Science.gov (United States)

    Sieber, M.; Althöfer, I.; Höhlich, D.; Scharf, I.; Böttger, D.; Böttger, S.; Böttger, E.; Lampke, T.

    2016-03-01

    The anodic oxidation process is commonly used to refine the surface of aluminium and its alloys. Compared to the substrate, the alumina layers produced by anodising exhibit an increased hardness and chemical resistance. Thus, the corrosion and wear resistance are generally improved. The coatings are also electrically isolating and may serve decorative purposes. Applying a time-variant, dynamic electrical process control by pulse-current or current-steps is a promising approach to improve the coating properties, which is partially deployed in an industrial scale. In the present work, the influence of dynamic electrical process control on the coating properties is examined by means of a design of experiments (DOE). The effects of various electrolyte compositions and temperatures as well as processing time are considered with regard to coating thickness, hardness, wear resistance and the electrical energy consumption during the formation of the coatings. Information about the statistical significance of the effects of the parameters on the considered properties is obtained by an analysis of variance (ANOVA).

  19. Current-controlled unidirectional edge-meron motion

    Science.gov (United States)

    Xing, Xiangjun; Pong, Philip W. T.; Zhou, Yan

    2016-11-01

    In order to address many of the challenges and bottlenecks currently experienced by traditional charge-based technologies, various alternatives are being actively explored to provide potential solutions of device miniaturization and scaling in the post-Moore's-law era. Amongst these alternatives, spintronic physics and devices have recently attracted rapidly increasing interest by exploiting the additional degree of electrons-spin. For example, magnetic domain-wall racetrack-memory and logic devices have been realized via manipulating domain-wall motion. As compared to domain-wall-based devices, magnetic skyrmions have the advantages of ultrasmall size (typically 5-100 nm in diameter), facile current-driven motion, topological stability, and peculiar emergent electrodynamics, promising for next-generation electronics applications in the post-Moore's-law regime. Here, a magnetic meron device, which behaves similarly to a PN-junction diode, is demonstrated for the first time, by tailoring the current-controlled unidirectional motion of edge-merons (i.e., fractional skyrmions) in a nanotrack with interfacial Dzyaloshinskii-Moriya interaction. The working principles of the meron device, theoretically predicted from the Thiele equation for topological magnetic objects, are further verified using micromagnetic simulations. The present study has revealed the topology-independent transport property of different magnetic objects and is expected to open the vista toward integrated composite circuitry (with unified data storage and processing) based on a single magnetic chip, as the meron device can be used, either as a building block to develop complex logic components or as a signal controller to interconnect skyrmion, domain-wall, and even spin-wave devices.

  20. Improving Myoelectric Control for Amputees through Transcranial Direct Current Stimulation.

    Science.gov (United States)

    Pan, Lizhi; Zhang, Dingguo; Sheng, Xinjun; Zhu, Xiangyang

    2015-08-01

    Most prosthetic myoelectric control studies have shown good performance for unimpaired subjects. However, performance is generally unacceptable for amputees. The primary problem is the poor quality of electromyography (EMG) signals of amputees compared with healthy individuals. To improve clinical performance of myoelectric control, this study explored transcranial direct current stimulation (tDCS) to modulate brain activity and enhance EMG quality. We tested six unilateral transradial amputees by applying active and sham anodal tDCS separately on two different days. Surface EMG signals were acquired from the affected and intact sides for 11 hand and wrist motions in the pre-tDCS and post-tDCS sessions. Autoregression coefficients and linear discriminant analysis classifiers were used to process the EMG data for pattern recognition of the 11 motions. For the affected side, active anodal tDCS significantly reduced the average classification error rate (CER) by 10.1%, while sham tDCS had no such effect. For the intact side, the average CER did not change on the day of sham tDCS but increased on the day of active tDCS. These results demonstrated that tDCS could modulate brain function and improve EMG-based classification performance for amputees. It has great potential in dramatically reducing the length of learning process of amputees for effectively using myoelectrically controlled multifunctional prostheses.

  1. Cross Voltage Control with Inner Hysteresis Current Control for Multi-output Boost Converter

    DEFF Research Database (Denmark)

    Nami, Alireza; Zare, Firuz; Blaabjerg, Frede

    2009-01-01

    with inner hysteresis current control loop has been proposed to keep the simplicity of the control law for the double-output MOB converter, which can be implemented by a combination of analogue and logical ICs or simple microcontroller to constrain the output voltages of MOB converter at their reference...

  2. Cross Voltage Control with Inner Hysteresis Current Control for Multi-output Boost Converter

    DEFF Research Database (Denmark)

    Nami, Alireza; Zare, Firuz; Blaabjerg, Frede

    2009-01-01

    with inner hysteresis current control loop has been proposed to keep the simplicity of the control law for the double-output MOB converter, which can be implemented by a combination of analogue and logical ICs or simple microcontroller to constrain the output voltages of MOB converter at their reference...

  3. Bifurcation behaviours of peak current controlled PFC boost converter

    Institute of Scientific and Technical Information of China (English)

    Ren Hai-Peng; Liu Ding

    2005-01-01

    Bifurcation behaviours of the peak current controlled power-factor-correction (PFC) boost converter, including fast-scale instability and low-frequency bifurcation, are investigated in this paper. Conventionally, the PFC converter is analysed in continuous conduction mode (CCM). This prevents us from recognizing the overall dynamics of the converter. It has been pointed out that the discontinuous conduction mode (DCM) can occur in the PFC boost converter, especially in the light load condition. Therefore, the DCM model is employed to analyse the PFC converter to cover the possible DCM operation. By this way, the low-frequency bifurcation diagram is derived, which makes the route from period-double bifurcation to chaos clear. The bifurcation diagrams versus the load resistance and the output capacitance also indicate the stable operation boundary of the converter, which is useful for converter design.

  4. Fuzzy Controller based Neutral Current Harmonic Suppression in Distribution System

    Directory of Open Access Journals (Sweden)

    T.Guna Sekar

    2013-10-01

    Full Text Available Recent surveys of three-phase four-wire electric systems, buildings and industrial plants with computers and non-linear loads shows the excessive currents in the neutral conductor. This is mainly due to unbalancing system and non-linear loads. Third order harmonics are much dominant in the neutral conductor due to the presence of zero sequence components. In response to this concern, this paper presents a concept of series active filter scheme to suppress the neutral current harmonics to reduce the burden of the secondary of the distribution transformer. In this scheme, the series active filteris connected in series with the neutral conductor to eliminate the zero sequence components in the neutral conductor. In this paper, Fuzzy based controller is used to extract the harmonic component in the neutral conductor. The proposed method improves the overall performance of the system and eliminates the burden of the neutral conductor. To validate the proposed simulation results, a scale-down prototype experimental model is developed.

  5. Linking chronic infection and autoimmune diseases: Mycobacterium avium subspecies paratuberculosis, SLC11A1 polymorphisms and type-1 diabetes mellitus.

    Directory of Open Access Journals (Sweden)

    Daniela Paccagnini

    Full Text Available BACKGROUND: The etiology of type 1 diabetes mellitus (T1DM is still unknown; numerous studies are performed to unravel the environmental factors involved in triggering the disease. SLC11A1 is a membrane transporter that is expressed in late endosomes of antigen presenting cells involved in the immunopathogenic events leading to T1DM. Mycobacterium avium subsp. paratuberculosis (MAP has been reported to be a possible trigger in the development of T1DM. METHODOLOGY/PRINCIPAL FINDINGS: Fifty nine T1DM patients and 79 healthy controls were genotyped for 9 polymorphisms of SLC11A1 gene, and screened for the presence of MAP by PCR. Differences in genotype frequency were evaluated for both T1DM patients and controls. We found a polymorphism in the SLC11A1 gene (274C/T associated to type 1 diabetic patients and not to controls. The presence of MAP DNA was also significantly associated with T1DM patients and not with controls. CONCLUSIONS/SIGNIFICANCE: The 274C/T SCL11A1 polymorphism was found to be associated with T1DM as well as the presence of MAP DNA in blood. Since MAP persists within macrophages and it is also processed by dendritic cells, further studies are necessary to evaluate if mutant forms of SLC11A1 alter the processing or presentation of MAP antigens triggering thereby an autoimmune response in T1DM patients.

  6. Current trends in small vocabulary speech recognition for equipment control

    Science.gov (United States)

    Doukas, Nikolaos; Bardis, Nikolaos G.

    2017-09-01

    Speech recognition systems allow human - machine communication to acquire an intuitive nature that approaches the simplicity of inter - human communication. Small vocabulary speech recognition is a subset of the overall speech recognition problem, where only a small number of words need to be recognized. Speaker independent small vocabulary recognition can find significant applications in field equipment used by military personnel. Such equipment may typically be controlled by a small number of commands that need to be given quickly and accurately, under conditions where delicate manual operations are difficult to achieve. This type of application could hence significantly benefit by the use of robust voice operated control components, as they would facilitate the interaction with their users and render it much more reliable in times of crisis. This paper presents current challenges involved in attaining efficient and robust small vocabulary speech recognition. These challenges concern feature selection, classification techniques, speaker diversity and noise effects. A state machine approach is presented that facilitates the voice guidance of different equipment in a variety of situations.

  7. Partial deletion of the sulfate transporter SLC13A1 is associated with an osteochondrodysplasia in the Miniature Poodle breed.

    Directory of Open Access Journals (Sweden)

    Mark W Neff

    Full Text Available A crippling dwarfism was first described in the Miniature Poodle in Great Britain in 1956. Here, we resolve the genetic basis of this recessively inherited disorder. A case-control analysis (8:8 of genotype data from 173 k SNPs revealed a single associated locus on CFA14 (P(raw <10(-8. All affected dogs were homozygous for an ancestral haplotype consistent with a founder effect and an identical-by-descent mutation. Systematic failure of nine, nearly contiguous SNPs, was observed solely in affected dogs, suggesting a deletion was the causal mutation. A 130-kb deletion was confirmed both by fluorescence in situ hybridization (FISH analysis and by cloning the physical breakpoints. The mutation was perfectly associated in all cases and obligate heterozygotes. The deletion ablated all but the first exon of SLC13A1, a sodium/sulfate symporter responsible for regulating serum levels of inorganic sulfate. Our results corroborate earlier findings from an Slc13a1 mouse knockout, which resulted in hyposulfatemia and syndromic defects. Interestingly, the metabolic disorder in Miniature Poodles appears to share more clinical signs with a spectrum of human disorders caused by SLC26A2 than with the mouse Slc13a1 model. SLC26A2 is the primary sodium-independent sulfate transporter in cartilage and bone and is important for the sulfation of proteoglycans such as aggregan. We propose that disruption of SLC13A1 in the dog similarly causes undersulfation of proteoglycans in the extracellular matrix (ECM, which impacts the conversion of cartilage to bone. A co-dominant DNA test of the deletion was developed to enable breeders to avoid producing affected dogs and to selectively eliminate the mutation from the gene pool.

  8. Mitigation of Grid Current Distortion for LCL-Filtered Voltage Source Inverter with Inverter Current Feedback Control

    DEFF Research Database (Denmark)

    Xin, Zhen; Mattavelli, Paolo; Yao, WenLi

    2017-01-01

    LCL filters feature low inductance; thus, the injected grid current from an LCL-filtered Voltage Source Inverter (VSI) can be easily distorted by grid voltage harmonics. This problem is especially tough for the control system with Inverter-side Current Feedback (ICF), since the grid current...... cause noise amplification. In light of the above issue, this paper develops a simple method for the ICF control system to mitigate the grid current harmonics without extra sensors. In the proposed method, resonant harmonic controllers and an additional compensation loop are adopted at the same time...

  9. Estrogen receptor 1 agonist PPT stimulates Slc2a4 gene expression and improves insulin-induced glucose uptake in adipocytes.

    Science.gov (United States)

    Campello, R S; Alves-Wagner, A B; Lucas, T F; Mori, R C; Furuya, D T; Porto, C S; Machado, U F

    2012-01-01

    Type 2 diabetes mellitus is characterized by disruption in glycemic homeostasis, involving impaired insulin-induced glucose disposal. For that, reduced glucose transporter GLUT4, encoded by Slc2a4 gene, plays a fundamental role. Conversely, increase in Slc2a4/GLUT4 expression improves glycemic homeostasis. Recent studies have proposed that estradiol is able to modulate Slc2a4 expression, according to distinct effects upon estrogen receptors ESR1/ESR2. We hypothesize that ESR1-agonist effect could stimulate Slc2a4 expression; thus, increasing cellular glucose disposal, which could be beneficial to glycemic control. Differentiated 3T3-L1 adipocytes were treated (24 hours) with selective ESR1- agonist PPT 1,3,5-tris(4-hydroxyphenyl)-4-propyl-1H-pyrazole, selective ESR1-antagonist MPP 1,3-Bis(4- hydroxyphenyl)-4-methyl-5-[4-(2-piperidinylethoxy)phenol]-1H-pyrazole dihydrochloride, and selective ESR2 agonist DPN 2,3-bis(4-Hydroxyphenyl)-propionitrile, with/without 17β-estradiol (E2). We analyzed Slc2a4 mRNA (real time PCR) and GLUT4 protein (Western blotting) expression, transcriptional activity of the Slc2a4 repressor Nuclear Factor- κB (NF-κB) (electrophoretic mobility shift assay), and cellular glucose disposal (2-deoxi-D-[(3)H]glucose uptake, 2-DG). ESR1-agonist PPT enhanced Slc2a4/GLUT4 expression (~30%) in the absence or presence of 0.1 and 10 nmol/L E2, and decreased the NF-κB binding activity (~50%). Conversely, ESR1-antagonist MPP, together with E2, decreased Slc2a4/GLUT4 expression (20-40%) and increased NF-κB binding activity (~30%). Furthermore, treatment with ESR2- agonist DPN decreased Slc2a4/GLUT4 expression (20-50%). 2-DG uptake was modulated in parallel to that observed in GLUT4 protein. The present results reveal that ESR1 activity enhances, whereas ESR2 activity represses, Slc2a4/GLUT4 expression. These effects are partially mediated by NF-κB, and allow parallel changes in adipocyte glucose disposal. Furthermore, the data provide evidences that

  10. The gene expression of the neuronal protein, SLC38A9, changes in mouse brain after in vivo starvation and high-fat diet

    Science.gov (United States)

    Eriksson, Mikaela M.; Lekholm, Emilia; Arapi, Vasiliki; Perland, Emelie; Fredriksson, Robert

    2017-01-01

    SLC38A9 is characterized as a lysosomal component of the amino acid sensing Ragulator-RAG GTPase complex, controlling the mechanistic target of rapamycin complex 1 (mTORC1). Here, immunohistochemistry was used to map SLC38A9 in mouse brain and staining was detected throughout the brain, in cortex, hypothalamus, thalamus, hippocampus, brainstem and cerebellum. More specifically, immunostaining was found in areas known to be involved in amino acid sensing and signaling pathways e.g. piriform cortex and hypothalamus. SLC38A9 immunoreactivity co-localized with both GABAergic and glutamatergic neurons, but not with astrocytes. SLC38A9 play a key role in the mTORC1 pathway, and therefore we performed in vivo starvation and high-fat diet studies, to measure gene expression alterations in specific brain tissues and in larger brain regions. Following starvation, Slc38a9 was upregulated in brainstem and cortex, and in anterior parts of the brain (Bregma 3.2 to -2.1mm). After high-fat diet, Slc38a9 was specifically upregulated in hypothalamus, while overall downregulation was noticed throughout the brain (Bregma 3.2 to -8.6mm). PMID:28235079

  11. SLC6 Neurotransmitter Transporters: Structure, Function, and Regulation

    DEFF Research Database (Denmark)

    Kristensen, Anders S; Andersen, Jacob; Jørgensen, Trine N

    2011-01-01

    The neurotransmitter transporters (NTTs) belonging to the solute carrier 6 (SLC6) gene family (also referred to as the neurotransmitter-sodium-symporter family or Na(+)/Cl(-)-dependent transporters) comprise a group of nine sodium- and chloride-dependent plasma membrane transporters for the monoa......The neurotransmitter transporters (NTTs) belonging to the solute carrier 6 (SLC6) gene family (also referred to as the neurotransmitter-sodium-symporter family or Na(+)/Cl(-)-dependent transporters) comprise a group of nine sodium- and chloride-dependent plasma membrane transporters....... Furthermore, psychostimulants such as cocaine and amphetamines have the SLC6 NTTs as primary targets. Beginning with the determination of a high-resolution structure of a prokaryotic homolog of the mammalian SLC6 transporters in 2005, the understanding of the molecular structure, function, and pharmacology...

  12. Reducing current reversal time in electric motor control

    Science.gov (United States)

    Bredemann, Michael V

    2014-11-04

    The time required to reverse current flow in an electric motor is reduced by exploiting inductive current that persists in the motor when power is temporarily removed. Energy associated with this inductive current is used to initiate reverse current flow in the motor.

  13. Preliminary effects of bupropion and the promoter region (HTTLPR) serotonin transporter (SLC6A4) polymorphism on smoking behavior in schizophrenia.

    Science.gov (United States)

    Bloch, Boaz; Reshef, Alon; Cohen, Tamara; Tafla, Amos; Gathas, Samich; Israel, Salomon; Gritsenko, Inga; Kremer, Ilana; Ebstein, Richard P

    2010-01-30

    In the current study, we investigated how individual variants in the serotonin promoter gene, previously associated with smoking cessation and linked to anxiety-related personality traits, were associated with individual differences in responsiveness to bupropion and cognitive behavioral therapy (CBT) in a clinical population. We hypothesize that subjects with the long allele may be less responsive to treatment. Altogether 61 schizophrenic patients (46 M, 15 F) on stable neuroleptic medication were initially enrolled in a smoking reduction program (prospective, double-blind, placebo-controlled) including cognitive behavioral therapy plus placebo or CBT plus bupropion. Additionally, subjects were genotyped for a polymorphism in the serotonin transporter (SLC6A4). Thirty-two subjects (23 M, 9 F) completed a 14-week course of treatment. While both groups of subjects demonstrated significant reductions in smoking behavior due to CBT, subjects receiving bupropion did not show significant differences in smoking behavior when compared to placebo. In addition, analysis by SPSS repeated measures multivariate showed a significant sex by SLC6A4 genotype interaction on the number of cigarettes smoked. Only male subjects with at least one short promoter region allele (short/short and short/long combined) showed a reduction in cigarette consumption as a result of treatment. This study provides preliminary evidence of how polymorphisms in the serotonin transporter can be informative in predicting individual responses to smoking reduction therapy.

  14. Analysis of modern optimal control theory applied to plasma position and current control in TFTR

    Energy Technology Data Exchange (ETDEWEB)

    Firestone, M.A.

    1981-09-01

    The strong compression TFTR discharge has been segmented into regions where linear dynamics can approximate the plasma's interaction with the OH and EF power supply systems. The dynamic equations for these regions are utilized within the linear optimal control theory framework to provide active feedback gains to control the plasma position and current. Methods are developed to analyze and quantitatively evaluate the quality of control in a nonlinear, more realistic simulation. Tests are made of optimal control theory's assumptions and requirements, and the feasibility of this method for TFTR is assessed.

  15. Balanced Current Control Strategy for Current Source Rectifier Stage of Indirect Matrix Converter under Unbalanced Grid Voltage Conditions

    Directory of Open Access Journals (Sweden)

    Yeongsu Bak

    2016-12-01

    Full Text Available This paper proposes a balanced current control strategy for the current source rectifier (CSR stage of an indirect matrix converter (IMC under unbalanced grid voltage conditions. If the three-phase grid connected to the voltage source inverter (VSI of the IMC has unbalanced voltage conditions, it affects the currents of the CSR stage and VSI stage, and the currents are distorted. Above all, the distorted currents of the CSR stage cause instability in the overall system, which can affect the life span of the system. Therefore, in this paper, a control strategy for balanced currents in the CSR stage is proposed. To achieve balanced currents in the CSR stage, the VSI stage should receive DC power without ripple components from the CSR stage. This is implemented by controlling the currents in the VSI stage. Therefore, the proposed control strategy decouples the positive and negative phase-sequence components existing in the unbalanced voltages and currents of the VSI stage. Using the proposed control strategy under unbalanced grid voltage conditions, the stability and life span of the overall system can be improved. The effectiveness of the proposed control strategy is verified by simulation and experimental results.

  16. Current profile control experiments in EXTRAP T2R

    Science.gov (United States)

    Brunsell, P.; Cecconello, M.; Drake, J.; Franz, P.; Malmberg, J. A.; Marrelli, L.; Martin, P.; Spizzo, G.

    2002-11-01

    EXTRAP T2R is a high aspect ratio (R=1.24 m, a = 0.183 m) reversed-field pinch device, characterised by a double, thin shell system. The simultaneous presence of many m=1, |n| > 11 tearing modes is responsible for a magnetic field turbulence, which is believed to produce the rather high energy and particle transport that is observed in this type of magnetic configuration. In this paper first results from current profile control experiments (PPCD) in a thin shell device are shown. When an edge poloidal electric field is transiently applied, an increase of the electron temperature and of the electron density is seen, which is consistent with an increase of the thermal content of the plasma. At the same time, the soft x-ray emission, measured with a newly installed miniaturised camera, shows a peaking of the profile in the core. Furthermore, the amplitudes of the m=1 tearing modes are reduced and and the rotation velocities increase during PPCD, which is also consistent with a reduction of magnetic turbulence and a heating of the plasma

  17. Macroscopic strain controlled ion current in an elastomeric microchannel

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, Chin-Chang; Nguyen, Du; Buchsbaum, Steven; Innes, Laura; Dennin, Michael, E-mail: mdennin@uci.edu [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Li, Yongxue [Department of Civil and Environmental Engineering, University of California, Irvine, California 92697 (United States); Esser-Kahn, Aaron P. [Department of Chemistry, University of California, Irvine, California 92697 (United States); Valdevit, Lorenzo [Department of Mechanical and Aerospace Engineering, University of California, Irvine, California 92697-3975 (United States); Department of Chemical Engineering and Materials Science, University of California, Irvine, California 92697 (United States); Sun, Lizhi [Department of Civil and Environmental Engineering, University of California, Irvine, California 92697 (United States); Department of Chemical Engineering and Materials Science, University of California, Irvine, California 92697 (United States); Siwy, Zuzanna [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Department of Chemistry, University of California, Irvine, California 92697 (United States)

    2015-05-07

    We report on the fabrication of an ultra-high aspect ratio ionically conductive single microchannel with tunable diameter from ≈ 20 μm to fully closed. The 4 mm-long channel is fabricated in a Polydimethylsiloxane (PDMS) mold and its cross-sectional area is controlled by applying macroscopic compressive strain to the mold in a direction perpendicular to the channel length. We investigated the ionic conduction properties of the channel. For a wide range of compressive strain up to ≈ 0.27, the strain dependence of the resistance is monotonic and fully reversible. For strain > 0.27, ionic conduction suddenly shuts off and the system becomes hysteretic (whereby a finite strain reduction is required to reopen the channel). Upon unloading, the original behavior is retrieved. This reversible behavior is observed over 200 compression cycles. The cross-sectional area of the channel can be inferred from the ion current measurement, as confirmed by a Nano-Computed Tomography investigation. We show that the cross-sectional area decreases monotonically with the applied compressive strain in the reversible range, in qualitative agreement with linear elasticity theory. We find that the shut-off strain is affected by the spatial extent of the applied strain, which provides additional tunability. Our tunable channel is well-suited for multiple applications in micro/nano-fluidic devices.

  18. Dynamic phase-control of a rising sun magnetron using modulated and continuous current

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Gutierrez, Sulmer, E-mail: sulmer.a.fernandez.gutierrez@intel.com [Intel Corporation, 2111 NE 25th Ave, Hillsboro, Oregon 97214 (United States); Browning, Jim [Department of Electrical and Computer Engineering, Boise State University, Boise, Idaho 83725 (United States); Lin, Ming-Chieh [Department of Electrical and Biomedical Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Smithe, David N. [Tech-X Corporation, 5621 Arapahoe Ave, Boulder, Colorado 80303 (United States); Watrous, Jack [Confluent Sciences, LLC, Albuquerque, New Mexico 87111 (United States)

    2016-01-28

    Phase-control of a magnetron is studied via simulation using a combination of a continuous current source and a modulated current source. The addressable, modulated current source is turned ON and OFF at the magnetron operating frequency in order to control the electron injection and the spoke phase. Prior simulation work using a 2D model of a Rising Sun magnetron showed that the use of 100% modulated current controlled the magnetron phase and allowed for dynamic phase control. In this work, the minimum fraction of modulated current source needed to achieve a phase control is studied. The current fractions (modulated versus continuous) were varied from 10% modulated current to 100% modulated current to study the effects on phase control. Dynamic phase-control, stability, and start up time of the device were studied for all these cases showing that with 10% modulated current and 90% continuous current, a phase shift of 180° can be achieved demonstrating dynamic phase control.

  19. A partial gene deletion of SLC45A2 causes oculocutaneous albinism in Doberman pinscher dogs.

    Directory of Open Access Journals (Sweden)

    Paige A Winkler

    Full Text Available The first white Doberman pinscher (WDP dog was registered by the American Kennel Club in 1976. The novelty of the white coat color resulted in extensive line breeding of this dog and her offspring. The WDP phenotype closely resembles human oculocutaneous albinism (OCA and clinicians noticed a seemingly high prevalence of pigmented masses on these dogs. This study had three specific aims: (1 produce a detailed description of the ocular phenotype of WDPs, (2 objectively determine if an increased prevalence of ocular and cutaneous melanocytic tumors was present in WDPs, and (3 determine if a genetic mutation in any of the genes known to cause human OCA is causal for the WDP phenotype. WDPs have a consistent ocular phenotype of photophobia, hypopigmented adnexal structures, blue irides with a tan periphery and hypopigmented retinal pigment epithelium and choroid. WDPs have a higher prevalence of cutaneous melanocytic neoplasms compared with control standard color Doberman pinschers (SDPs; cutaneous tumors were noted in 12/20 WDP (5 years of age: 8/8 and 1/20 SDPs (p<0.00001. Using exclusion analysis, four OCA causative genes were investigated for their association with WDP phenotype; TYR, OCA2, TYRP1 and SLC45A2. SLC45A2 was found to be linked to the phenotype and gene sequencing revealed a 4,081 base pair deletion resulting in loss of the terminus of exon seven of SLC45A2 (chr4∶77,062,968-77,067,051. This mutation is highly likely to be the cause of the WDP phenotype and is supported by a lack of detectable SLC45A2 transcript levels by reverse transcriptase PCR. The WDP provides a valuable model for studying OCA4 visual disturbances and melanocytic neoplasms in a large animal model.

  20. Delayed onset of congenital hereditary endothelial dystrophy due to compound heterozygous SLC4A11 mutations

    Directory of Open Access Journals (Sweden)

    Babu Lal Kumawat

    2016-01-01

    Full Text Available Background: Congenital hereditary endothelial dystrophy (CHED is an autosomal recessive disorder characterized by bilateral, symmetrical, noninflammatory corneal clouding (edema present at birth or shortly thereafter. This study reports on an unusual delayed presentation of CHED with compound heterozygous SLC4A11 mutations. Materials and Methods: A 45-year-old female, presenting with bilateral decreased vision since childhood that deteriorated in the last 5 years, was evaluated to rule out trauma, viral illness, chemical injury, glaucoma, and corneal endothelial dystrophies. Tear sample was sent for herpes simplex viral (HSV antigen testing. Genomic DNA from peripheral blood was screened for mutations in all exons of SLC4A11 by direct sequencing. Full-thickness penetrating keratoplasty was done and corneal button was sent for histopathological examination. Results: Slit-lamp findings revealed bilateral diffuse corneal edema and left eye spheroidal degeneration with scarring. Increased corneal thickness (762 μm and 854 μm in the right and left eyes, respectively, normal intraocular pressure (12 mmHg and 16 mmHg in the right and left eyes, respectively, inconclusive confocal scan, and specular microscopy, near normal tear film parameters, were the other clinical features. HSV-polymerase chain reaction was negative. Histopathological examination revealed markedly thickened Descemet′s membrane with subepithelial spheroidal degeneration. SLC4A11 screening showed a novel variant p.Ser415Asn, reported mutation p.Cys386Arg and two polymorphisms, all in the heterozygous state and not identified in 100 controls. Conclusions: The study shows, for the first time, compound heterozygous SLC4A11 mutations impair protein function leading to delayed onset of the disease.

  1. A Self-Oscillating Control Scheme for a Boost Converter Providing a Controlled Output Current

    DEFF Research Database (Denmark)

    Knott, Arnold; Pfaffinger, Gerhard R.; Andersen, Michael A. E.

    2011-01-01

    Most switched mode power supplies provide a regulated voltage at their output. However, there are applications requiring a controlled current. Among others are battery chargers, test equipment for converters driven by solar cells, and LED drivers. This paper describes a dc–dc power converter real...

  2. Boric acid increases the expression levels of human anion exchanger genes SLC4A2 and SLC4A3.

    Science.gov (United States)

    Akbas, F; Aydin, Z

    2012-04-03

    Boron is an important micronutrient in plants and animals. The role of boron in living systems includes coordinated regulation of gene expression, growth and proliferation of higher plants and animals. There are several well-defined genes associated with boron transportation and tolerance in plants and these genes show close homology with human anion exchanger genes. Mutation of these genes also characterizes some genetic disorders. We investigated the toxic effects of boric acid on HEK293 cells and mRNA expression of anion exchanger (SLC4A1, SLC4A2 and SLC4A3) genes. Cytotoxicity of boric acid at different concentrations was tested by using the methylthiazolyldiphenyl-tetrazolium bromide assay. Gene expression profiles were examined using quantitative real-time PCR. In the HEK293 cells, the nontoxic upper concentration of boric acid was 250 μM; more than 500 μM caused cytotoxicity. The 250 μM boric acid concentration increased gene expression level of SLC4A2 up to 8.6-fold and SLC4A3 up to 2.6-fold, after 36-h incubation. There was no significant effect of boric acid on SLC4A1 mRNA expression levels.

  3. Solute Carrier Family 26 Member a2 (slc26a2 Regulates Otic Development and Hair Cell Survival in Zebrafish.

    Directory of Open Access Journals (Sweden)

    Fei Liu

    Full Text Available Hearing loss is one of the most prevalent human birth defects. Genetic factors contribute to the pathogenesis of deafness. It is estimated that one-third of deafness genes have already been identified. The current work is an attempt to find novel genes relevant to hearing loss using guilt-by-profiling and guilt-by-association bioinformatics analyses of approximately 80 known non-syndromic hereditary hearing loss (NSHL genes. Among the 300 newly identified candidate deafness genes, slc26a2 were selected for functional studies in zebrafish. The slc26a2 gene was knocked down using an antisense morpholino (MO, and significant defects were observed in otolith patterns, semicircular canal morphology, and lateral neuromast distributions in morphants. Loss-of-function defects are caused primarily by apoptosis, and morphants are insensitive to sound stimulation and imbalanced swimming behaviours. Morphant defects were found to be partially rescued by co-injection of human SLC26A2 mRNA. All the results suggest that bioinformatics is capable of predicting new deafness genes and this showed slc26a2 is to be a critical otic gene whose dysfunction may induce hearing impairment.

  4. Steam generator degradation: Current mitigation strategies for controlling corrosion

    Energy Technology Data Exchange (ETDEWEB)

    Millett, P. [Electric Power Research Institute, Palo Alto, CA (United States)

    1997-02-01

    Steam Generator degradation has caused substantial losses of power generation, resulted in large repair and maintenance costs, and contributed to significant personnel radiation exposures in Pressurized Water Reactors (PWRs) operating throughout the world. EPRI has just published the revised Steam Generator Reference Book, which reviews all of the major forms of SG degradation. This paper discusses the types of SG degradation that have been experienced with emphasis on the mitigation strategies that have been developed and implemented in the field. SG degradation is presented from a world wide perspective as all countries operating PWRs have been effected to one degree or another. The paper is written from a US. perspective where the utility industry is currently undergoing tremendous change as a result of deregulation of the electricity marketplace. Competitive pressures are causing utilities to strive to reduce Operations and Maintenance (O&M) and capital costs. SG corrosion is a major contributor to the O&M costs of PWR plants, and therefore US utilities are evaluating and implementing the most cost effective solutions to their corrosion problems. Mitigation strategies developed over the past few years reflect a trend towards plant specific solutions to SG corrosion problems. Since SG degradation is in most cases an economic problem and not a safety problem, utilities can focus their mitigation strategies on their unique financial situation. Accordingly, the focus of R&D has shifted from the development of more expensive, prescriptive solutions (e.g. reduced impurity limits) to corrosion problems to providing the utilities with a number of cost effective mitigation options (e.g. molar ratio control, boric acid treatment).

  5. Effects of Weile Powder on Bicarbonate Transporters CFTR SLC26A3 and SLC26A6 in Gastric Ulcers of Rats%胃乐散对大鼠胃溃疡黏膜碳酸氢盐转运蛋白CFTR、SLC26A3及SLC26A6的作用

    Institute of Scientific and Technical Information of China (English)

    文国容; 徐靖宇; 刘雪梅; 赵正兰; 江义霞; 谢睿; 陈萍; 余丽梅; 庹必光

    2013-01-01

    Objective To investigate the effects of Weile Powder (WLP)on bicarbonate transporters in rats with gastric ulcers, and to probe its functional mechanisms. Methods The 48 SD rats were randomly divided into the normal control group, the model group, the low dose WLP group (at the daily dose of 0. 075 g/mL), the middle dose WLP group (at the daily dose of 0. 150 g/mL), the high dose WLP group (at the daily dose of 0. 030 g/mL), and the ranitidine group (at the daily dose of 0. 030 g/mL), 8 in each group. The gastric ulcer rat model was prepared by the glacial acetic acid cauterization method. Rats in each medication group were administered from the 2nd day of modeling. Rats were sacrificed after 14-day successive medication. The protein was extracted from the ulcer tissue. The protein expressions of solute carrier26A3 (SLC26A3)and solute carrier26A6 (SLC26A6)were detected using Western blot. The gastric ulcer and its peripheral tissue were sectioned. The changes of cystic fibrosis transmem-brane conductance regulator (CFTR)were measured by immunofluorescence. Results Compared with the model control group, the expression levels of SLC26A3 increased in the high dose WLP group and the ranitidine group with statistical difference (P <0. 05). The expression levels of SLC26A6 increased in the high and middle dose WLP groups and the ranitidine group with statistical difference (P <0. 05). The ex- pression level of CFTR also obviously increased in the high and middle dose WLP groups (P <0.01 ). Conclusion WLP could elevate the expression levels of SLC26A6, SLC26A3 , and CFTR, increase the secretion of bicarbonate, thus protecting the gastric mucosa.%目的 研究胃乐散对大鼠胃溃疡黏膜碳酸氢盐分泌的影响,并探讨其作用机制.方法 SD大鼠48只,随机分为正常对照组,模型组,胃乐散低剂量组[0.075 g/(mL·kg)]、中剂量组[0.150 g/(mL·kg)]、高剂量组[0.300 g/(mL·kg)]和雷尼替丁组[0.030 g/(mL·kg)],每组8只.采用冰醋酸烧

  6. The SLC28 (CNT) and SLC29 (ENT) nucleoside transporter families: a 30-year collaborative odyssey.

    Science.gov (United States)

    Young, James D

    2016-06-15

    Specialized nucleoside transporter (NT) proteins are required for passage of nucleosides and hydrophilic nucleoside analogues across biological membranes. Physiologic nucleosides serve as central salvage metabolites in nucleotide biosynthesis, and nucleoside analogues are used as chemotherapeutic agents in the treatment of cancer and antiviral diseases. The nucleoside adenosine modulates numerous cellular events via purino-receptor cell signalling pathways. Human NTs are divided into two structurally unrelated protein families: the SLC28 concentrative nucleoside transporter (CNT) family and the SLC29 equilibrative nucleoside transporter (ENT) family. Human CNTs are inwardly directed Na(+)-dependent nucleoside transporters found predominantly in intestinal and renal epithelial and other specialized cell types. Human ENTs mediate bidirectional fluxes of purine and pyrimidine nucleosides down their concentration gradients and are ubiquitously found in most, possibly all, cell types. Both protein families are evolutionarily old: CNTs are present in both eukaryotes and prokaryotes; ENTs are widely distributed in mammalian, lower vertebrate and other eukaryote species. This mini-review describes a 30-year collaboration with Professor Stephen Baldwin to identify and understand the structures and functions of these physiologically and clinically important transport proteins.

  7. A linearly controlled direct-current power source for high-current inductive loads in a magnetic suspension wind tunnel

    Science.gov (United States)

    Tripp, John S.; Daniels, Taumi S.

    1990-01-01

    The NASA Langley 6 inch magnetic suspension and balance system (MSBS) requires an independently controlled bidirectional DC power source for each of six positioning electromagnets. These electromagnets provide five-degree-of-freedom control over a suspended aerodynamic test model. Existing power equipment, which employs resistance coupled thyratron controlled rectifiers as well as AC to DC motor generator converters, is obsolete, inefficient, and unreliable. A replacement six phase bidirectional controlled bridge rectifier is proposed, which employs power MOSFET switches sequenced by hybrid analog/digital circuits. Full load efficiency is 80 percent compared to 25 percent for the resistance coupled thyratron system. Current feedback provides high control linearity, adjustable current limiting, and current overload protection. A quenching circuit suppresses inductive voltage impulses. It is shown that 20 kHz interference from positioning magnet power into MSBS electromagnetic model position sensors results predominantly from capacitively coupled electric fields. Hence, proper shielding and grounding techniques are necessary. Inductively coupled magnetic interference is negligible.

  8. A linearly controlled direct-current power source for high-current inductive loads in a magnetic suspension wind tunnel

    Science.gov (United States)

    Tripp, John S.; Daniels, Taumi S.

    1990-08-01

    The NASA Langley 6 inch magnetic suspension and balance system (MSBS) requires an independently controlled bidirectional DC power source for each of six positioning electromagnets. These electromagnets provide five-degree-of-freedom control over a suspended aerodynamic test model. Existing power equipment, which employs resistance coupled thyratron controlled rectifiers as well as AC to DC motor generator converters, is obsolete, inefficient, and unreliable. A replacement six phase bidirectional controlled bridge rectifier is proposed, which employs power MOSFET switches sequenced by hybrid analog/digital circuits. Full load efficiency is 80 percent compared to 25 percent for the resistance coupled thyratron system. Current feedback provides high control linearity, adjustable current limiting, and current overload protection. A quenching circuit suppresses inductive voltage impulses. It is shown that 20 kHz interference from positioning magnet power into MSBS electromagnetic model position sensors results predominantly from capacitively coupled electric fields. Hence, proper shielding and grounding techniques are necessary. Inductively coupled magnetic interference is negligible.

  9. Serotonin transporter gene (SLC6A4) polymorphism and susceptibility to a home-visiting maternal-infant attachment intervention delivered by community health workers in South Africa: Reanalysis of a randomized controlled trial

    Science.gov (United States)

    Moser, Dirk; Skeen, Sarah; Cooper, Peter; Murray, Lynne; Moran, Greg

    2017-01-01

    is a misleading index of efficacy. The study raises questions about how policy-makers deal with the challenge of balancing equity (equal treatment for all) and efficacy (treating only those whose genes render them likely to benefit) when implementing psychosocial interventions. Trial Registration Current Controlled Trials ISRCTN25664149 PMID:28245280

  10. Risk and protective genetic variants in suicidal behaviour: association with SLC1A2, SLC1A3, 5-HTR1B &NTRK2 polymorphisms.

    LENUS (Irish Health Repository)

    Murphy, Therese M

    2012-02-01

    BACKGROUND: Suicidal behaviour is known to aggregate in families. Patients with psychiatric disorders are at higher risk for suicide attempts (SA), however protective and risk genetic variants for suicide appear to be independent of underlying psychiatric disorders. Here we investigate genetic variants in genes important for neurobiological pathways linked to suicidal behaviour and\\/or associated endophenotypes, for association with SA among patients with co-existing psychiatric illness. Selected gene-gene and gene-environment interactions were also tested. METHODS: DNA was obtained from bloods of 159 patients (76 suicide attempters and 83 non-attempters), who were profiled for DSM-IV Axis I psychiatric diagnosis. Twenty-eight single nucleotide polymorphisms (SNPs) from 18 candidate genes (COMT, 5-HT2A, 5-HT1A, 5-HTR1B, TPH1, MAO-A, TPH2, DBH, CNR1, BDNF, ABCG1, GABRA5, GABRG2, GABRB2, SLC1A2, SLC1A3, NTRK2, CRHR1) were genotyped. Genotyping was performed by KBioscience. Tests of association between genetic variants and SA were conducted using Chi squared and Armitage Trend tests. Binary logistical regression analyses were performed to evaluate the contribution of individual genetic variants to the prediction of SA, and to examine SNPs for potential gene-gene and gene-environment interactions. RESULTS: Our analysis identified 4 SNPs (rs4755404, rs2269272, rs6296 and rs1659400), which showed evidence of association with SA compared to a non-attempter control group. We provide evidence of a 3-locus gene-gene interaction, and a putative gene-environment interaction, whereby genetic variation at the NTRK2 locus may moderate the risk associated with history of childhood abuse. CONCLUSION: Preliminary findings suggest that allelic variability in SLC1A2\\/3, 5-HTR1B and NTRK2 may be relevant to the underlying diathesis for suicidal acts.

  11. A New Type Hi-Speed BLDC Control System Base on Indirect Current Control Strategy

    Science.gov (United States)

    Wang, D. P.; Wang, Y. C.; Zhang, F. G.; Jin, S.

    2017-05-01

    High speed BLDC has the characteristic as larger air gap smaller armature inductance, traditional PWM modulation will produce a great number of high frequency current harmonics which led problem like large torque ripple and serious motor heat. In the meantime traditional PWM modulation use the diode rectifier which cause harmonic pollution in electric power net. To solve the problem above, proposes a new motor controller topology. Using the IGBT device to replace the diode on frequency converter rectifier side, apply the power factor correction technology, reduce the pollution on the grid. Using busbar current modulation on the inverter, driving bridge-arm use 3-phase 6-state open as driving Mode, realize the control on a 10000r/min,10kw BLDC. The results of Simulation on matlab show the topological structure as proposed can effectively improve the network side power factor and reduce the motor armature winding harmonic and motor torque ripple.

  12. Modeling and Control of Impressed Current Cathodic Protection (ICCP System

    Directory of Open Access Journals (Sweden)

    Marwah S.Hashim

    2012-12-01

    Full Text Available The corrosion of metallic structures buried in soil or submerged in water which became a problem of worldwide significance and causes most of the deterioration in petroleum industry can be controlled by cathodic protection (CP.CP is a popular technique used to minimize the corrosion of metals in a variety of large structures. To prevent corrosion, voltage between the protection metal and the auxiliary anode has to be controlled on a desired level. In this study two types of controllers will be used to set a pipeline potential at required protection level. The first one is a conventional Proportional-Integral-Derivative (PID controller and the second are intelligent controllers (fuzzy and neural controllers.The results were simulated and implemented using MATLAB R 2010a program which offers predefined functions to develop PID, fuzzy and neural control systems.

  13. Micromagnetic analysis of geometrically controlled current-driven magnetization switching

    Directory of Open Access Journals (Sweden)

    O. Alejos

    2017-05-01

    Full Text Available The magnetization dynamics induced by current pulses in a pair of two “S-shaped” ferromagnetic elements, each one consisting on two oppositely tilted tapered spikes at the ends of a straight section, is theoretically studied by means of micromagnetic simulations. Our results indicate that the magnetization reversal is triggered by thermal activation, which assists the current-induced domain nucleation and the propagation of domain walls. The detailed analysis of the magnetization dynamics reveals that the magnetization switching is only achieved when a single domain wall is nucleated in the correct corner of the element. In agreement with recent experimental studies, the switching is purely dictated by the shape, being independent of the current polarity. The statistical study points out that successful switching is only achieved within a narrow range of the current pulse amplitudes.

  14. Concepts Concerning 'Disease' Causation, Control, and the current ...

    African Journals Online (AJOL)

    2008-12-05

    Dec 5, 2008 ... specific reference to the current cholera outbreak in Zimbabwe and its effects on the ... Concepts concerning the cause of disease transformed with the ..... inform the public as to the nature, cause and prevention of cholera.16.

  15. Distributed Secondary Control for DC Microgrid Applications with Enhanced Current Sharing Accuracy

    DEFF Research Database (Denmark)

    Lu, Xiaonan; Guerrero, Josep M.; Sun, Kai

    2013-01-01

    are used locally as the distributed secondary controllers in each converter to enhance the current sharing accuracy and restore the dc bus voltage simultaneously. All the controllers are realized locally and the LBC system is only used for changing the data of dc voltage and current. Thus, a decentralized......, a distributed secondary control method is proposed. Droop control is employed as the primary control method for load current sharing. Meanwhile, the dc output voltage and current in each module is transferred to the others by the low bandwidth communication (LBC) network. Average voltage and current controllers...

  16. Human SLC26A1 Gene Variants: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Paul A. Dawson

    2013-01-01

    Full Text Available Kidney stones are a global health problem, incurring massive health costs annually. Why stones recur in many patients remains unknown but likely involves environmental, physiological, and genetic factors. The solute linked carrier (SLC 26A1 gene has previously been linked to kidney stones in mice. SLC26A1 encodes the sulfate anion transporter 1 (SAT1 protein, and its loss in mice leads to hyperoxaluria and calcium oxalate renal stones. To investigate the possible involvement of SAT1 in human urolithiasis, we screened the SLC26A1 gene in a cohort of 13 individuals with recurrent calcium oxalate urolithiasis, which is the commonest type. DNA sequence analyses showed missense mutations in seven patients: one individual was heterozygous R372H; 4 individuals were heterozygous Q556R; one patient was homozygous Q556R; and one patient with severe nephrocalcinosis (requiring nephrectomy was homozygous Q556R and heterozygous M132T. The M132 amino acid in human SAT1 is conserved with 15 other species and is located within the third transmembrane domain of the predicted SAT1 protein structure, suggesting that this amino acid may be important for SAT1 function. These initial findings demonstrate genetic variants in SLC26A1 of recurrent stone formers and warrant wider independent studies of SLC26A1 in humans with recurrent calcium oxalate stones.

  17. Wave-current interaction, experiments with controlled uniform shear

    Science.gov (United States)

    Simon, Bruno; Touboul, Julien; Rey, Vincent

    2016-04-01

    Vertically varying currents have a non negligible impact on the propagation of waves. Even though the analytical aspect of the interaction between wave and sheared current is being an active subject of research, experimental data remain rare. Here, the effects of a uniformly shear were investigated in the 10 m long by 0.3 m wide wave flume of the Université de Toulon, France. The main difficulty of the study was to produce several conditions of current with constant shear (du/dz = cst) that would persist along the channel. This was achieved by using curved wire screens upstream the channel (Dunn and Tavoularis, 2007). The geometry and properties of the screens were adjusted to deflect the streamline towards the channel bed or the free surface in order to change the velocity profile. The study focused on regular wave propagating against the current for several wave frequencies and amplitudes. Properties of the free surface and flow velocity are discussed for current with positive and negative shear in order to quantify the influence of the current on the waves. ACKNOWLEDGEMENTS The DGA (Direction Générale de l'Armement, France) is acknowledged for its financial support through the ANR grant N° ANR-13-ASTR-0007.

  18. Mouse Slc4a11 expressed in Xenopus oocytes is an ideally selective H+/OH- conductance pathway that is stimulated by rises in intracellular and extracellular pH.

    Science.gov (United States)

    Myers, Evan J; Marshall, Aniko; Jennings, Michael L; Parker, Mark D

    2016-12-01

    The SLC4A11 gene encodes the bicarbonate-transporter-related protein BTR1, which is mutated in syndromes characterized by vision and hearing loss. Signs of these diseases [congenital hereditary endothelial dystrophy (CHED) and Harboyan syndrome] are evident in mouse models of Slc4a11 disruption. However, the intrinsic activity of Slc4a11 remains controversial, complicating assignment of its (patho)physiological role. Most studies concur that Slc4a11 transports H(+) (or the thermodynamically equivalent species OH(-)) rather than HCO3(-), but disparities have arisen as to whether the transport is coupled to another species such as Na(+) or NH3/NH4(+) Here for the first time, we examine the action of mouse Slc4a11 in Xenopus oocytes. We simultaneously monitor changes in intracellular pH, membrane potential, and conductance as we alter extracellular pH, revealing the electrical and chemical driving forces that underlie the observed ion fluxes. We find that mSlc4a11 is an ideally selective H(+)/OH(-) conductive pathway, the action of which is uncoupled from the cotransport of any other ion. We also find that the activity of mSlc4a11 is independently enhanced by both extracellular and intracellular alkalinization, suggesting OH(-) as the most likely substrate and providing a novel explanation for the apparent NH3-dependence of Slc4a11-mediated currents reported by others. We suggest that the unique properties of Slc4a11 action underlie its value as a pH regulator in corneal endothelial cells. Copyright © 2016 the American Physiological Society.

  19. The current issues of internal control and internal audit harmonization

    OpenAIRE

    Синюгіна, Наталія Вікторівна

    2013-01-01

    The relevance of topics related to a harmonization of internal control and internal audit system of internal financial control is being proved. It is high lightened the essence of harmonization period by reviewing existing thoughts on this object, a concept of 'harmonization of internal control and internal audit", and provided reasonably practical recommendations to ensure such harmonization in the modern world. The scientific impact of this research is to clarify the concept of "harmonizati...

  20. A systematic review of current and emergent manipulator control approaches

    Science.gov (United States)

    Ajwad, Syed Ali; Iqbal, Jamshed; Ullah, Muhammad Imran; Mehmood, Adeel

    2015-06-01

    Pressing demands of productivity and accuracy in today's robotic applications have highlighted an urge to replace classical control strategies with their modern control counterparts. This recent trend is further justified by the fact that the robotic manipulators have complex nonlinear dynamic structure with uncertain parameters. Highlighting the authors' research achievements in the domain of manipulator design and control, this paper presents a systematic and comprehensive review of the state-of-the-art control techniques that find enormous potential in controlling manipulators to execute cuttingedge applications. In particular, three kinds of strategies, i.e., intelligent proportional-integral-derivative (PID) scheme, robust control and adaptation based approaches, are reviewed. Future trend in the subject area is commented. Open-source simulators to facilitate controller design are also tabulated. With a comprehensive list of references, it is anticipated that the review will act as a firsthand reference for researchers, engineers and industrialinterns to realize the control laws for multi-degree of freedom (DOF) manipulators.

  1. Management and employee control in current industrial work

    DEFF Research Database (Denmark)

    Holt, Helle; Hvid, Helge

    2014-01-01

    This article examines how employee control is affected by the ongoing erosion of boundaries in work organization and established boundaries in the relationship between employees and management. One assumption is that the erosion of boundaries offers potential for increased employee control, meaning...

  2. Control of Hall angle of Skyrmion driven by electric current

    Science.gov (United States)

    Gao-Bin, Liu; Da, Li; de Chatel, P. F.; Jian, Wang; Wei, Liu; Zhi-Dong, Zhang

    2016-06-01

    Skyrmions are very promising for applications in spintronics and magnetic memory. It is desired to manipulate and operate a single skyrmion. Here we report on the thermal effect on the motion of current-driven magnetic Skyrmions in magnetic metal. The results show that the magnon current induced by the thermal gradient acts on Skyrmions via magnonic spin-transfer torque, an effect of the transverse and longitudinal Skyrmions drift velocities, thus leading to the effective manipulation of the Hall angle through the ratio of thermal gradient to electric current density, which can be used as a Skyrmion valve. Project supported by the National Natural Science Foundation of China (Grant No. 51331006) and the Fund from the Chinese Academy of Sciences (Grant No. KJZD-EW-M05).

  3. Management and Employee Control in Current Industrial Work

    Directory of Open Access Journals (Sweden)

    Helle Holt

    2014-09-01

    Full Text Available This article examines how employee control is affected by the ongoing erosion of boundaries in work organization and established boundaries in the relationship between employees and management. One assumption is that the erosion of boundaries offers potential for increased employee control, meaning increased autonomy or self-determination at work (employee control how and when to do what. This assumption is supported by theories on the psychosocial working environment. Another assumption is that the erosion of boundaries threatens the frontiers from where employees can defend their interests, and consequently reduces employees’ control of their work (what and how much to do. This assumption is supported by “labor process theory.” This article studies control and the erosion of boundaries in two case factories in the food industry. Two perspectives are applied: the psychosocial working environment and “labor process theory.”

  4. Pulse current gas metal arc welding characteristics, control and applications

    CERN Document Server

    Ghosh, Prakriti Kumar

    2017-01-01

    This monograph is a first-of-its-kind compilation on high deposition pulse current GMAW process. The nine chapters of this monograph may serve as a comprehensive knowledge tool to use advanced welding engineering in prospective applications. The contents of this book will prove useful to the shop floor welding engineer in handling this otherwise critical welding process with confidence. It will also serve to inspire researchers to think critically on more versatile applications of the unique nature of pulse current in GMAW process to develop cutting edge welding technology.

  5. Controlling charge current through a DNA based molecular transistor

    Science.gov (United States)

    Behnia, S.; Fathizadeh, S.; Ziaei, J.

    2017-01-01

    Molecular electronics is complementary to silicon-based electronics and may induce electronic functions which are difficult to obtain with conventional technology. We have considered a DNA based molecular transistor and study its transport properties. The appropriate DNA sequence as a central chain in molecular transistor and the functional interval for applied voltages is obtained. I-V characteristic diagram shows the rectifier behavior as well as the negative differential resistance phenomenon of DNA transistor. We have observed the nearly periodic behavior in the current flowing through DNA. It is reported that there is a critical gate voltage for each applied bias which above it, the electrical current is always positive.

  6. Improvement of tokamak confinement by current profile control

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Kimitaka (National Inst. for Fusion Science, Nagoya (Japan)); Itoh, Sanae; Yagi, Masatoshi; Fukuyama, Atsushi; Azumi, Masafumi

    1993-12-01

    Impact of the current profile on the anomalous transport coefficients in tokamaks is discussed, based on the recent progress of the anomalous transport theory. When the central q-value is elevated above unity, the geometry turns to the magnetic well, and the anomalous transport is reduced. If the negative shear is realized, the anomalous transport is further reduced. The confinement improvement phenomena associated with the lower hybrid wave current drive and with high [beta][sub p] experiments are discussed as an application of this model. A motivation of the research on the steady state plasmas is also discussed. (author).

  7. Essay: Bob Siemann-SLC Days at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Raubenheimer, Tor O.; /SLAC

    2011-11-14

    Bob Siemann was a great experimentalist and an excellent teacher.We will greatly miss him. Bob came to SLAC in early 1991 to work on the Stanford Linear Collider (SLC). The SLC was a challenging accelerator which began operating in the late 1980's but still had numerous obstacles to be overcome years into operation. One of the compounding difficulties was making reproducible measurements, since the stability of the collider was poor and the diagnostics were insufficient. Bob dove into this challenge and helped design experiments and diagnostics that provided further clarity. I first got to know Bob while I was still a graduate student, trying to finish my thesis and performing some experimental studies on the SLC, which, at the time, was proving to be very difficult. Most of my expertise had been in beam theory and simulation. Dealing with the real issues of the accelerator was challenging. Bob helped me understand the difference between systematic and statistical errors, and separate operational issues from the fundamental physics. His way of teaching was not to provide an explanation but to ask enough questions so that I could find the answer on my own - this was the best way to learn. I later asked Bob to be a reader on my thesis. As in all things, he took this role extremely seriously. He read through the draft and marked every page to the point where I was regretting my decision. However, his questions again helped me understand my own work better and greatly improved my thesis. Bob was also the de facto leader of an effort focused on the damping rings and the bunch compressors. He was great to work with. He made people think for themselves and refused to simply provide answers. He also worked hard himself, expressing real interest and curiosity. After the studies of the SLC damping rings identified a sawtooth instability due to the vacuum chamber impedance as a source of many downstream fluctuations, Bob took charge of upgrading the rings. As part of

  8. No Association of BDNF, COMT, MAOA, SLC6A3, and SLC6A4 Genes and Depressive Symptoms in a Sample of Healthy Colombian Subjects

    Directory of Open Access Journals (Sweden)

    Yeimy González-Giraldo

    2015-01-01

    Full Text Available Background. Major depressive disorder (MDD is the second cause of years lived with disability around the world. A large number of studies have been carried out to identify genetic risk factors for MDD and related endophenotypes, mainly in populations of European and Asian descent, with conflicting results. The main aim of the current study was to analyze the possible association of five candidate genes and depressive symptoms in a Colombian sample of healthy subjects. Methods and Materials. The Spanish adaptation of the Hospital Anxiety and Depression Scale (HADS was applied to one hundred eighty-eight healthy Colombian subjects. Five functional polymorphisms were genotyped using PCR-based assays: BDNF-Val66Met (rs6265, COMT-Val158Met (rs4680, SLC6A4-HTTLPR (rs4795541, MAOA-uVNTR, and SLC6A3-VNTR (rs28363170. Result. We did not find significant associations with scores of depressive symptoms, derived from the HADS, for any of the five candidate genes (nominal p values >0.05. In addition, we did not find evidence of significant gene-gene interactions. Conclusion. This work is one of the first studies of candidate genes for depressive symptoms in a Latin American sample. Study of additional genetic and epigenetic variants, taking into account other pathophysiological theories, will help to identify novel candidates for MDD in populations around the world.

  9. Measles: Current Status and Outbreak Control on Campus.

    Science.gov (United States)

    Amler, Robert W.; Orenstein, Walter A.

    1984-01-01

    The current effort to eliminate measles in the United States has caused record low levels of the disease. This strategy must continue to be applied in order to break the transmission of measles on college campuses through high immunization levels, promotion of rapid reporting of cases, and quick responses to outbreaks. (Author/DF)

  10. Schmitt Trigger with Controllable Hysteresis Using Current Conveyors

    Directory of Open Access Journals (Sweden)

    Jiri Misurec

    2012-07-01

    Full Text Available Active elements working in the current or mixed mode are still attractive for the design of analog functional blocks. The current conveyor (CC was defined already in 1968. This paper deals with hysteresis comparators using second generation current conveyor. The comparator is basically a pulse circuit. In these circuits, the maximum rate of change in the output voltage is required during switching from one state to another. In comparators with operational amplifiers the switching time is given by the slew rate of the operational amplifier used, which is not too high. If a current conveyor is used, the time of switching the comparator gets shorter. The comparator is capable to operate at a higher frequency bands and if it is used, for example, in converters, a higher operating frequency can be reached. The connection of an inverting and a non-inverting comparator with adjustable hysteresis is shown as a practical implementation. Using the AD844, results of experimental measurements are presented that confirm the theoretical  assumptions and the results of computer simulation.

  11. Robust Current Control of Doubly Fed Wind Turbine Generator under Unbalanced Grid Voltage Conditions

    DEFF Research Database (Denmark)

    Wang, Yun; Gong, Wenming; Wu, Qiuwei

    2014-01-01

    This paper presents the design of a H ∞ current controller for doubly fed induction generators (DFIGs) in order to maintain stable operation under unbalanced voltage conditions. The H ∞ current controller has a multi-input and multi-output (MIMO) structure and is designed using the loop shaping...... method. Case studies have been carried out in order to verify the efficacy of the proposed H ∞ current controller for DFIGs. The case study results show that the proposed H ∞ current controller can realize different control objectives, i.e. stable stator current, stable stator active power and stable...

  12. Association of rare variation in the glutamate receptor gene SLC1A2 with susceptibility to bipolar disorder and schizophrenia.

    Science.gov (United States)

    Fiorentino, Alessia; Sharp, Sally I; McQuillin, Andrew

    2015-09-01

    The SLC1A2 gene encodes the excitatory amino acid transporter 2 (EAAT2). Glutamate is the major mediator of excitatory neurotransmission and EAAT2 is responsible for clearing the neurotransmitter from the synaptic cleft. Genetic variation in SLC1A2 has been implicated in a range of neurological and neuropsychiatric conditions including schizophrenia (SZ), autism and in core phenotypes of bipolar disorder (BD). The coding and putative regulatory regions of SLC1A2 gene were screened for variants using high resolution melting or sequenced in 1099 or in 32 BD subjects. Thirty-two variants were detected in the SLC1A2 gene. Fifteen potentially etiological variants were selected for genotyping in 1099 BD and 1095 control samples. Five amino acid changing variants were also genotyped in 630 participants suffering from SZ. None of the variants were found to be associated with BD or SZ or with the two diseases combined. However, two recurrent missense variants (rs145827578:G>A, p.(G6S); rs199599866:G>A, p.(R31Q)) and one recurrent 5'-untranslated region (UTR) variant (ss825678885:G>T) were detected in cases only. Combined analysis of the recurrent-case-only missense variants and of the case-only missense and 5'-UTR variants showed nominal evidence for association with the combined diseases (Fisher's P=0.019 and 0.0076). These findings are exploratory in nature and await replication in larger cohorts, however, they provide intriguing evidence that potentially functional rare variants in the SLC1A2 gene may confer susceptibility to psychotic disorders.

  13. Helicobacter pylori Infection Is Associated with Decreased Expression of SLC5A8, a Cancer Suppressor Gene, in Young Children

    Science.gov (United States)

    Orellana-Manzano, Andrea; O'Ryan, Miguel G.; Lagomarcino, Anne J.; George, Sergio; Muñoz, Mindy S.; Mamani, Nora; Serrano, Carolina A.; Harris, Paul R.; Ramilo, Octavio; Mejías, Asunción; Torres, Juan P.; Lucero, Yalda; Quest, Andrew F. G.

    2016-01-01

    Background: Helicobacter pylori infects half of the world's population and causes gastric cancer in a subset of infected adults. Previous blood microarray findings showed that apparently healthy children, persistently infected with H. pylori have differential gene expression compared to age-matched, non-infected children. SLC5A8, a cancer suppressor gene with decreased expression among infected children, was chosen for further study based on bioinformatics analysis. Methods: A pilot study was conducted using specific qRT-PCR amplification of SLC5A8 in blood samples from H. pylori infected and non-infected children, followed by a larger, blinded, case-control study. We then analyzed gastric tissue from H. pylori infected and non-infected children undergoing endoscopy for clinical purposes. Results: Demographics, clinical findings, and family history were similar between groups. SLC5A8 expression was decreased in infected vs. non-infected children in blood, 0.12 (IQR: 0–0.89) vs. 1.86 (IQR: 0–8.94, P = 0.002), and in gastric tissue, 0.08 (IQR: 0.04–0.15) vs. 1.88 (IQR: 0.55–2.56; P = 0.001). Children who were both stool positive and seropositive for H. pylori had the lowest SLC5A8 expression levels. Conclusions: H. pylori infection is associated with suppression of SCL5A8, a cancer suppressor gene, in both blood and tissue samples from young children. Key Points: Young children, persistently infected with Helicobacter pylori show decreased expression of SLC5A8 mRNA in both blood and tissue samples as compared to non-infected children. PMID:27777899

  14. Heterogeneous nucleation - current transients under chemical reaction control

    CERN Document Server

    D'Ajello-Tettamanzy, P C; Kipervaser, Z G S

    2002-01-01

    Heterogeneous nucleation on catalytic surfaces plunged into a fluid is described through a stochastic model. To generate this non-equilibrium process we assume that the turn on of a electrostatic potential triggers a complex dynamics that includes a free Brownian motion, a reaction kinetic and a stimulated migration before the final adhesion of ions on the surface (electrode). At, when the potential is switched on, the spatial symmetry is broken and a two-stage process is developed. First the ion undergoes a change in its electrochemical character (at some region of the space) and then reacts at some specific points to stick together on the surface. The continuous addition of ions develops a material deposit connected to the current transient signals measured in electrochemical deposition processes. Unlike current models found in the literature, this procedure avoids the computation of the area covered by the diffusion zones, allowing a formalism skill to describe equally well the absorption of ions by channe...

  15. Natural history of SLC11 genes in vertebrates: tales from the fish world

    Directory of Open Access Journals (Sweden)

    Castro L Filipe C

    2011-04-01

    Full Text Available Abstract Background The SLC11A1/Nramp1 and SLC11A2/Nramp2 genes belong to the SLC11/Nramp family of transmembrane divalent metal transporters, with SLC11A1 being associated with resistance to pathogens and SLC11A2 involved in intestinal iron uptake and transferrin-bound iron transport. Both members of the SLC11 gene family have been clearly identified in tetrapods; however SLC11A1 has never been documented in teleost fish and is believed to have been lost in this lineage during early vertebrate evolution. In the present work we characterized the SLC11 genes in teleosts and evaluated if the roles attributed to mammalian SLC11 genes are assured by other fish specific SLC11 gene members. Results Two different SLC11 genes were isolated in the European sea bass (Dicentrarchus. labrax, and named slc11a2-α and slc11a2-β, since both were found to be evolutionary closer to tetrapods SLC11A2, through phylogenetic analysis and comparative genomics. Induction of slc11a2-α and slc11a2-β in sea bass, upon iron modulation or exposure to Photobacterium damselae spp. piscicida, was evaluated in in vivo or in vitro experimental models. Overall, slc11a2-α was found to respond only to iron deficiency in the intestine, whereas slc11a2-β was found to respond to iron overload and bacterial infection in several tissues and also in the leukocytes. Conclusions Our data suggests that despite the absence of slc11a1, its functions have been undertaken by one of the slc11a2 duplicated paralogs in teleost fish in a case of synfunctionalization, being involved in both iron metabolism and response to bacterial infection. This study provides, to our knowledge, the first example of this type of sub-functionalization in iron metabolism genes, illustrating how conserving the various functions of the SLC11 gene family is of crucial evolutionary importance.

  16. Lack of Association between a 3'UTR VNTR Polymorphism of Dopamine Transporter Gene (SLC6A3) and ADHD in a Brazilian Sample of Adult Patients

    Science.gov (United States)

    Aperecida da Silva, Maria; Cordeiro, Quirino; Louza, Mario; Vallada, Homero

    2011-01-01

    Objective: To investigate a possible association between a 3'UTR VNTR polymorphism of the dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients. Method: Study Case-control with 102 ADHD adult outpatients ("DSM-IV" criteria) and 479 healthy controls. The primers' sequence used were: 3'UTR-Forward: 5' TGT GGT…

  17. Lack of Association between a 3'UTR VNTR Polymorphism of Dopamine Transporter Gene (SLC6A3) and ADHD in a Brazilian Sample of Adult Patients

    Science.gov (United States)

    Aperecida da Silva, Maria; Cordeiro, Quirino; Louza, Mario; Vallada, Homero

    2011-01-01

    Objective: To investigate a possible association between a 3'UTR VNTR polymorphism of the dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients. Method: Study Case-control with 102 ADHD adult outpatients ("DSM-IV" criteria) and 479 healthy controls. The primers' sequence used were: 3'UTR-Forward: 5' TGT GGT GAT GGG…

  18. RNAi for insect control: current perspective and future challenges.

    Science.gov (United States)

    Katoch, Rajan; Sethi, Amit; Thakur, Neelam; Murdock, Larry L

    2013-10-01

    The research on the RNA interference (RNAi) for the control of insect pests has made significant growth in recent years. The availability of the genomic sequences of insects has further widened the horizons for the testing of this technology to various insect groups. Different modes of application of double-stranded RNA (dsRNA) have been tested; however, the practicability of delivery of dsRNA in insects still remains the biggest challenge. Till date, the oral delivery of dsRNA in insects is one of the efficient approaches for the practical application of this technique. The uptake of dsRNA from the insect gut is mediated either by SID-1/SID-2 transmembrane proteins or by endocytosis; however, the systemic RNAi machinery still remains to be revealed in insect species. The RNAi-mediated gene knockdown has shown striking results in different insect groups, pointing it to be the upcoming technique for insect control. However, before the successful application of this technique for insect control, some potential issues need to be resolved. This review presents the account of prospects and challenges for the use of this technology for insect control.

  19. Hysteresis Current Control technique based on Space Vector Modulation for Active Power Filter

    Directory of Open Access Journals (Sweden)

    Wang Yun-liang

    2011-09-01

    Full Text Available In this paper, the hysteresis current control (HCC technique based on space vector modulation (SVM for shunt active power filter (APF is proposed. The switching control algorithms of the HCC based SVM manage to generate compensated current according to the reference current. Harmonics extraction is based on the instantaneous active and reactive power theorem in time domain by calculating the power compensation. A closed loop control system is carried out and the error current is the difference between the reference current which is obtained from the power compensation and the actual current needs to be injected back into the power grid. By implementing this control strategy, the APF manages to generate better compensated harmonics currents to the power grid. Keywords: active power filter, hysteresis current control, space vector modulation ,matlab/simulink

  20. Alternating current-generated plasma discharges for the controlled direct current charging of ferroelectrets

    Science.gov (United States)

    Cury Basso, Heitor; Monteiro, José Roberto B. de A.; Baladelli Mazulquim, Daniel; Teixeira de Paula, Geyverson; Gonçalves Neto, Luiz; Gerhard, Reimund

    2013-09-01

    The standard charging process for polymer ferroelectrets, e.g., from polypropylene foams or layered film systems involves the application of high DC fields either to metal electrodes or via a corona discharge. In this often-used process, the DC field triggers the internal breakdown and limits the final charge densities inside the ferroelectret cavities and, thus, the final polarization. Here, an AC + DC charging procedure is proposed and demonstrated in which a high-voltage high-frequency (HV-HF) wave train is applied together with a DC poling voltage. Thus, the internal dielectric-barrier discharges in the ferroelectret cavities are induced by the HV-HF wave train, while the final charge and polarization level is controlled separately through the applied DC voltage. In the new process, the frequency and the amplitude of the HV-HF wave train must be kept within critical boundaries that are closely related to the characteristics of the respective ferroelectrets. The charging method has been tested and investigated on a fluoropolymer-film system with a single well-defined cylindrical cavity. It is found that the internal electrical polarization of the cavity can be easily controlled and increases linearly with the applied DC voltage up to the breakdown voltage of the cavity. In the standard charging method, however, the DC voltage would have to be chosen above the respective breakdown voltage. With the new method, control of the HV-HF wave-train duration prevents a plasma-induced deterioration of the polymer surfaces inside the cavities. It is observed that the frequency of the HV-HF wave train during ferroelectret charging and the temperature applied during poling of ferroelectrics serve an analogous purpose. The analogy and the similarities between the proposed ferroelectret charging method and the poling of ferroelectric materials or dipole electrets at elevated temperatures with subsequent cooling under field are discussed.

  1. A Coordinate Control Strategy for Circulating Current Suppression in Multiparalleled Three-Phase Inverters

    DEFF Research Database (Denmark)

    Zhang, Xueguang; Wang, Tianyi; Wang, Xiongfei

    2017-01-01

    This paper addresses the zero-sequence circulating current control in the multiparalleled three-phase voltage-source inverters. The model of the zero-sequence circulating current in the N-paralleled (N ≥ 3) inverters is derived. It is shown that the circulating current is not only susceptible...... to the mismatches of circuit parameters, but it is also influenced by the interactions of circulating current controllers used by other paralleled inverters. To eliminate these adverse effects on the circulating current control loop, a coordinate control strategy for the N-paralleled inverter is proposed based...

  2. Research on Full-Digital Hysteresis Current Controlled Controllable Current Source%全数字滞环电流控制可控电流源研究

    Institute of Scientific and Technical Information of China (English)

    单任仲; 沈沉; 陈来军; 刘锋; 黄秀琼

    2012-01-01

    Based on field-programmable gate array (FPGA), a full-digital hysteresis current controlled controllable current disturbance source, in which the single-phase full-bridge topology is chosen as the main circuit of the controllable current source, is proposed. Simulation analysis of bi-level and tri-level hysteresis current control is performed and simulation results are compared. Utilizing self-defined module in PSCAD software two different control strategies are programmed by Fortran language, and simulation results of the two control strategies show that the bi-level hysteresis current control is more suitable to controllable current source. Finally, a principle prototype is designed and made, and then the control of current source is implemented by FPGA controller and the hysteresis current control is implemented by VHDL programming. Experimental results show that the hysteresis current control technique is effective for the implementation of controllable current source.%提出了一种基于现场可编程门阵列(field-programm-able gate array,FPGA)控制的全数字滞环电流控制型可控电流扰动源,选取单相全桥拓扑作为可控电流源的主电路结构.对两态滞环和三态滞环电流控制进行了仿真分析和对比,利用PSCAD软件中的自定义模块,采用Fortran语言对2种不同控制策略进行编程实现,仿真结果表明两态滞环电流控制策略更加适合于可控电流源.最后设计制作了一台原理样机,利用FPGA控制器实现了对电流源的控制,采用VHDL语言实现滞环电流控制,实验结果表明滞环电流控制技术对可控电流源的实现是有效的.

  3. Brushless DC motor Drive during Speed regulation with Current Controller

    OpenAIRE

    Bhikshalu Manchala; T.Amar Kiran

    2015-01-01

    Brushless DC Motor (BLDC) is one of the best electrical drives that have increasing popularity, due to their high efficiency, reliability, good dynamic response and very low maintenance. Due to the increasing demand for compact & reliable motors and the evolution of low cost power semiconductor switches and permanent magnet (PM) materials, brushless DC motors become popular in every application from home appliances to aerospace industry. The conventional techniques for controlling...

  4. Current Control and Future Risk in Asthma Management

    OpenAIRE

    2011-01-01

    Despite international and national guidelines, poor asthma control remains an issue. Asthma exacerbations are costly to both the individual, and the healthcare provider. Improvements in our understanding of the therapeutic benefit of asthma therapies suggest that, in general, while long-acting bronchodilator therapy improves asthma symptoms, the anti-inflammatory activity of inhaled corticosteroids reduces acute asthma exacerbations. Studies have explored factors which could be predictive of ...

  5. Current status and control of rabies in Perú

    OpenAIRE

    2007-01-01

    Rabies is an endemic disease of Peru, that appears in two cycles, one urban related with transmission by dog, and another wild caused mainly by vampires bats bite. Most of human cases of the last decades they have been by urban rabies, nevertheless the used measures of control (canine vaccine campaigns, vaccine production, identification of biting dog, opportune attention of the victim and surveillance and notification system) they have managed to reduce the incidence of canine rabies and ...

  6. Current status of hypertension control around the world.

    Science.gov (United States)

    Erdine, Serap; Aran, Sinan Nazif

    2004-01-01

    It is well established that hypertension is an important risk factor for cardiovascular disease. Data from epidemiological and observational studies have demonstrated increasing risk of stroke, myocardial infarction, cardiovascular death and all cause mortality associated with high blood pressure. Despite the significance of the problem with respect to overall health, control of high blood pressure is far from being optimal. Data from the National Health and Nutrition Survey have shown that those achieving target blood pressure values less than 140/90 mmHg are only 34% of the hypertensive population. The situation is no better in the rest of the world and even worse in the developing countries. Epidemiological transition taking place in developing countries with a decline in communicable diseases and an increase in noncommunicable have resulted in an improvement in life expectancy, thus causing predictable shifts in causes of death. Aging of the populations, urbanization and socioeconomic changes in the developing world have led to an increase in the prevalence of hypertension, with low control rates due to scarce health resources and insufficient health infrastructure. Thus prevention, detection, treatment and control of hypertension play a crucial role in protection of cardiovascular disease, not only in the developed countries but also in the developing world and implementation of hypertension guidelines should be reinforced around the world.

  7. Design and Implementation of Digital Current Mode Controller for DC-DC Converters

    DEFF Research Database (Denmark)

    Taeed, Fazel

    to be regulated by a closed-loop controller. The Peak Current Mode Control (PCMC) is one of the most promising control methods for dc-dc converters. It has been known for high bandwidth (speed), and inherent current protection. Increasing the controller bandwidth decreases the output filter size and cost. Analog...... a bandwidth of 1/10 of the switching frequency. In the current state-of-the-art, the best reported digital PCMC has crossover frequency of 1/15 of the switching frequency. In this PhD study a novel digital PCMC with negligible delay in the inner current loop has been proposed. The proposed solution has...... are eliminated in current mode control; applying the current mode control in high efficiency dc-dc converters results in much higher controller bandwidth....

  8. Comparison of Unmodulated Current Control Characteristics of Permanent Magnet Synchronous Motor

    Directory of Open Access Journals (Sweden)

    Anwar Muqorobin

    2014-12-01

    Full Text Available This paper discusses comparison of unmodulated current controls in PMSM, more specifically, on-off, sliding mode, predictive and hybrid controls. The purpose of this study is to select the most appropriate control technique to be adopted. The comparison method is preceded by modeling the motor and entering the values of the motor parameters. PI control is used for speed control and zero d-axis current is employed. Furthermore, performing simulation for each type ofthe selected current controls and analyzing their responses in terms of dq and abc currents, q-axis current response with step reference, as well as THD. Simulation results show that the on-off control gives the best overall performance based on its abc-axis current ripple and THD at large load torque. The hybrid control shows the best response occurring only at the fastest transient time of q-axis current but its response exhibits bad qualities compared with other controls. The predictive control yields the best responses offering the smallest d-axis ripple current and THD at small load torque condition. The sliding mode control, however, does not exhibit any prominent performance compared to the others. Results presented in this paper further indicate that for the PMSM used in the simulation the most appropriate control is the predictive control.

  9. Direct Torque Control in presence of Current sensor failure in Variable Speed Wind System: Effect analysis, detection and control reconfiguration

    Directory of Open Access Journals (Sweden)

    A. J. Arbi

    2008-03-01

    Full Text Available This paper presents a study of current sensor failure in a Direct Torque Control applied to a Double Fed Induction Generator based Variable Speed Wind System. The effect of scaling and offset current sensor errors is discussed through sensibility analysis. A control reconfiguration is then proposed to remedy this sensor failure. Simulation results emphasize the good performances of the proposed current sensor fault tolerant control

  10. Genome-Wide Association Analysis Identifies a Mutation in the Thiamine Transporter 2 (SLC19A3) Gene Associated with Alaskan Husky Encephalopathy

    Science.gov (United States)

    Vernau, Karen M.; Runstadler, Jonathan A.; Brown, Emily A.; Cameron, Jessie M.; Huson, Heather J.; Higgins, Robert J.; Ackerley, Cameron; Sturges, Beverly K.; Dickinson, Peter J.; Puschner, Birgit; Giulivi, Cecilia; Shelton, G. Diane; Robinson, Brian H.; DiMauro, Salvatore; Bollen, Andrew W.; Bannasch, Danika L.

    2013-01-01

    Alaskan Husky Encephalopathy (AHE) has been previously proposed as a mitochondrial encephalopathy based on neuropathological similarities with human Leigh Syndrome (LS). We studied 11 Alaskan Husky dogs with AHE, but found no abnormalities in respiratory chain enzyme activities in muscle and liver, or mutations in mitochondrial or nuclear genes that cause LS in people. A genome wide association study was performed using eight of the affected dogs and 20 related but unaffected control AHs using the Illumina canine HD array. SLC19A3 was identified as a positional candidate gene. This gene controls the uptake of thiamine in the CNS via expression of the thiamine transporter protein THTR2. Dogs have two copies of this gene located within the candidate interval (SLC19A3.2 – 43.36–43.38 Mb and SLC19A3.1 – 43.411–43.419 Mb) on chromosome 25. Expression analysis in a normal dog revealed that one of the paralogs, SLC19A3.1, was expressed in the brain and spinal cord while the other was not. Subsequent exon sequencing of SLC19A3.1 revealed a 4bp insertion and SNP in the second exon that is predicted to result in a functional protein truncation of 279 amino acids (c.624 insTTGC, c.625 C>A). All dogs with AHE were homozygous for this mutation, 15/41 healthy AH control dogs were heterozygous carriers while 26/41 normal healthy AH dogs were wild type. Furthermore, this mutation was not detected in another 187 dogs of different breeds. These results suggest that this mutation in SLC19A3.1, encoding a thiamine transporter protein, plays a critical role in the pathogenesis of AHE. PMID:23469184

  11. Genome-wide association analysis identifies a mutation in the thiamine transporter 2 (SLC19A3 gene associated with Alaskan Husky encephalopathy.

    Directory of Open Access Journals (Sweden)

    Karen M Vernau

    Full Text Available Alaskan Husky Encephalopathy (AHE has been previously proposed as a mitochondrial encephalopathy based on neuropathological similarities with human Leigh Syndrome (LS. We studied 11 Alaskan Husky dogs with AHE, but found no abnormalities in respiratory chain enzyme activities in muscle and liver, or mutations in mitochondrial or nuclear genes that cause LS in people. A genome wide association study was performed using eight of the affected dogs and 20 related but unaffected control AHs using the Illumina canine HD array. SLC19A3 was identified as a positional candidate gene. This gene controls the uptake of thiamine in the CNS via expression of the thiamine transporter protein THTR2. Dogs have two copies of this gene located within the candidate interval (SLC19A3.2 - 43.36-43.38 Mb and SLC19A3.1 - 43.411-43.419 Mb on chromosome 25. Expression analysis in a normal dog revealed that one of the paralogs, SLC19A3.1, was expressed in the brain and spinal cord while the other was not. Subsequent exon sequencing of SLC19A3.1 revealed a 4bp insertion and SNP in the second exon that is predicted to result in a functional protein truncation of 279 amino acids (c.624 insTTGC, c.625 C>A. All dogs with AHE were homozygous for this mutation, 15/41 healthy AH control dogs were heterozygous carriers while 26/41 normal healthy AH dogs were wild type. Furthermore, this mutation was not detected in another 187 dogs of different breeds. These results suggest that this mutation in SLC19A3.1, encoding a thiamine transporter protein, plays a critical role in the pathogenesis of AHE.

  12. Control of spin-polarised currents in graphene nanorings

    Energy Technology Data Exchange (ETDEWEB)

    Saiz-Bretín, M.; Munárriz, J. [GISC, Departamento de Física de Materiales, Universidad Complutense, E-28040 Madrid (Spain); Malyshev, A.V. [GISC, Departamento de Física de Materiales, Universidad Complutense, E-28040 Madrid (Spain); Ioffe Physical–Technical Institute, St-Petersburg (Russian Federation); Domínguez-Adame, F., E-mail: adame@fis.ucm.es [GISC, Departamento de Física de Materiales, Universidad Complutense, E-28040 Madrid (Spain); Department of Physics, University of Warwick, Coventry, CV4 7AL (United Kingdom)

    2015-09-25

    We study electronic transport in systems comprising square graphene nanorings with a ferromagnetic insulator layer on top of them. The rings are connected symmetrically or asymmetrically to contacts. The proximity exchange interaction of electrons with magnetic ions results in spin-dependent transport properties. When a nanoring is connected asymmetrically, the occurrence of Fano-like antiresonances in the transmission coefficient can induce abrupt changes in the spin polarisation under minute variations of the Fermi energy. We also demonstrate that the spin polarisation can be efficiently controlled by a side-gate voltage. This opens a possibility to use these effects for fabricating tunable sources of polarised electrons.

  13. Current Status of Parasite Control at the Feed Yard.

    Science.gov (United States)

    Yazwinski, Thomas A; Tucker, Chris A; Powell, Jeremy; Beck, Paul; Wray, Eva; Weingartz, Christine

    2015-07-01

    Fly and louse infestations are readily discerned and remedied in feedlot cattle. Tapeworm and fluke infections are accepted as probable but, given the lack of anthelmintics with realistic efficacy against these infections, these helminths are allowed to persist without treatment. Nematode infections are considered ubiquitous with cattle coming from pasture and are targeted with a macrocyclic lactone, usually in combination with a benzimidazole. Populations of nematodes seem to be effectively controlled by a combination of anthelmintic treatment, animal resistance and resilience, lack of reinfection, and diet.

  14. COMPARISON PERFORMANCE OF INDUCTION MOTOR USING SVPWM AND HYSTERESIS CURRENT CONTROLLER

    Directory of Open Access Journals (Sweden)

    FIZATUL AINI PATAKOR

    2011-08-01

    Full Text Available This paper presents the comparative performances of three phase induction motors using space vector pulse width modulation (SVPWM and hysteresis current controller. An indirect field orientation is applied to ensure decoupling control between torque and flux of the induction motor. The hysteresis current controller is built in with PI speed controller and three hysteresis current bands while the SVPWM system is embedded with the two control loops, the inner current control loop and the outer speed control loop using PI controller. Both systems were run and tested using MATLAB/SIMULINK software. The simulation results demonstrate that the SVPWM can improve the quality of the stator current and reduce the torque ripple while maintaining the other performance characteristics of the system.

  15. A grid side converter current controller for accurate current injection under normal and fault ride through operation

    DEFF Research Database (Denmark)

    Hadjidemetriou, Lenos; Kyriakides, Elias; Blaabjerg, Frede

    2013-01-01

    requirements. In addition, the renewable energy systems require fault ride through capability in order to support the power grid under balanced or unbalanced low voltage grid faults. Therefore, the development of advanced current controller techniques is essential for the grid side power electronic converters...... in order to increase the renewable energy systems penetration and satisfy the grid codes. This paper proposes a current controller technique, which enables the appropriate operation of the grid side converter under unbalanced grid faults and harmonic distorted grid conditions. The proposed current......Modern grid codes for interconnection of distributed energy resources have become more restrictive due to the massive integration of renewable energy sources. The interconnected renewable energy sources must operate accurately under normal and abnormal grid conditions in order to meet the grid...

  16. The role of the neutral amino acid transporter B0AT1 (SLC6A19) in Hartnup disorder and protein nutrition.

    Science.gov (United States)

    Bröer, Stefan

    2009-06-01

    Hartnup disorder (OMIM 234500) is an autosomal recessive disorder, which was first described in 1956 as an aminoaciduria of neutral amino acids accompanied by a variety of symptoms, such as a photo-sensitive skin-rash and cerebellar ataxia. The disorder is caused by mutations in the neutral amino acid transporter B(0)AT1 (SLC6A19). To date 21 mutations have been identified in more than twenty families. SLC6A19 requires either collectrin or angiotensin-converting enzyme 2 for surface expression in the kidney and intestine, respectively. This ties SLC6A19 together with more complex functions such as blood-pressure control, glomerular structure, and exocytosis. (c) 2009 IUBMB.

  17. Speed Control Analysis of Brushless DC Motor Based on Maximum Amplitude DC Current Feedback

    Directory of Open Access Journals (Sweden)

    Hassan M.A.A.

    2014-07-01

    Full Text Available This paper describes an approach to develop accurate and simple current controlled modulation technique for brushless DC (BLDC motor drive. The approach is applied to control phase current based on generation of quasi-square wave current by using only one current controller for the three phases. Unlike the vector control method which is complicated to be implemented, this simple current modulation technique presents advantages such as phase currents are kept in balance and the current is controlled through only one dc signal which represent maximum amplitude value of trapezoidal current (Imax. This technique is performed with Proportional Integral (PI control algorithm and triangular carrier comparison method to generate Pulse Width Modulation (PWM signal. In addition, the PI speed controller is incorporated with the current controller to perform desirable speed operation of non-overshoot response. The performance and functionality of the BLDC motor driver are verified via simulation by using MATLAB/SIMULINK. The simulation results show the developed control system performs desirable speed operation of non-overshoot and good current waveforms.

  18. Air gun wounding and current UK laws controlling air weapons.

    Science.gov (United States)

    Bruce-Chwatt, Robert Michael

    2010-04-01

    Air weapons whether rifles or pistols are, potentially, lethal weapons. The UK legislation is complex and yet little known to the public. Hunting with air weapons and the laws controlling those animals that are permitted to be shot with air weapons is even more labyrinthine due to the legal power limitations on the possession of air weapons. Still relatively freely available by mail order or on the Internet, an increasing number of deaths have been reported from the misuse of air weapons or accidental discharges. Ammunition for air weapons has become increasingly sophisticated, effective and therefore increasingly dangerous if misused, though freely available being a mere projectile without a concomitant cartridge containing a propellant and an initiator.

  19. Intramolecular cross-linking in a bacterial homolog of mammalian SLC6 neurotransmitter transporters suggests an evolutionary conserved role of transmembrane segments 7 and 8

    DEFF Research Database (Denmark)

    Kniazeff, Julie; Loland, Claus Juul; Goldberg, Naomi

    2005-01-01

    The extracellular concentration of the neurotransmitters dopamine, serotonin, norepinephrine, GABA and glycine is tightly controlled by plasma membrane transporters belonging to the SLC6 gene family. A very large number of putative transport proteins with a remarkable homology to the SLC6...... transporters has recently been identified in prokaryotes. Here we have probed structural relationships in a 'microdoman' corresponding to the extracellular ends of transmembrane segments (TM) 7 and 8 in one of these homologs, the tryptophan transporter TnaT from Symbiobacterium thermophilum. We found...

  20. Versatile CAMAC power supply controller-monitor with built-in ramping and ripple monitor

    Energy Technology Data Exchange (ETDEWEB)

    Kang, H.; Horelick, D.

    1984-10-01

    An integrated power supply controller-monitor has been designed and is in use to control large power supplies for SLC dc magnets. This single-width CAMAC module contains a 14-bit DAC, a 14-bit ADC, and several channels of optically coupled digital status and control signals. Additional features include built-in selectable ramping rates, self-test capabilities, and a ripple monitor circuit to measure ac ripple in the power supply current.

  1. Research on Precision Assembly Robot's Joint Torque Control Based on Current Measurement

    Institute of Scientific and Technical Information of China (English)

    董高云; 许春山; 费燕琼; 赵锡芳

    2003-01-01

    A set of new current sensing device is used to realize joint torque control based on current measurement in a precision assembly robot's third joint. The output torque's model of the joint's brnshless DC motor is founded. Disturbance factors and the compensated effect of the torque's closed loop based on current measurement are analyzed. Related simulations and experiments show that the system has good current tracking and anti-disturbances performance, which improve the force control performance of the robot in assembly.

  2. Development of beam current control system in RF-knockout slow extraction

    Science.gov (United States)

    Mizushima, K.; Sato, S.; Shirai, T.; Furukawa, T.; Katagiri, K.; Takeshita, E.; Iwata, Y.; Himukai, T.; Noda, K.

    2011-12-01

    A raster scanning method has been developed for cancer therapy at NIRS-HIMAC. This method requires a high-accuracy beam current control and fast beam-on/off switching. We have developed a feedback control system of the beam current with the RF-knockout slow extraction method. The system has allowed a stable response to beam-on/off switching using a feedback control delay function with a beam-current ripple of 7%.

  3. Development of beam current control system in RF-knockout slow extraction

    Energy Technology Data Exchange (ETDEWEB)

    Mizushima, K., E-mail: mizshima@nirs.go.jp [Department of Accelerator and Medical Physics, National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Graduate School of Science and Technology, Chiba University, Yayoi-cho, Inage-ku, Chiba 263-8522 (Japan); Sato, S.; Shirai, T.; Furukawa, T.; Katagiri, K.; Takeshita, E.; Iwata, Y.; Himukai, T.; Noda, K. [Department of Accelerator and Medical Physics, National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan)

    2011-12-15

    A raster scanning method has been developed for cancer therapy at NIRS-HIMAC. This method requires a high-accuracy beam current control and fast beam-on/off switching. We have developed a feedback control system of the beam current with the RF-knockout slow extraction method. The system has allowed a stable response to beam-on/off switching using a feedback control delay function with a beam-current ripple of 7%.

  4. Electrical Discharge Machining Flyback Converter using UC3842 Current Mode PWM Controller

    Directory of Open Access Journals (Sweden)

    Nazriah Mahmud

    2014-10-01

    Full Text Available This paper presents a current mode Pulse Width Modulation (PWM controlled Flyback converter using UC3842 for Electrical Discharge Machining current generator control circuit. Circuit simplicity and high efficiency can be achieved by a Flyback converter with current mode PWM controller. The behaviors of the system's operation is analyzed and discussed by varying the load resistance. Matlab sofware is used to simulate the Flyback converter where a prototype has been built and tested to verify it's performance.

  5. Neonatal pain and COMT Val158Met genotype in relation to serotonin transporter (SLC6A4 promoter methylation in very preterm children at school age

    Directory of Open Access Journals (Sweden)

    Cecil Ming Yeung Chau

    2014-12-01

    Full Text Available Children born very preterm are exposed to repeated neonatal procedures that induce pain and stress during hospitalization in the neonatal intensive care unit (NICU. The COMT Val158Met genotype is involved with pain sensitivity, and early life stress is implicated in altered expression of methylation of the serotonin transporter. We examined: (1 whether methylation of the serotonin transporter gene (SLC6A4 promoter differs between very preterm children and full-term controls at school age, (2 relationships with child behavior problems, and (3 whether the extent of neonatal pain exposure interacts with the COMT Val158Met genotype to predict SLC6A4 methylation at 7 years in the very preterm children. We examined the associations between the COMT genotypes, neonatal pain exposure (adjusted for neonatal clinical confounders, SLC6A4 methylation and behavior problems. Very preterm children had significantly higher methylation at 7/10 CpG sites in the SLC6A4 promoter compared to full-term controls at 7 years. Neonatal pain (adjusted for clinical confounders was significantly associated with total child behaviour problems on the Child Behavior Checklist (CBCL questionnaire (adjusted for concurrent stressors and 5HTTLPR genotype (p = 0.035. CBCL total problems was significantly associated with greater SLC6A4 methylation in very preterm children (p = 0.01. Neonatal pain (adjusted for clinical confounders and COMT Met/Met genotype were associated with SLC6A4 promoter methylation in very preterm children at 7 years (p = 0.001. These findings provide evidence that both genetic predisposition and early environment need to be considered in understanding susceptibility for developing behavioral problems in this vulnerable population.

  6. Europe: history, current situation and control measures for infectious bronchitis

    Directory of Open Access Journals (Sweden)

    RC Jones

    2010-06-01

    Full Text Available The emergence and nature of different strains of infectious bronchitis virus (IBV in Europe are described. Infectious bronchitis (IB is the most important endemic viral respiratory disease where highly pathogenic Newcastle disease and avian influenza are not present. IB was first described in the UK in 1948 and identified as Massachusetts type. In the 1970s and 80s new serotypes were reported in Holland and elsewhere and new vaccines were developed. The 1990s saw the emergence of the major variant commonly called 793B, again needing a new vaccine. Two novel types have been recognised since 2000, Italy 02 and QX. Italy 02 appears to be well controlled by the use of two different live vaccines (H120 and the 793B-related 4/91 while for QX, associated with nephritis in young birds and silent layers, new vaccines are in development. The use of two vaccines as above is a widely used protocol and is capable of protecting against a wide range of different types. Alternative approaches to IB vaccination are discussed. The importance of constant surveillance for prevalent and novel IBV types is emphasised and the value of experimental infections in chickens to determine the pathogenesis and pathology of new types in addition to testing efficacy of vaccines is outlined.

  7. [Current problems in the microbiological control of food].

    Science.gov (United States)

    Campello, C

    1989-01-01

    The paper deals with a number of aspects of current interest and significance on the subject of the microbiological testing of food with particular reference to the role of research institutes. The main objectives of microbiological testing of food are essentially two: (i) to establish the absence of a human health hazard due to microbial contamination of food (food safety); and (ii) to define the quality standard of food (food quality). As far as the first of these objectives is concerned, the outcome of the assay necessarily emerges not only from identification of pathogens but also from definition of their pathogenicity and virulence characteristics and of critical factors for their transmission. Alongside the classic pathogens, evidence has recently been found indicating that four additional bacteria, namely Yersinia enterocolitica, Campylobacter jejuni, Vibrio cholerae non 0-1 and Listeria monocytogenes, also play an important role in food-borne disease. The most characteristic biological, ecological and epidemiologic aspects related to human food-borne disease are described for these bacteria. As regards the second objective, i.e. food quality, stress is laid on the role played by microbial indicators and their predictivity for pathogenic micro-organisms, which does not always exist. This depends on three basic differential factors: (i) biological characteristics giving rise to different diffusion, dilution and extinction phenomena, or, on the other hand, multiplication of such pathogens in the environment and in food; (ii) resistance to the natural inactivation mechanisms, whether of a general or specific nature, of each alimentary substrate; and (iii) the ecological and epidemiological pattern. By way of examples, two experiences indicating the lack of predictivity of the faecal indicators for enterovirus and Vibrio cholerae non 0-1 are reported. Nevertheless, standard microbiological testing for mesophilic flora and indicators are fundamental instruments

  8. H∞ Robust Current Control for DFIG Based Wind Turbine subject to Grid Voltage Distortions

    DEFF Research Database (Denmark)

    Wang, Yun; Wu, Qiuwei; Gong, Wenming;

    2016-01-01

    are designed to efficiently track the unbalanced current components and the 5th and 7th background harmonics. The robust stability (RS) and robust performance (RP) of the proposed controller are verified by the structured singular value µ. The performance of the H∞ robust current controller was demonstrated......This paper proposes an H∞ robust current controller for doubly fed induction generator (DFIG) based wind turbines (WTs) subject to grid voltage distortions. The controller is to mitigate the impact of the grid voltage distortions on rotor currents with DFIG parameter perturbation. The grid voltage...

  9. Simulation of droplet transfer process and current waveform control of CO2 arc welding

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A simulation system used in the arc welding short-circuit transfer process and current waveform control process was developed in this paper. The simulation results are basically consistent with welding technical experiments. The simulation system can be used to simulate and test the current waveform control parameters with welding variables. By this simulation system, the influence regularities of the current waveform control parameters in the CO2 arc welding droplet short-circuit transfer process can be got. Moreover, the basic mode of real-time current waveform control can be also established by the simulation testing.

  10. Reduced Slc6a15 in Nucleus Accumbens D2-Neurons Underlies Stress Susceptibility.

    Science.gov (United States)

    Chandra, Ramesh; Francis, T Chase; Nam, Hyungwoo; Riggs, Lace M; Engeln, Michel; Rudzinskas, Sarah; Konkalmatt, Prasad; Russo, Scott J; Turecki, Gustavo; Iniguez, Sergio D; Lobo, Mary Kay

    2017-07-05

    Previous research demonstrates that Slc6a15, a neutral amino acid transporter, is associated with depression susceptibility. However, no study examined Slc6a15 in the ventral striatum [nucleus accumbens (NAc)] in depression. Given our previous characterization of Slc6a15 as a striatal dopamine receptor 2 (D2)-neuron-enriched gene, we examined the role of Slc6a15 in NAc D2-neurons in mediating susceptibility to stress in male mice. First, we showed that Slc6a15 mRNA was reduced in NAc of mice susceptible to chronic social defeat stress (CSDS), a paradigm that produces behavioral and molecular adaptations that resemble clinical depression. Consistent with our preclinical data, we observed Slc6a15 mRNA reduction in NAc of individuals with major depressive disorder (MDD). The Slc6a15 reduction in NAc occurred selectively in D2-neurons. Next, we used Cre-inducible viruses combined with D2-Cre mice to reduce or overexpress Slc6a15 in NAc D2-neurons. Slc6a15 reduction in D2-neurons caused enhanced susceptibility to a subthreshold social defeat stress (SSDS) as observed by reduced social interaction, while a reduction in social interaction following CSDS was not observed when Slc6a15 expression in D2-neurons was restored. Finally, since both D2-medium spiny neurons (MSNs) and D2-expressing choline acetyltransferase (ChAT) interneurons express Slc6a15, we examined Slc6a15 protein in these interneurons after CSDS. Slc6a15 protein was unaltered in ChAT interneurons. Consistent with this, reducing Slc5a15 selectively in NAc D2-MSNs, using A2A-Cre mice that express Cre selectively in D2-MSNs, caused enhanced susceptibility to SSDS. Collectively, our data demonstrate that reduced Slc6a15 in NAc occurs in MDD individuals and that Slc6a15 reduction in NAc D2-neurons underlies stress susceptibility.SIGNIFICANCE STATEMENT Our study demonstrates a role for reduced Slc6a15, a neutral amino acid transporter, in nucleus accumbens (NAc) in depression and stress susceptibility. The

  11. New Gain Controllable Resistor-less Current-mode First Order Allpass Filter and its Application

    Directory of Open Access Journals (Sweden)

    W. Jaikla

    2012-04-01

    Full Text Available New first order allpass filter (APF in current mode, constructed from 2 CCCCTAs and grounded capacitor, is presented. The current gain and phase shift can be electronically /orthogonally controlled. Low input and high output impedances are achieved which make the circuit to be easily cascaded to the current-mode circuit without additional current buffers. The operation of the proposed filter has been verified through simulation results which confirm the theoretical analysis. The application example as current-mode quadrature oscillator with non-interactive current control for both of oscillation condition and oscillation frequency is included to show the usability of the proposed filter.

  12. Transcription factor ATF-3 regulates allele variation phenotypes of the human SLC11A1 gene.

    Science.gov (United States)

    Taka, Styliani; Gazouli, Maria; Politis, Panagotis K; Pappa, Kalliopi I; Anagnou, Nicholas P

    2013-03-01

    Genetic polymorphisms in the human solute carrier family 11 member 1 (SLC11A1) gene predispose to susceptibility to infectious/inflammatory diseases and cancer. Human susceptibility to these diseases exhibits allelic association with a polymorphic regulatory Z-DNA-forming microsatellite of a (GT/AC)n repeat. The carriage of different alleles may influence chromatin remodeling and accessibility by transcription factors. Of particular importance is the binding site for the Activating Protein 1 (AP-1) elements, (ATF-3 and c-Jun), adjacent to the 5' sequence of the Z-DNA-forming polymorphism. The aim of the study was to characterize the transcriptional mechanisms controlling different alleles of SLC11A1 expression by ATF-3 and c-Jun. Allele 2, [T(GT)5AC(GT)5AC(GT)10GGCAGA(G)6], and Allele 3, [T(GT)5AC(GT)5AC(GT)9GGCAGA(G)6], were subcloned into the PGL2Basic vector. Transient transfections of THP-1 cells with the constructs, in the presence or absence of pATF-3 were preformed. Luciferase expression was determined. To document the recruitment of ATF-3 and c-Jun, to the polymorphic promoter alleles in vivo, we performed ChIP assays with transient transfected THP-1 cells treated with or without lipopolyssacharides. Our data documented that ATF-3 suppresses the transcriptional activation of Allele-3, and this suppression is enhanced in the presence of lipopolyssacharides. Our findings suggest that ATF-3 and c-Jun may influence heritable variation in SLC11A1-dependent innate resistance to infection and inflammation both within and between populations.

  13. Current knowledge on groundwater microbial pathogens and their control

    Science.gov (United States)

    Macler, Bruce A.; Merkle, Jon C.

    Those who drink groundwater that has not been disinfected are at increased risk of infection and disease from pathogenic microorganisms. Recent studies have shown that up to half of all US drinking-water wells tested had evidence of fecal contamination. A significant fraction of all waterborne disease outbreaks is associated with groundwater. An estimated 750,000 to 5.9million illnesses per year result from contaminated groundwaters in the US. Mortality from these illnesses may be 1400-9400 deaths per year. Control of these pathogens starts with source-water protection activities to prevent fecal contamination of aquifers and wells. These include assessment of wellhead vulnerability to fecal contamination and correction of identified deficiencies. Correction may include control of sources or rehabilitation of the well itself. Disinfection can serve as a useful barrier and is recommended as a prudent public-health policy for all groundwater systems. Ceux qui boivent une eau souterraine non désinfectée présentent un risque accru d'infection et de maladie par des germes pathogènes. De récentes études ont montré que près de la moitié de tous les puits américains testés, captés pour l'eau potable, sont soumis à une contamination fécale. Une fraction significative de l'ensemble des premières manifestations de maladies liées à l'eau est associée aux eaux souterraines. On estime qu'entre 750 000 et 5,9millions de personnes sont malades chaque année aux États-Unis à cause d'eaux souterraines polluées. La mortalité parmi ces malades doit ètre de l'ordre de 1400 à 9400 décès par an. La protection contre ces germes pathogènes commence avec des mesures prises au niveau du captage pour empècher la pollution des aquifères et des puits. Celles-ci comprennent une évaluation de la vulnérabilité des tètes de puits à la pollution fécale et une correction des insuffisances mises en évidence. Cette correction peut comprendre une maîtrise des sources

  14. Association study of polymorphisms in the excitatory amino acid transporter 2 gene (SLC1A2 with schizophrenia

    Directory of Open Access Journals (Sweden)

    Iwata Nakao

    2004-08-01

    Full Text Available Abstract Background The glutamatergic dysfunction hypothesis of schizophrenia suggests that genes involved in glutametergic transmission are candidates for schizophrenic susceptibility genes. We have been performing systematic association studies of schizophrenia with the glutamate receptor and transporter genes. In this study we report an association study of the excitatory amino acid transporter 2 gene, SLC1A2 with schizophrenia. Methods We genotyped 100 Japanese schizophrenics and 100 controls recruited from the Kyushu area for 11 single nucleotide polymorphism (SNP markers distributed in the SLC1A2 region using the direct sequencing and pyrosequencing methods, and examined allele, genotype and haplotype association with schizophrenia.The positive finding observed in the Kyushu samples was re-examined using 100 Japanese schizophrenics and 100 controls recruited from the Aichi area. Results We found significant differences in genotype and allele frequencies of SNP2 between cases and controls (P = 0.013 and 0.008, respectively. After Bonferroni corrections, the two significant differences disappeared. We tested haplotype associations for all possible combinations of SNP pairs. SNP2 showed significant haplotype associations with the disease (P = 9.4 × 10-5, P = 0.0052 with Bonferroni correction, at the lowest in 8 combinations. Moreover, the significant haplotype association of SNP2-SNP7 was replicated in the cumulative analysis of our two sample sets. Conclusion We concluded that at least one susceptibility locus for schizophrenia is probably located within or nearby SLC1A2 in the Japanese population.

  15. Current control method of thyristor converter for PF superconducting coil in KSTAR

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Jae-hoon, E-mail: jaehoon@nfri.re.kr [National Fusion Research Institute (NFRI), 169-148 Gwahak-ro, Yuseong-gu, Daejeon 305-806 (Korea, Republic of); Ahn, Hyun-sik [POSCO ICT, 622, Sampyeong-dong, Bundang-gu, Seongnam-si, Kyeonggi-do 463-400 (Korea, Republic of); Lee, Dong-keun; Jin, Jong-kuk [National Fusion Research Institute (NFRI), 169-148 Gwahak-ro, Yuseong-gu, Daejeon 305-806 (Korea, Republic of); Jang, Gye-yong; Seong, Dae-kyung; Yun, Min-sung; Shin, Hyun-seok [POSCO ICT, 622, Sampyeong-dong, Bundang-gu, Seongnam-si, Kyeonggi-do 463-400 (Korea, Republic of); Kim, Yaung-soo [National Fusion Research Institute (NFRI), 169-148 Gwahak-ro, Yuseong-gu, Daejeon 305-806 (Korea, Republic of)

    2012-11-15

    This paper presents the current control method of thyristor converter which is applied to PF power supply in KSTAR. The thyristor converter for PF superconducting coil is composed of two 6 pulse converters and each converter is connected in parallel using DC reactor to reduce voltage ripple, current rating of converter and harmonic components. For 4 quadrant operation, each 6 pulse converter has six arms of anti-paralleled thyristor device, back-to-back connection. To apply this converter on KSTAR PF coil, stable coil current control is needed. Additionally, PF coil needs smooth current control without dead-time when current polarity changes and it is not easy in back-to-back thyristor converter. For this reason, zero crossing current control using circulating current and test results are introduced in this paper and it was satisfactory.

  16. A Customized Pigmentation SNP Array Identifies a Novel SNP Associated with Melanoma Predisposition in the SLC45A2 Gene

    Science.gov (United States)

    Alonso, Santos; Boyano, M. Dolores; Peña-Chilet, Maria; Pita, Guillermo; Aviles, Jose A.; Mayor, Matias; Gomez-Fernandez, Cristina; Casado, Beatriz; Martin-Gonzalez, Manuel; Izagirre, Neskuts; De la Rua, Concepcion; Asumendi, Aintzane; Perez-Yarza, Gorka; Arroyo-Berdugo, Yoana; Boldo, Enrique; Lozoya, Rafael; Torrijos-Aguilar, Arantxa; Pitarch, Ana; Pitarch, Gerard; Sanchez-Motilla, Jose M.; Valcuende-Cavero, Francisca; Tomas-Cabedo, Gloria; Perez-Pastor, Gemma; Diaz-Perez, Jose L.; Gardeazabal, Jesus; de Lizarduy, Iñigo Martinez; Sanchez-Diez, Ana; Valdes, Carlos; Pizarro, Angel; Casado, Mariano; Carretero, Gregorio; Botella-Estrada, Rafael; Nagore, Eduardo; Lazaro, Pablo; Lluch, Ana; Benitez, Javier; Martinez-Cadenas, Conrado; Ribas, Gloria

    2011-01-01

    As the incidence of Malignant Melanoma (MM) reflects an interaction between skin colour and UV exposure, variations in genes implicated in pigmentation and tanning response to UV may be associated with susceptibility to MM. In this study, 363 SNPs in 65 gene regions belonging to the pigmentation pathway have been successfully genotyped using a SNP array. Five hundred and ninety MM cases and 507 controls were analyzed in a discovery phase I. Ten candidate SNPs based on a p-value threshold of 0.01 were identified. Two of them, rs35414 (SLC45A2) and rs2069398 (SILV/CKD2), were statistically significant after conservative Bonferroni correction. The best six SNPs were further tested in an independent Spanish series (624 MM cases and 789 controls). A novel SNP located on the SLC45A2 gene (rs35414) was found to be significantly associated with melanoma in both phase I and phase II (P<0.0001). None of the other five SNPs were replicated in this second phase of the study. However, three SNPs in TYR, SILV/CDK2 and ADAMTS20 genes (rs17793678, rs2069398 and rs1510521 respectively) had an overall p-value<0.05 when considering the whole DNA collection (1214 MM cases and 1296 controls). Both the SLC45A2 and the SILV/CDK2 variants behave as protective alleles, while the TYR and ADAMTS20 variants seem to function as risk alleles. Cumulative effects were detected when these four variants were considered together. Furthermore, individuals carrying two or more mutations in MC1R, a well-known low penetrance melanoma-predisposing gene, had a decreased MM risk if concurrently bearing the SLC45A2 protective variant. To our knowledge, this is the largest study on Spanish sporadic MM cases to date. PMID:21559390

  17. A customized pigmentation SNP array identifies a novel SNP associated with melanoma predisposition in the SLC45A2 gene.

    Directory of Open Access Journals (Sweden)

    Maider Ibarrola-Villava

    Full Text Available As the incidence of Malignant Melanoma (MM reflects an interaction between skin colour and UV exposure, variations in genes implicated in pigmentation and tanning response to UV may be associated with susceptibility to MM. In this study, 363 SNPs in 65 gene regions belonging to the pigmentation pathway have been successfully genotyped using a SNP array. Five hundred and ninety MM cases and 507 controls were analyzed in a discovery phase I. Ten candidate SNPs based on a p-value threshold of 0.01 were identified. Two of them, rs35414 (SLC45A2 and rs2069398 (SILV/CKD2, were statistically significant after conservative Bonferroni correction. The best six SNPs were further tested in an independent Spanish series (624 MM cases and 789 controls. A novel SNP located on the SLC45A2 gene (rs35414 was found to be significantly associated with melanoma in both phase I and phase II (P<0.0001. None of the other five SNPs were replicated in this second phase of the study. However, three SNPs in TYR, SILV/CDK2 and ADAMTS20 genes (rs17793678, rs2069398 and rs1510521 respectively had an overall p-value<0.05 when considering the whole DNA collection (1214 MM cases and 1296 controls. Both the SLC45A2 and the SILV/CDK2 variants behave as protective alleles, while the TYR and ADAMTS20 variants seem to function as risk alleles. Cumulative effects were detected when these four variants were considered together. Furthermore, individuals carrying two or more mutations in MC1R, a well-known low penetrance melanoma-predisposing gene, had a decreased MM risk if concurrently bearing the SLC45A2 protective variant. To our knowledge, this is the largest study on Spanish sporadic MM cases to date.

  18. Equivalent Circuit for Cavity Discharges Including Controlled Current Source and Controlled Switch

    Institute of Scientific and Technical Information of China (English)

    CHEN Weigen; CHEN Xi; XIE Bo; LIU Jun

    2013-01-01

    Numerous equivalent circuits for cavity discharges have been developed,yet most of these models cannot provide simulated signals that precisely reveal the variability of the discharge's characteristic parameters,such as repetition rate,magnitude and phase of discharges,which makes them not suitable for intensive studies of discharge process.Therefore,using Simulink code,we theoretically analyzed and studied the classical equivalent circuits of cavity discharges,as well as the influence of circuit components on simulation results,and then proposed a novel equivalent circuit,the key parameters of which were determined according to the physical behavior of cavity discharges.In the novel equivalent circuit,the repetition rate can be changed by discharge resistance,inception and residual voltages;meanwhile the phase of discharge can be controlled by adjusting the parameters of shunt resistance.Furthermore,a controlled current source as a function of space charge is introduced in the equivalent circuit.Compared with the former ones,the simulated signals obtained by this novel model are better approximation of real signals.This work could be referred by latter studies of the characteristics and the mechanisms of cavity discharge in oil-paper insulation.

  19. Current Status and Control Measures of Ecological Restoration in Karst Rocky Desertification Area of Guizhou

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    [Objective] The aim was to analyze the current status and control measures of ecological restoration in Karst rocky desertification area of Guizhou.[Method] The current status and existing problems of ecological restoration in Karst rocky desertification area of Guizhou were studied firstly,and main control measures were put forward according to existing problems.[Result] At present,Karst rocky desertification area in Guizhou has suitable ecological environment,obvious control results and rich control exper...

  20. Frequency of 3' VNTR Polymorphism in the Dopamine Transporter Gene SLC6A3 in Humans Predisposed to Antisocial Behavior.

    Science.gov (United States)

    Cherepkova, E V; Aftanas, L I; Maksimov, N; Menshanov, P N

    2016-11-01

    Predisposition to antisocial behavior can be related to the presence of certain polymorphic variants of genes encoding dopaminergic system proteins. We studied the frequencies of allele variants and genotypes of variable number tandem repeat polymorphism in 3' untranslated region (3' VTNR) of the dopaminergic transporter SLC6A3 gene in Caucasian men committed socially dangerous violent and non-violent crimes. Alleles with 9 and 10 repeats were most frequent in both the control group and group of men predisposed to antisocial behavior. At the same time, the 10/10 genotype was more frequently observed in the group of men prone to antisocial non-violent behavior. Hence, the presence of certain variants of 3' VTNR polymorphism of SLC6A3 gene in men is associated with predisposition to certain forms of antisocial behavior.

  1. Generation of a Slc39a8 hypomorph mouse: Markedly decreased ZIP8 Zn{sup 2+}/(HCO{sub 3}{sup -}){sub 2} transporter expression

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Bin; He, Lei; Dong, Hongbin; Dalton, Timothy P. [Department of Environmental Health and Center for Environmental Genetics (CEG), University of Cincinnati Medical Center, Cincinnati, OH 45267-0056 (United States); Nebert, Daniel W., E-mail: dan.nebert@uc.edu [Department of Environmental Health and Center for Environmental Genetics (CEG), University of Cincinnati Medical Center, Cincinnati, OH 45267-0056 (United States)

    2011-07-01

    Highlights: {yields} The mouse Slc39a8 gene encodes the ZIP8 transporter. {yields} ZIP8 functions endogenously as a electroneutral Zn{sup 2+}/(HCO{sub 3}{sup -}){sub 2} symporter. {yields} A Slc39a8(neo/neo) hypomorph mouse, due to retention of the neo mini-gene, has been created. {yields} ZIP8 expression in utero is {approx}90% decreased in all tissues examined. {yields} This mouse model will be useful for studying developmental and in utero physiological functions of ZIP8. -- Abstract: Previously this laboratory has identified the mouse Slc39a8 gene encoding the ZIP8 transporter, important in cadmium uptake. ZIP8 functions endogenously as a electroneutral Zn{sup 2+}/(HCO{sub 3}{sup -}){sub 2} symporter, moving both ions into the cell. The overall physiological importance of ZIP8 remains unclear. Herein we describe generation of a mouse line carrying the Slc39a8(neo) allele, containing the Frt-flanked neomycin-resistance (neo) mini-cassette in intron 3 and loxP sites in introns 3 and 6. Cre recombinase functions correctly in Escherichia coli and in adeno-Cre-infected mouse fetal fibroblasts, but does not function in the intact mouse for reasons not clear. Slc39a8(neo) is a hypomorphic allele, because Slc39a8(neo/neo) homozygotes exhibit dramatically decreased ZIP8 expression in embryo, fetus, and visceral yolk sac - in comparison to their littermate wild-type controls. This ZIP8 hypomorph will be instrumental in studying developmental and in utero physiological functions of the ZIP8 transporter.

  2. Evidence for epistasis between SLC6A4 and ITGB3 in autism etiology and in the determination of platelet serotonin levels.

    Science.gov (United States)

    Coutinho, Ana M; Sousa, Inês; Martins, Madalena; Correia, Catarina; Morgadinho, Teresa; Bento, Celeste; Marques, Carla; Ataíde, Assunção; Miguel, Teresa S; Moore, Jason H; Oliveira, Guiomar; Vicente, Astrid M

    2007-04-01

    Autism is a neurodevelopmental disorder of unclear etiology. The consistent finding of platelet hyperserotonemia in a proportion of patients and its heritability within affected families suggest that genes involved in the serotonin system play a role in this disorder. The role in autism etiology of seven candidate genes in the serotonin metabolic and neurotransmission pathways and mapping to autism linkage regions (SLC6A4, HTR1A, HTR1D, HTR2A, HTR5A, TPH1 and ITGB3) was analyzed in a sample of 186 nuclear families. The impact of interactions among these genes in autism was assessed using the multifactor-dimensionality reduction (MDR) method in 186 patients and 181 controls. We further evaluated whether the effect of specific gene variants or gene interactions associated with autism etiology might be mediated by their influence on serotonin levels, using the quantitative transmission disequilibrium test (QTDT) and the restricted partition method (RPM), in a sample of 109 autistic children. We report a significant main effect of the HTR5A gene in autism (P = 0.0088), and a significant three-locus model comprising a synergistic interaction between the ITGB3 and SLC6A4 genes with an additive effect of HTR5A (P level distribution (P = 0.0163). The most significant models contributing to serotonin distribution were found for interactions between TPH1 rs4537731 and SLC6A4 haplotypes (P = 0.002) and between HTR1D rs6300 and SLC6A4 haplotypes (P = 0.013). In addition to the significant independent effects, evidence for interaction between SLC6A4 and ITGB3 markers was also found. The overall results implicate SLC6A4 and ITGB3 gene interactions in autism etiology and in serotonin level determination, providing evidence for a common underlying genetic mechanism and a molecular explanation for the association of platelet hyperserotonemia with autism.

  3. Bile acid-regulated peroxisome proliferator-activated receptor-α (PPARα) activity underlies circadian expression of intestinal peptide absorption transporter PepT1/Slc15a1.

    Science.gov (United States)

    Okamura, Ayako; Koyanagi, Satoru; Dilxiat, Adila; Kusunose, Naoki; Chen, Jia Jun; Matsunaga, Naoya; Shibata, Shigenobu; Ohdo, Shigehiro

    2014-09-05

    Digested proteins are mainly absorbed as small peptides composed of two or three amino acids. The intestinal absorption of small peptides is mediated via only one transport system: the proton-coupled peptide transporter-1 (PepT1) encoded from the soluble carrier protein Slc15a1. In mammals, intestinal expression of PepT1/Slc15a1 oscillates during the daily feeding cycle. Although the oscillation in the intestinal expression of PepT1/Slc15a1 is suggested to be controlled by molecular components of circadian clock, we demonstrated here that bile acids regulated the oscillation of PepT1/Slc15a1 expression through modulating the activity of peroxisome proliferator-activated receptor α (PPARα). Nocturnally active mice mainly consumed their food during the dark phase. PPARα activated the intestinal expression of Slc15a1 mRNA during the light period, and protein levels of PepT1 peaked before the start of the dark phase. After food intake, bile acids accumulated in intestinal epithelial cells. Intestinal accumulated bile acids interfered with recruitment of co-transcriptional activator CREB-binding protein/p300 on the promoter region of Slc15a1 gene, thereby suppressing PPARα-mediated transactivation of Slc15a1. The time-dependent suppression of PPARα-mediated transactivation by bile acids caused an oscillation in the intestinal expression of PepT1/Slc15a1 during the daily feeding cycle that led to circadian changes in the intestinal absorption of small peptides. These findings suggest a molecular clock-independent mechanism by which bile acid-regulated PPARα activity governs the circadian expression of intestinal peptide transporter.

  4. First-principles-driven model-based current profile control for the DIII-D tokamak via LQI optimal control

    Science.gov (United States)

    Boyer, Mark D.; Barton, Justin; Schuster, Eugenio; Luce, Tim C.; Ferron, John R.; Walker, Michael L.; Humphreys, David A.; Penaflor, Ben G.; Johnson, Robert D.

    2013-10-01

    In tokamak fusion plasmas, control of the spatial distribution profile of the toroidal plasma current plays an important role in realizing certain advanced operating scenarios. These scenarios, characterized by improved confinement, magnetohydrodynamic stability, and a high fraction of non-inductively driven plasma current, could enable steady-state reactor operation with high fusion gain. Current profile control experiments at the DIII-D tokamak focus on using a combination of feedforward and feedback control to achieve a targeted current profile during the ramp-up and early flat-top phases of the shot and then to actively maintain this profile during the rest of the discharge. The dynamic evolution of the current profile is nonlinearly coupled with several plasma parameters, motivating the design of model-based control algorithms that can exploit knowledge of the system to achieve desired performance. In this work, we use a first-principles-driven, control-oriented model of the current profile evolution in low confinement mode (L-mode) discharges in DIII-D to design a feedback control law for regulating the profile around a desired trajectory. The model combines the magnetic diffusion equations with empirical correlations for the electron temperature, resistivity, and non-inductive current drive. To improve tracking performance of the system, a nonlinear input transformation is combined with a linear-quadratic-integral (LQI) optimal controller designed to minimize a weighted combination of the tracking error and controller effort. The resulting control law utilizes the total plasma current, total external heating power, and line averaged plasma density as actuators. A simulation study was used to test the controller's performance and ensure correct implementation in the DIII-D plasma control system prior to experimental testing. Experimental results are presented that show the first-principles-driven model-based control scheme's successful rejection of input

  5. SIMULATION AND IMPLEMENTATION OF CURRENT CONTROL OF BRUSHLESS DC MOTOR BASED ON A COMMON DC SIGNAL

    Directory of Open Access Journals (Sweden)

    J.Karthikeyan

    2010-06-01

    Full Text Available The objective of this project is to build a simple current controlled modulation technique for brushless dc motors. In electric traction and most other applications, a wide range of speed and torque control of the electric motor is required. The dc machine fulfills these requirements, but the dc machine requires constant maintenance. But the brushless permanent magnet motors do not have brushes and so they require less maintenance only. Brushless dc motors are widely used in applications which require wide range of speed and torque control because of its low inertia, fast response, high reliability and maintenance free. This current controlled technique is based on the generation of quasi- square wave currents using only one controller for the three phases. The current control strategy uses a triangular carrier for the power transistors which is simpler and more accuratethan any other options. The advantages of this technique are: a The stator currents are completely characterized by their maximum amplitude , b The three phases are controlled with the same dc component , and then the phase currents are kept at exactly the same magnitude I max, c The dc link current measurement is not required .d phase currents are kept balanced and phase over currents are eliminated.

  6. Active-Only Current Controlled Summing/Difference Amplifiers Using CCCIIs

    Directory of Open Access Journals (Sweden)

    Sudhanshu Maheshwari

    2003-01-01

    Full Text Available Novel active-only summing/difference amplifiers employing only current controlled conveyors (CCCIIs are presented. The circuits possess high input impedance, current controllable gain, good linearity and dynamic range, low THD and are suited for IC implementation. SPICE simulation results are included to verify the circuits.

  7. Decoupled Double Synchronous Reference Frame Current Controller for Unbalanced Grid Voltage Conditions

    DEFF Research Database (Denmark)

    Reyes, M.; Rodriguez, Pedro; Vazquez, S.;

    2012-01-01

    -sequence current components is becoming necessary for achieving new capabilities like the reactive power injection during a grid fault. This paper deals with a fundamental issue in this topic, i.e., the performance of the current controller. Classical dq controllers, which are extensively used in industrial...

  8. Research on transient hysteresis current control strategy of DC-DC converter

    Science.gov (United States)

    Zhang, Ting; Wang, Zu-liang; Zhao, Yu-kai

    2017-01-01

    In order to improve the dynamic performance of DC-DC converter, transient hysteresis current control strategy is proposed which is based on parallel computing and combinational logic. By making a comparison between the real-time inductor current and the threshold inductor current, the switch is controlled more accurately. Under the Matlab/Simulink environment, the process of the Buck-Boost converter was simulated. The simulation results show that the transient hysteresis current control strategy can effectively overcome the disadvantages when load changes or input voltage disturbance occurs, it posses high load regulation and short dynamic response time, and it verifies the feasibility of the proposed strategy.

  9. Disruption of Slc4a10 augments neuronal excitability and modulates synaptic short-term plasticity

    Directory of Open Access Journals (Sweden)

    Anne eSinning

    2015-06-01

    Full Text Available Slc4a10 is a Na+-coupled Cl--HCO3- exchanger, which is expressed in principal and inhibitory neurons as well as in choroid plexus epithelial cells of the brain. Slc4a10 knockout mice have collapsed brain ventricles and display an increased seizure threshold, while heterozygous deletions in man have been associated with idiopathic epilepsy and other neurological symptoms. To further characterize the role of Slc4a10 for network excitability, we compared input-output relations as well as short and long term changes of evoked field potentials in Slc4a10 knockout and wildtype mice. While responses of CA1 pyramidal neurons to stimulation of Schaffer collaterals were increased in Slc4a10 knockout mice, evoked field potentials did not differ between genotypes in the stratum radiatum or the neocortical areas analyzed. Paired pulse facilitation was diminished in the hippocampus upon disruption of Slc4a10 and paired pulse depression was increased in the neocortex. Though short term plasticity is modulated via Slc4a10, long term potentiation appears independent of Slc4a10. Our data support that Slc4a10 dampens neuronal excitability and thus sheds light on the pathophysiology of SLC4A10 associated pathologies.

  10. Cloning and expression of SLC1OA4,a putative organic anion transport protein

    Institute of Scientific and Technical Information of China (English)

    Patrick L Splinter; Konstantinos N Lazaridis; Paul A Dawson; Nicholas F LaRusso

    2006-01-01

    AIM:To determine if novel bile acid transporters may be expressed in human tissues.METHODS:SLC10A1 (NTCP) was used as a probe to search the NCBI database for homology to previously uncharacterized ESTs. The homology search identified an EST (termed SLC10A4) that shares sequence identity with SLC10A1 and SLC10A2 (ASBT). We performed Northern blot analysis and RT-PCR to determine the tissue distribution of SLC10A4. SLC10A4 was cloned in frame with an epitope tag and overexpressed in CHO cells to determine cellular localization and functional analysis of bile acid uptake.RESULTS:Northern analysis revealed that SLC 10A4 mRNA is ubiquitously expressed fn human tissues with the highest levels of mRNA expression in brain,placenta, and liver. In SLC10A4-transfected CHO cells,immunoblotting analysis and immunofluorescence staining demonstrated a 49-kDa protein that is expressed at the plasma membrane and intracellular compartments.Functional analysis of SLC10A4 showed no significant taurocholate uptake in the presence of sodium when compared to untransfected CHO cells.CONCLUSION:To date, we have shown that this protein has no capacity to transport taurocholate relative to SLC1041; however, given its ubiquitous tissue distribution, it may play a more active role in transporting other endogenous organic anions.

  11. Current Sensorless Control Algorithm for Single-Phase Three-Level NPC Inverter

    Directory of Open Access Journals (Sweden)

    Suzdalenko Alexander

    2014-12-01

    Full Text Available The current measurement is becoming a challenging task in power converters operating at high switching frequencies, moreover traditional control system requires two control loops - first (slow regulates DC-link voltage, second (fast controls the shape of current, that all together results in complicated transfer function and long transition periods. The current sensorless control (CSC allows neglecting the mentioned problems. This research for the first time presents the solution of CSC implementation in single-phase three-level neutral point clamped inverter. Mathematical equations were defined for inductor current peaks and transistor conduction time during discontinuous and continuous conduction modes, as well as major problem of current fitting between different voltage levels (consequently with different current peak-to-peak values was solved, providing two solutions - pre-fitting and post-fitting trajectories. The verification of our theoretical assumptions and analytical equations was confirmed by the simulation analysis. Challenges of real experiments are discussed in the conclusion.

  12. Design of Nonlinear Robust Rotor Current Controller for DFIG Based on Terminal Sliding Mode Control and Extended State Observer

    Directory of Open Access Journals (Sweden)

    Guowei Cai

    2014-01-01

    Full Text Available As to strong nonlinearity of doubly fed induction generators (DFIG and uncertainty of its model, a novel rotor current controller with nonlinearity and robustness is proposed to enhance fault ride-though (FRT capacities of grid-connected DFIG. Firstly, the model error, external disturbances, and the uncertain factors were estimated by constructing extended state observer (ESO so as to achieve linearization model, which is compensated dynamically from nonlinear model. And then rotor current controller of DFIG is designed by using terminal sliding mode variable structure control theory (TSMC. The controller has superior dynamic performance and strong robustness. The simulation results show that the proposed control approach is effective.

  13. All-electric-controlled spin current switching in single-molecule magnet-tunnel junctions

    Institute of Scientific and Technical Information of China (English)

    Zhang Zheng-Zhong; Shen Rui; Sheng Li; Wang Rui-Qiang; Wang Bai-Gen; Xing Ding-Yu

    2011-01-01

    A single-molecule magnet (SMM)coupled to two normal metallic electrodes can both switch spin-up and spindown electronic currents within two different windows of SMM gate voltage. Such spin current switching in the SMM tunnel junction arises from spin-selected single electron resonant tunneling via the lowest unoccupied molecular orbit of the SMM. Since it is not magnetically controlled but all-electrically controlled, the proposed spin current switching effect may have potential applications in future spintronics.

  14. Adaptive Hysteresis Band Current Control for Transformerless Single-Phase PV Inverters

    DEFF Research Database (Denmark)

    Vázquez, Gerardo; Rodriguez, Pedro; Ordoñez, Rafael

    2009-01-01

    Current control based on hysteresis algorithms are widely used in different applications, such as motion control, active filtering or active/reactive power delivery control in distributed generation systems. The hysteresis current control provides to the system a fast and robust dynamic response......, and requires a simple implementation in standard digital signal platforms. On the other hand, the main drawback of classical hysteresis current control lies in the fact that the switching frequency is variable, as the hysteresis band is fixed. In this paper a variable band hysteresis control algorithm...... will be presented. As it will be shown, this variable band permits overcoming the aforementioned problem giving rise to an almost constant switching frequency. The performance of this algorithm, together with classical hysteresis controls and proportional resonant (PR) controllers, has been evaluated in three...

  15. SLC-off Landsat-7 ETM+ reflective band radiometric calibration

    Science.gov (United States)

    Markham, B.L.; Barsi, J.A.; Thome, K.J.; Barker, J.L.; Scaramuzza, P.L.; Helder, D.L.; ,

    2005-01-01

    Since May 31, 2003, when the scan line corrector (SLC) on the Landsat-7 ETM+ failed, the primary foci of Landsat-7 ETM+ analyses have been on understanding and attempting to fix the problem and later on developing composited products to mitigate the problem. In the meantime, the Image Assessment System personnel and vicarious calibration teams have continued to monitor the radiometric performance of the ETM+ reflective bands. The SLC failure produced no measurable change in the radiometric calibration of the ETM+ bands. No trends in the calibration are definitively present over the mission lifetime, and, if present, are less than 0.5% per year. Detector 12 in Band 7 dropped about 0.5% in response relative to the rest of the detectors in the band in May 2004 and recovered back to within 0.1% of its initial relative gain in October 2004.

  16. Multi-frequency proportional-resonant (MFPR) current controller for PWM VSC under unbalanced supply conditions

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    This letter presents a multi-frequency proportional-resonant (MFPR) current controller developed for PWM voltage source converter (VSC) under the unbalanced supply voltage conditions. The delta operator is used in place of the shift operator for the implementation of MFPR by using a low-cost fixed-point DSP. The experimental results with an alternative control strategy validated the feasibility of the proposed MFPR current controller for the PWM VSC during voltage unbalance.

  17. Differential expression of the Slc4 bicarbonate transporter family in murine corneal endothelium and cell culture.

    Science.gov (United States)

    Shei, William; Liu, Jun; Htoon, Hla M; Aung, Tin; Vithana, Eranga N

    2013-01-01

    To characterize the relative expression levels of all the solute carrier 4 (Slc4) transporter family members (Slc4a1-Slc4a11) in murine corneal endothelium using real-time quantitative (qPCR), to identify further important members besides Slc4a11 and Slc4a4, and to explore how close to the baseline levels the gene expressions remain after cells have been subjected to expansion and culture. Descemet's membrane-endothelial layers of 8-10-week-old C57BL6 mice were stripped from corneas and used for both primary cell culture and direct RNA extraction. Total RNA (from uncultured cells as well as cultured cells at passages 2 and 7) was reverse transcribed, and the cDNA was used for real time qPCR using specific primers for all the Slc4 family members. The geNorm method was applied to determine the most stable housekeeping genes and normalization factor, which was calculated from multiple housekeeping genes for more accurate and robust quantification. qPCR analyses revealed that all Slc4 bicarbonate transporter family members were expressed in mouse corneal endothelium. Slc4a11 showed the highest expression, which was approximately three times higher than that of Slc4a4 (3.4±0.3; p=0.004). All Slc4 genes were also expressed in cultured cells, and interestingly, the expression of Slc4a11 in cultured cells was significantly reduced by approximately 20-fold (0.05±0.001; p=0.000001) in early passage and by approximately sevenfold (0.14±0.002; p=0.000002) in late passage cells. Given the known involvement of SLC4A4 and SLC4A11 in corneal dystrophies, we speculate that the other two highly expressed genes in the uncultured corneal endothelium, SLC4A2 and SLC4A7, are worthy of being considered as potential candidate genes for corneal endothelial diseases. Moreover, as cell culture can affect expression levels of Slc4 genes, caution and careful design of experiments are necessary when undertaking studies of Slc4-mediated ion transport in cultured cells.

  18. Downregulation of organic cation transporters OCT1 (SLC22A1 and OCT3 (SLC22A3 in human hepatocellular carcinoma and their prognostic significance

    Directory of Open Access Journals (Sweden)

    Heise Michael

    2012-03-01

    Full Text Available Abstract Background Organic cation transporters (OCT are responsible for the uptake and intracellular inactivation of a broad spectrum of endogenous substrates and detoxification of xenobiotics and chemotherapeutics. The transporters became pharmaceutically interesting, because OCTs are determinants of the cytotoxicity of platin derivates and the transport activity has been shown to correlate with the sensitivity of tumors towards tyrosine kinase inhibitors. No data exist about the relevance of OCTs in hepatocellular carcinoma (HCC. Methods OCT1 (SLC22A1 and OCT3 (SLC22A3 mRNA expression was measured in primary human HCC and corresponding non neoplastic tumor surrounding tissue (TST by real time PCR (n = 53. Protein expression was determined by western blot analysis and immunofluorescence. Data were correlated with the clinicopathological parameters of HCCs. Results Real time PCR showed a downregulation of SLC22A1 and SLC22A3 in HCC compared to TST (p ≤ 0.001. A low SLC22A1 expression was associated with a worse patient survival (p SLC22A1 was less frequently downregulated in tumors with lower stages who underwent transarterial chemoembolization (p SLC22A1 expression (SLC22A3 expression compared to HCC with high SLC22A1 expression (p SLC22A3 expression. In the western blot analysis we found a different protein expression pattern in tumor samples with a more diffuse staining in the immunofluorescence suggesting that especially OCT1 is not functional in advanced HCC. Conclusion The downregulation of OCT1 is associated with tumor progression and a worse patient survival.

  19. On-line current feed and computer aided control tactics for automatic balancing head

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    In the designed automatic balancing head,a non-contact induction transformer is used to deliver driving energy to solve the problem of current fed and controlling on-line.Computer controlled automatic balancing experiments with phase-magnitude control tactics were performed on a flexible rotor system.Results of the experiments prove that the energy feeding method and the control tactics are effective in the automatic balancing head for vibration controlling.

  20. Feedback Control of Plasma Current and Horizontal Position in HT-7

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    There is a strong magnetic coupling between poloidal field coils of superconducting tokamak HT-7, especially between ohinic heating and vertical field coils. These coils are connected to individual power supply. The control system for the plasma current and horizontal position control has been designed and showed satisfactory results with the feedback control of multivariable feedforward-decoupling and var-parameter PID controller to simultaneously modulate power supplies. The design and analysis of the control system is presented.

  1. Enhancing the Frequency Adaptability of Periodic Current Controllers for Grid-Connected Power Converters

    DEFF Research Database (Denmark)

    Yang, Yongheng; Zhou, Keliang; Blaabjerg, Frede

    2015-01-01

    (PR) and Repetitive Controllers (RC). The synchronization is actually to detect the instantaneous grid information (e.g., frequency and phase of the grid voltage) for the current control, which is commonly performed by a Phase-Locked-Loop (PLL) system. As a consequence, harmonics and deviations......It is mandatory for grid-connected power converters to synchronize the feed-in currents with the grid. Moreover, the power converters should produce feed-in currents with low total harmonic distortions according to the demands, by employing advanced current controllers, e.g., Proportional Resonant...... deviations. Experiments on a single-phase grid-connected inverter system are presented, which have verified the proposals and also the effectiveness of the frequency adaptive current controllers....

  2. A Hierarchical Control Scheme for Reactive Power and Harmonic Current Sharing in Islanded Microgrids

    DEFF Research Database (Denmark)

    Lorzadeh, Iman; Firoozabadi, Mehdi Savaghebi; Askarian Abyaneh, Hossein

    2015-01-01

    of each inverter output current are extracted at primary level and transmitted to the secondary controller. Then, instantaneous circulating currents at different frequencies are calculated and applied by the secondary level to generate proper control signals for accurate reactive power and harmonic......In this paper, a hierarchical control scheme consisting of primary and secondary levels is proposed for achieving accurate reactive power and harmonic currents sharing among interface inverters of distributed generators (DGs) in islanded microgrids. Firstly, fundamental and main harmonic components...... current sharing among the inverters. Consequently, these signals are sent to the primary level and inserted as voltage references after passing the control blocks. In contrast to the conventional virtual impedance schemes, where reactive power and harmonic current sharing are realized at the expense...

  3. A deletion mutation in bovine SLC4A2 is associated with osteopetrosis in Red Angus cattle

    Directory of Open Access Journals (Sweden)

    Beever Jonathan E

    2010-05-01

    Full Text Available Abstract Background Osteopetrosis is a skeletal disorder of humans and animals characterized by the formation of overly dense bones, resulting from a deficiency in the number and/or function of bone-resorbing osteoclast cells. In cattle, osteopetrosis can either be induced during gestation by viral infection of the dam, or inherited as a recessive defect. Genetically affected calves are typically aborted late in gestation, display skull deformities and exhibit a marked reduction of osteoclasts. Although mutations in several genes are associated with osteopetrosis in humans and mice, the genetic basis of the cattle disorder was previously unknown. Results We have conducted a whole-genome association analysis to identify the mutation responsible for inherited osteopetrosis in Red Angus cattle. Analysis of >54,000 SNP genotypes for each of seven affected calves and nine control animals localized the defective gene to the telomeric end of bovine chromosome 4 (BTA4. Homozygosity analysis refined the interval to a 3.4-Mb region containing the SLC4A2 gene, encoding an anion exchanger protein necessary for proper osteoclast function. Examination of SLC4A2 from normal and affected animals revealed a ~2.8-kb deletion mutation in affected calves that encompasses exon 2 and nearly half of exon 3, predicted to prevent normal protein function. Analysis of RNA from a proven heterozygous individual confirmed the presence of transcripts lacking exons 2 and 3, in addition to normal transcripts. Genotyping of additional animals demonstrated complete concordance of the homozygous deletion genotype with the osteopetrosis phenotype. Histological examination of affected tissues revealed scarce, morphologically abnormal osteoclasts displaying evidence of apoptosis. Conclusions These results indicate that a deletion mutation within bovine SLC4A2 is associated with osteopetrosis in Red Angus cattle. Loss of SLC4A2 function appears to induce premature cell death, and

  4. Simple DCM or CRM analog peak current controller for HV capacitor charge-discharge applications

    DEFF Research Database (Denmark)

    Trintis, Ionut; Dimopoulos, Emmanouil; Munk-Nielsen, Stig

    2013-01-01

    This paper presents a simple analog current controller suitable for buck and boost converter topologies. The controller operates in DCM or CRM, depending on the setup. The experimental results are presented to validate the proposed controller functionality for a high voltage capacitor charge...

  5. Frequency Response Analysis of Current Controllers for Selective Harmonic Compensation in Active Power Filters

    DEFF Research Database (Denmark)

    Lascu, C.; Asiminoaei, L.; Boldea, I.;

    2009-01-01

    This paper compares four current control structures for selective harmonic compensation in active power filters. All controllers under scrutiny perform the harmonic compensation by using arrays of resonant controllers, one for the fundamental and one for each harmonic of interest, in order to ach...

  6. Multi-Inputs/Multi-Outputs control of plasma current and loop voltage on Tore Supra

    Energy Technology Data Exchange (ETDEWEB)

    Nouailletas, R., E-mail: remy.nouailletas@cea.fr [CEA, F-13108 Saint Paul lez Durance (France); Barana, O.; Saint-Laurent, F.; Brémond, S.; Moreau, P.; Ekedahl, A.; Artaud, J.-F. [CEA, F-13108 Saint Paul lez Durance (France)

    2013-10-15

    During a tokamak discharge, several control modes may have to be run in sequence in order to perform the control of the different discharge phases. The transitions between these control modes are not always easy to handle because in most cases the coupling between the controlled plasma quantities is not taken into account in each control mode design process. This paper presents a new Multi-Inputs/Multi-Outputs (MIMO) controller applied on Tore Supra to control both plasma current and flux variations through the central solenoid voltage and the lower hybrid current drive (LHCD) system power. It deals with the transition from a loop voltage floating mode to a loop voltage control mode. The controller, synthesized and tuned using a model-based approach, has been validated in simulation before its successful implementation on Tore Supra experiments.

  7. Complex state variable- and disturbance observer-based current controllers for AC drives

    DEFF Research Database (Denmark)

    Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede

    2013-01-01

    , extracted by a disturbance observer and then injected into the current controller. In this study, a revised version of a disturbance observer-based controller and a well known complex variable model-based design with a single set of complex pole are compared in terms of design aspects and performance...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...

  8. Transcriptomic and Immunohistochemical Profiling of SLC6A14 in Pancreatic Ductal Adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Alan R. Penheiter

    2015-01-01

    PDAC patients. The best imaging target identified was SLC6A14 (a neutral and basic amino acid transporter. SLC6A14 was overexpressed at the transcriptional level in all patients and expressed at the protein level in 95% of PDAC tumors. Very little is known about the role of SLC6A14 in PDAC and our results demonstrate that this target merits further investigation as a candidate transporter for functional imaging of PDAC.

  9. A low noise modular current source for stable magnetic field control

    Science.gov (United States)

    Biancalana, Valerio; Bevilacqua, Giuseppe; Chessa, Piero; Dancheva, Yordanka; Cecchi, Roberto; Stiaccini, Leonardo

    2017-03-01

    A low cost, stable, programmable, unipolar current source is described. The circuit is designed in view of a modular arrangement, suitable for applications where several DC sources must be controlled at once. A hybrid switching/linear design helps in improving the stability and in reducing the power dissipation and cross-talking. Multiple units can be supplied by a single DC power supply, while allowing for a variety of maximal current values and compliance voltages at the outputs. The circuit is analogically controlled by a unipolar voltage, enabling current programmability and control through commercial digital-to-analogue conversion cards.

  10. An Improved Distributed Secondary Control Method for DC Microgrids With Enhanced Dynamic Current Sharing Performance

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Panbao; Lu, Xiaonan; Yang, Xu; Wang, Wei; Xu, Dianguo

    2016-09-01

    This paper proposes an improved distributed secondary control scheme for dc microgrids (MGs), aiming at overcoming the drawbacks of conventional droop control method. The proposed secondary control scheme can remove the dc voltage deviation and improve the current sharing accuracy by using voltage-shifting and slope-adjusting approaches simultaneously. Meanwhile, the average value of droop coefficients is calculated, and then it is controlled by an additional controller included in the distributed secondary control layer to ensure that each droop coefficient converges at a reasonable value. Hence, by adjusting the droop coefficient, each participating converter has equal output impedance, and the accurate proportional load current sharing can be achieved with different line resistances. Furthermore, the current sharing performance in steady and transient states can be enhanced by using the proposed method. The effectiveness of the proposed method is verified by detailed experimental tests based on a 3 × 1 kW prototype with three interface converters.

  11. PRIMARY SIDE DETECTION AND PEAK CURRENT MODE CONTROL IN FLYBACK CONVERTER

    Institute of Scientific and Technical Information of China (English)

    Fang Jian; Lu Zhiping; Yang Jian; Li Zhaoji

    2004-01-01

    A new cycle-by-cycle control flyback converter with primary side detection and peak current mode control is proposed and its dynamic characteristics are analyzed. The flyback converter is verified by the OrCAD simulator. The main advantages of this converter over the conventional one are simplicity, small size, rapid regulating and no sensing control signals over the isolation barrier. The circuit is suitable for digital control implementations.

  12. [An automatic torque control system for a bicycle ergometer equipped with an eddy current brake].

    Science.gov (United States)

    Kikinev, V V

    2007-01-01

    The main elements of the loading device of a bicycle ergometer, including an eddy current brake and a torque sensor, are described. The automatic torque control system, which includes the loading device, is equipped with a stabilizing feedback controller that optimally approximates the closed-loop transfer function of the target model. The reduced transfer function model of the controller is of the fourth order. A method featuring a modulation-demodulation loop is suggested for implementation of the control system.

  13. Assessment of waveform control method for mitigation of low-frequency current ripple

    OpenAIRE

    Zhu, GR; Wang, HR; Xiao, CY; Kang, Y.; Tan, SC

    2013-01-01

    Waveform control method can mitigate such a low-frequency ripple current being drawn from the DC distribution while the DC distribution system delivers AC power to the load through a differential inverter. Assessment on the waveform control method and comparative study between with and without waveform control method are proposed in this paper1. Experimental results are provided to explain the operation and showcase the performance between with and without the waveform control method. Results...

  14. Current and Future Research in Active Control of Lightweight, Flexible Structures Using the X-56 Aircraft

    Science.gov (United States)

    Ryan, John J.; Bosworth, John T.; Burken, John J.; Suh, Peter M.

    2014-01-01

    The X-56 Multi-Utility Technology Testbed aircraft system is a versatile experimental research flight platform. The system was primarily designed to investigate active control of lightweight flexible structures, but is reconfigurable and capable of hosting a wide breadth of research. Current research includes flight experimentation of a Lockheed Martin designed active control flutter suppression system. Future research plans continue experimentation with alternative control systems, explore the use of novel sensor systems, and experiments with the use of novel control effectors. This paper describes the aircraft system, current research efforts designed around the system, and future planned research efforts that will be hosted on the aircraft system.

  15. A Harmonic Current Suppression Control Strategy for Droop-Controlled Inverter Connected to the Distorted Grid

    DEFF Research Database (Denmark)

    Wei, Feng; Sun, Kai; Guan, Yajuan;

    2015-01-01

    being adopted for abstracting the fundamental components of grid voltage. The injected fundamental power is controlled through droop controller, and a hybrid voltage controller of GF-VCI with PI and R regulators in rotary frame is adopted for improving of the tracking capability of the grid harmonic...

  16. An improved current control scheme for grid-connected DG unit based distribution system harmonic compensation

    DEFF Research Database (Denmark)

    He, Jinwei; Wei Li, Yun; Wang, Xiongfei;

    2013-01-01

    In order to utilize DG unit interfacing converters to actively compensate distribution system harmonics, this paper proposes an enhanced current control approach. It seamlessly integrates system harmonic mitigation capabilities with the primary DG power generation function. As the proposed curren...

  17. Active harmonic filtering using current-controlled, grid-connected DG units with closed-loop power control

    DEFF Research Database (Denmark)

    He, Jinwei; Li, Yun Wei; Blaabjerg, Frede

    2014-01-01

    voltage detection are not necessary for the proposed harmonic compensation method. Moreover, a closed-loop power control scheme is employed to directly derive the fundamental current reference without using any phase-locked loops (PLL). The proposed power control scheme effectively eliminates the impacts...

  18. Control Strategies for Islanded Microgrid using Enhanced Hierarchical Control Structure with Multiple Current-Loop Damping Schemes

    DEFF Research Database (Denmark)

    Han, Yang; Shen, Pan; Zhao, Xin

    2017-01-01

    In this paper, the modeling, controller design, and stability analysis of the islanded microgrid (MG) using enhanced hierarchical control structure with multiple current loop damping schemes is proposed. The islanded MG is consisted of the parallel-connected voltage source inverters using LCL...

  19. Distributed Cooperative Current-Sharing Control of Parallel Chargers Using Feedback Linearization

    OpenAIRE

    Jiangang Liu; Zhiwu Huang; Jing Wang; Jun Peng; Weirong Liu

    2014-01-01

    We propose a distributed current-sharing scheme to address the output current imbalance problem for the parallel chargers in the energy storage type light rail vehicle system. By treating the parallel chargers as a group of agents with output information sharing through communication network, the current-sharing control problem is recast as the consensus tracking problem of multiagents. To facilitate the design, input-output feedback linearization is first applied to transform the nonidentica...

  20. CURRENT VECTOR CONTROL OF PERMANENT-MAGNET SYNCHRONOUS MOTOR OF HYBRID VEHICLE ENGINE

    Directory of Open Access Journals (Sweden)

    S. Serikov

    2009-01-01

    Full Text Available Characteristics of traction permanent-magnet synchronous motor under current vector optimum control in the possible traction-speed mode area which are relevant for hybrid vehicle engine have been investigated. As a criterion of optimality a maximum of electromagnetic moment per unit of current have been taken.

  1. Double-Frame Current Control with a Multivariable PI Controller and Power Compensation for Weak Unbalanced Networks

    CERN Document Server

    Siemaszko, D

    2015-01-01

    The handling of weak networks with asymmetric loads and disturbances im- plies the accurate handling of the second-harmonic component that appears in an unbalanced network. This paper proposes a classic vector control approach using a PI-based controller with superior decoupling capabilities for operation in weak networks with unbalanced phase voltages. A synchronization method for weak unbalanced networks is detailed, with dedicated dimensioning rules. The use of a double-frame controller allows a current symmetry or controlled imbalance to be forced for compensation of power oscillations by controlling the negative current sequence. This paper also serves as a useful reminder of the proper way to cancel the inherent coupling effect due to the transformation to the synchronous rotating reference frame, and of basic considerations of the relationship between switching frequency and control bandwidth.

  2. Adaptive rotor current control for wind-turbine driven DFIG using resonant controllers in a rotor rotating reference frame

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    This paper proposes an adaptive rotor current controller for doubly-fed induction generator (DFIG), which consists of a proportional (P) controller and two harmonic resonant (R) controllers implemented in the rotor rotating reference frame. The two resonant controllers are tuned at slip frequencies ωslip+ and ωslip-, respectively. As a result, the positive- and negative-sequence components of the rotor current are fully regulated by the PR controller without involving the positive- and negative-sequence decomposition, which in effect improves the fault ride-through (FRT) capability of the DFIG-based wind power generation system during the period of large transient grid voltage unbalance. Correctness of the theoretical analysis and feasibility of the proposed unbalanced control scheme are validated by simulation on a 1.5-MW DFIG wind power generation system.

  3. Lateral Current Reduction by Voltage Drop Compensator for Multiple Autonomously Controlled UPS Connected in Parallel

    Science.gov (United States)

    Sato, Eduardo Kazuhide; Kawamura, Atsuo

    An autonomous control for redundant parallelism of uninterruptible power supplies (UPS) connected in parallel has successfully been proposed and discussed in theoretical and experimental terms. This independent control only requires the measurement of the output current. With the computation of the active and reactive currents, proportional-integral-based controllers provide the phase angle and amplitude, respectively, of the output voltage. However, when voltage difference between UPS exists, there is a flow of reactive lateral current, which makes the load sharing disproportional. A preliminary approach to reduce this circulating current considers a high proportional gain in the control equation for output voltage amplitude in order to reduce the offset error. Nevertheless it implies in high variation of the voltage amplitude, so that voltage levels easily reaches the limit, and the respective control equation becomes incapable to compensate any voltage difference. This paper proposes a compensator to counterbalance the voltage drop caused by the proportional gain of the control equation for the voltage amplitude. Implementation in an experimental setup with three UPS with different output rating connected in parallel shows significant reduction of the reactive lateral current, and consequent improvement of the current distribution, including employment of voltage limiters (1%), under various conditions.

  4. Association between a genetic variant in the serotonin transporter gene (SLC6A4) and suicidal behavior in patients with schizophrenia

    DEFF Research Database (Denmark)

    Lindholm Carlstrom, Eva; Saetre, Peter; Rosengren, Anders

    2012-01-01

    ABSTRACT: BACKGROUND: The serotonin (5-hydroxytryptamin; 5-HT) system has a central role in the circuitry of cognition and emotions. Multiple lines of evidence suggest that genetic variation in the serotonin transporter gene (SLC6A4; 5-HTT) is associated with schizophrenia and suicidal behavior. ...... SLC6A4 appears to be involved in suicidal ideation among patients with schizophrenia. Independent replication is needed before more firm conclusions can be drawn.......ABSTRACT: BACKGROUND: The serotonin (5-hydroxytryptamin; 5-HT) system has a central role in the circuitry of cognition and emotions. Multiple lines of evidence suggest that genetic variation in the serotonin transporter gene (SLC6A4; 5-HTT) is associated with schizophrenia and suicidal behavior....... In this study, we wanted to elucidate whether SLC6A4 variations is involved in attempted suicide among patients with schizophrenia in a Scandinavian case-control sample. METHODS: Patients diagnosed with schizophrenia from three Scandinavian samples were assessed for presence or absence of suicide attempts...

  5. Analysis and design of over-current limit control strategies applied in aeronautical power supplies

    Institute of Scientific and Technical Information of China (English)

    WANG Lin-bing; HE Xiang-ning

    2007-01-01

    Some Over-Current Limit Control strategies are analyzed and designed to meet the demands of high reliability and rapid dynamic response in the aeronautical power supply applications. The control schemes are both effective in DC-DC converters and DC-AC converters. Controller models are set up, and the over-current limit operation principles of analogy and digital control are analyzed too. An 800VA aeronautical power supply has been constructed to verify the performance of the proposed control strategy in various cases such as the sudden load change and the constant load. The analysis and experiments confirm the advantages of the proposed over-current limit strategies as follows: simple,effective and reliable.

  6. Study on model current predictive control method of PV grid- connected inverters systems with voltage sag

    Science.gov (United States)

    Jin, N.; Yang, F.; Shang, S. Y.; Tao, T.; Liu, J. S.

    2016-08-01

    According to the limitations of the LVRT technology of traditional photovoltaic inverter existed, this paper proposes a low voltage ride through (LVRT) control method based on model current predictive control (MCPC). This method can effectively improve the photovoltaic inverter output characteristics and response speed. The MCPC method of photovoltaic grid-connected inverter designed, the sum of the absolute value of the predictive current and the given current error is adopted as the cost function with the model predictive control method. According to the MCPC, the optimal space voltage vector is selected. Photovoltaic inverter has achieved automatically switches of priority active or reactive power control of two control modes according to the different operating states, which effectively improve the inverter capability of LVRT. The simulation and experimental results proves that the proposed method is correct and effective.

  7. The Influence of Controller Parameters on the Quality of the Train Converter Current

    Directory of Open Access Journals (Sweden)

    M. Brenna

    2011-01-01

    Full Text Available This paper presents a stability analysis of train converters in order to evaluate how the controller parameters affect the absorbed current. The new dynamic model presented in this paper is capable of considering the time-variant nature of the system for the correct tuning of the feedback proportional-integral PI controller, applying a current controlled modulation technique never used in high-power traction converters. The reduction of the harmonic content of the current absorbed by a converter employed at the input stage onboard high-speed trains is really important, considering the interaction with the signaling system set up for traffic control. A computer model of the converter, considering both the power and the control structure, has also been implemented in order to deliver a validated tool for the developed theoretical analysis.

  8. Backstepping Control of the Current Profile in the DIII-D Tokamak

    Science.gov (United States)

    Boyer, M. D.; Barton, J.; Schuster, E.; Walker, M. L.; Humphreys, D. A.

    2011-10-01

    Control of the spatial profile of the plasma current in tokamaks has been demonstrated to be a key condition for advanced scenarios with improved confinement and steady-state operation. Non-model-based controllers tested at DIII-D have shown limitations, motivating the design of model-based controllers that account for the dynamics of the q profile. In this work, we utilize a control-oriented model of the current profile evolution in DIII-D to design a backstepping boundary control law for regulating the current profile around a desired feed-forward trajectory. The control scheme makes use of the total plasma current, total power, and line averaged density as actuators. A simulation study is done to test the control law against uncertainties in the model parameters and initial conditions, as well as input disturbances. Finally, the implementation of the controller in the DIII-D plasma control system is discussed and experimental results are presented. Supported by the NSF CAREER award program ECCS-0645086 and the US DOE under DE-FG02-09ER55064 and DE-FC02-04ER54698.

  9. Robust Control of the Spatial Current Profile in the DIII-D Tokamak

    Science.gov (United States)

    Barton, J.; Schuster, E.; Walker, M. L.; Humphreys, D. A.

    2011-10-01

    Advanced tokamak operating scenarios, characterized by large noninductively driven plasma currents, typically require active regulation of a specific current density profile. Non-model-based control of the q profile has been tested at DIII-D. However, some present limitations of the controller motivate the design of a model-based controller that accounts for the dynamics of the whole q profile in response to the control actuators. A control-oriented model of the current profile evolution in DIII-D was recently developed and used to design feedforward control schemes. In order to reject the effects of external disturbances to the system, a feedback control input needs to be added to the feedforward input. In this work, we report on the design of a robust feedback controller, on the implementation of the combined model-based feedforward + feedback controller in the DIII-D Plasma Control System, and on the experimental validation of the combined controller in the DIII-D tokamak. Supported by the NSF CAREER award program ECCS-0645086 and the US DOE under DE-FG02-09ER55064 and DE-FC02-04ER54698.

  10. Current Control in ITER Steady State Plasmas With Neutral Beam Steering

    Energy Technology Data Exchange (ETDEWEB)

    R.V. Budny

    2009-09-10

    Predictions of quasi steady state DT plasmas in ITER are generated using the PTRANSP code. The plasma temperatures, densities, boundary shape, and total current (9 - 10 MA) anticipated for ITER steady state plasmas are specified. Current drive by negative ion neutral beam injection, lower-hybrid, and electron cyclotron resonance are calculated. Four modes of operation with different combinations of current drive are studied. For each mode, scans with the NNBI aimed at differing heights in the plasma are performed to study effects of current control on the q profile. The timeevolution of the currents and q are calculated to evaluate long duration transients. Quasi steady state, strongly reversed q profiles are predicted for some beam injection angles if the current drive and bootstrap currents are sufficiently large.

  11. Mutation Analysis of MR-1, SLC2A1, and CLCN1 in 28 PRRT2-negative Paroxysmal Kinesigenic Dyskinesia Patients

    Institute of Scientific and Technical Information of China (English)

    Hong-Xia Wang; Hong-Fu Li; Gong-Lu Liu; Xiao-Dan Wen; Zhi-Ying Wu

    2016-01-01

    Background:Paroxysmal kinesigenic dyskinesia (PKD) is the most common subtype of paroxysmal dyskinesias and is caused by mutations in PRRT2 gene.The majority of familial PKD was identified to harbor PRRT2 mutations.However,over two-third of sporadic PKD patients did not carry anyPRRT2 mutation,suggesting an existence of additional genetic mutations or possible misdiagnosis due to clinical overlap.Methods:A cohort of 28 Chinese patients clinically diagnosed with sporadic PKD and excluded PRRT2 mutations were recruited.Clinical features were evaluated,and all subjects were screened for MR-1,SLC2A1,and CLCN1 genes,which are the causative genes of paroxysmal nonkinesigenic dyskinesia (PNKD),paroxysmal exertion-induced dyskinesia,and myotonia congenita (MC),respectively.In addition,200 genetically matched healthy individuals were recruited as controls.Results:A total of 16 genetic variants including 4 in MR-1 gene,8 in SLC2A1 gene,and 4 in CLCN1 gene were detected.Among them,SLC2A1 c.363G>A mutation was detected in one case,and CLCN1 c.1205C>T mutation was detected in other two cases.Neither of them was found in 200 controls as well as 1000 Genomes database and ExAC database.Both mutations were predicted to be pathogenic by SIFT and PolyPhen2.The SLC2A1 c.363G>A mutation was novel.Conclusions:The phenotypic overlap may lead to the difficulty in distinguishing PKD from PNKD and MC.For those PRRT2-negative PKD cases,screening of SLC2A1 and CLCN1 genes are useful in confirming the diagnosis.

  12. Characterization of the Human SLC30A8 Promoter and Intronic Enhancer

    Science.gov (United States)

    Pound, Lynley D.; Sarkar, Suparna A.; Cauchi, Stéphane; Wang, Yingda; Oeser, James K.; Lee, Catherine E.; Froguel, Philippe; Hutton, John C.; O'Brien1, Richard M.

    2011-01-01

    Genome-wide association (GWA) studies have shown that a polymorphic variant in SLC30A8, which encodes zinc transporter-8 (ZnT-8), is associated with altered susceptibility to type 2 diabetes (T2D). This association is consistent with the observation that glucose-stimulated insulin secretion is decreased in islets isolated from Slc30a8 knockout mice. In the present study immunohistochemical staining was first used to show that SLC30A8 is expressed specifically in pancreatic islets. Fusion gene studies were then used to examine the molecular basis for the islet-specific expression of SLC30A8. The analysis of SLC30A8-luciferase expression in βTC-3 cells revealed that the proximal promoter region, located between −6154 and −1, relative to the translation start site, was only active in stable but not transient transfections. VISTA analyses identified three regions in the SLC30A8 promoter and a region in SLC30A8 intron 2 that are conserved in the mouse Slc30a8 gene. Additional fusion gene experiments demonstrated that none of these Slc30a8 promoter regions exhibited enhancer activity when ligated to a heterologous promoter whereas the conserved region in SLC30A8 intron 2 conferred elevated reporter gene expression selectively in βTC-3 but not αTC-6 cells. Finally, the functional effects of a single nucleotide polymorphism (SNP), rs62510556, in this conserved intron 2 enhancer were investigated. Gel retardation studies showed that rs62510556 affects the binding of an unknown transcription factor and fusion gene analyses showed that it modulates enhancer activity. However genetic analyses suggest that this SNP is not a causal variant that contributes to the association between SLC30A8 and T2D, at least in Europeans. PMID:21798992

  13. SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.

    Science.gov (United States)

    Liu, Hong; Ma, Yan; He, Hong-Wei; Wang, Jia-Ping; Jiang, Jian-Dong; Shao, Rong-Guang

    2015-01-01

    Autophagy, a self-catabolic process, has been found to be involved in abrogating the proliferation and metastasis of breast cancer. SLC9A3R1 (solute carrier family 9, subfamily A [NHE3, cation proton antiporter 3], member 3 regulator 1), a multifunctional scaffold protein, is involved in suppressing breast cancer cells proliferation and the SLC9A3R1-related signaling pathway regulates the activation of autophagy processes. However, the precise regulatory mechanism and signaling pathway of SLC9A3R1 in the regulation of autophagy processes in breast cancer cells remains unknown. Here, we report that the stability of BECN1, the major component of the autophagic core lipid kinase complex, is augmented in SLC9A3R1-overexpressing breast cancer MDA-MB-231 cells, subsequently stimulating autophagy by attenuating the interaction between BECN1 and BCL2. Initially, we found that SLC9A3R1 partially stimulated autophagy through the PTEN-PI3K-AKT1 signaling cascade in MDA-MB-231 cells. SLC9A3R1 then attenuated the interaction between BECN1 and BCL2 to stimulate the autophagic core lipid kinase complex. Further findings revealed that SLC9A3R1 bound to BECN1 and subsequently blocked ubiquitin-dependent BECN1 degradation. And the deletion of the C-terminal domain of SLC9A3R1 resulted in significantly reduced binding to BECN1. Moreover, the lack of C-terminal of SLC9A3R1 neither reduced the ubiquitination of BECN1 nor induced autophagy in breast cancer cells. The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells. These findings indicate that the SLC9A3R1-BECN1 signaling pathway participates in the activation of autophagy processes in breast cancer cells.

  14. Enhanced Decoupled Double Synchronous Reference Frame Current Controller for Unbalanced Grid-Voltage Conditions

    DEFF Research Database (Denmark)

    Reyes, M.; Rodriguez, Pedro; Vazquez, S.;

    2012-01-01

    . In these codes, the injection of positive- and negative-sequence current components becomes necessary for fulfilling, among others, the low-voltage ride-through requirements during balanced and unbalanced grid faults. However, the performance of classical dq current controllers, applied to power converters......, under unbalanced grid-voltage conditions is highly deficient, due to the unavoidable appearance of current oscillations. This paper analyzes the performance of the double synchronous reference frame controller and improves its structure by adding a decoupling network for estimating and compensating...

  15. Active power filter for medium voltage networks with predictive current control

    Energy Technology Data Exchange (ETDEWEB)

    Verne, Santiago A.; Valla, Maria I. [Laboratorio de Electronica Industrial, Control e Instrumentacion (LEICI), Facultad de Ingenieria, Universidad Nacional de La Plata and CONICET, La Plata (Argentina)

    2010-12-15

    A transformer less Shunt Active Power Filter (SAPF) for medium voltage distribution networks based on Multilevel Diode Clamped Inverter is presented in this paper. Converter current control is based on a Model Predictive strategy, which gives very fast current response. Also, the algorithm includes voltage balancing capability which is essential for proper converter operation. The presented current control algorithm is naturally applicable to converters with an arbitrary number of levels with reduced computational effort by virtue of the incorporation of switching restrictions which are necessary for reliable converter operation. The performance of the proposed algorithm is evaluated by means of computer simulations. (author)

  16. A cooperative control strategy of resistance spot welding process by combining the constant current control with the DRC method

    Institute of Scientific and Technical Information of China (English)

    Li Guizhong; Wang Changzheng; Kong Meng; Guo Caiguang

    2009-01-01

    The modeling control method based on the dynamic resistance characteristics of good nuggets, that is the DRC method, is an improvement on the dynamic resistance threshold method for the quality control of resistance spot welding. But there is still a control blind area in the initial four cycles. For this reason, the quality of every weld nugget could not be fully ensured. Thus a new fuzzy cooperative control method is put forward. It uses a multi-information time-control mechanism by combining the constant current control technology with the DRC method in a relay way. This whole-process control strategy has led to a good control effect and produced the dual-identicul results in the weld nugget quality and the welding time.

  17. Particle-in-cell simulations of electron beam control using an inductive current divider

    Energy Technology Data Exchange (ETDEWEB)

    Swanekamp, S. B.; Angus, J. R.; Cooperstein, G.; Ottinger, P. F.; Richardson, A. S.; Schumer, J. W.; Weber, B. V. [Plasma Physics Division, Naval Research Laboratory, Washington, District of Columbia 20375 (United States)

    2015-11-15

    Kinetic, time-dependent, electromagnetic, particle-in-cell simulations of the inductive current divider are presented. The inductive current divider is a passive method for controlling the trajectory of an intense, hollow electron beam using a vacuum structure that inductively splits the beam's return current. The current divider concept was proposed and studied theoretically in a previous publication [Swanekamp et al., Phys. Plasmas 22, 023107 (2015)]. A central post carries a portion of the return current (I{sub 1}), while the outer conductor carries the remainder (I{sub 2}) with the injected beam current given by I{sub b} = I{sub 1} + I{sub 2}. The simulations are in agreement with the theory which predicts that the total force on the beam trajectory is proportional to (I{sub 2}−I{sub 1}) and the force on the beam envelope is proportional to I{sub b}. Independent control over both the current density and the beam angle at the target is possible by choosing the appropriate current-divider geometry. The root-mean-square (RMS) beam emittance (ε{sub RMS}) varies as the beam propagates through the current divider to the target. For applications where control of the beam trajectory is desired and the current density at the target is similar to the current density at the entrance foil, there is a modest 20% increase in ε{sub RMS} at the target. For other applications where the beam is pinched to a current density ∼5 times larger at the target, ε{sub RMS} is 2–3 times larger at the target.

  18. Optimized design of resonant controller for stator current harmonic compensation in DFIG wind turbine systems

    DEFF Research Database (Denmark)

    Liu, Changjin; Chen, Wenjie; Blaabjerg, Frede

    2012-01-01

    This paper presents an analytical method to optimize the parameters of resonant controller which is used in a Doubly-Fed Induction Generator (DFIG). In the DFIG control system, the fundamental current loop is controlled by PI-controllers, and the stator harmonic current loop is controlled by reso...... design procedure of the resonant controller parameters is presented. The maximum possible gain of the resonant controller can be directly evaluated from the procedure. Simulations and experiments are presented to validate the complete analysis....... by resonant controllers. The effects of the resonant controller on the system stability and the steady-state performance are discussed in details. The analysis shows that the resonant controller has an important impact on the system stability when the resonant frequency is close to the crossover frequency...... of the open loop gain. The gain of the resonant controller is mainly determined by the DFIG transient inductance, the proportional gain of the PI controller, and the required phase margin. Based on the analytical expression of the phase margin and the crossover frequency of the control system, a systematic...

  19. Current error vector based prediction control of the section winding permanent magnet linear synchronous motor

    Energy Technology Data Exchange (ETDEWEB)

    Hong Junjie, E-mail: hongjjie@mail.sysu.edu.cn [School of Engineering, Sun Yat-Sen University, Guangzhou 510006 (China); Li Liyi, E-mail: liliyi@hit.edu.cn [Dept. Electrical Engineering, Harbin Institute of Technology, Harbin 150000 (China); Zong Zhijian; Liu Zhongtu [School of Engineering, Sun Yat-Sen University, Guangzhou 510006 (China)

    2011-10-15

    Highlights: {yields} The structure of the permanent magnet linear synchronous motor (SW-PMLSM) is new. {yields} A new current control method CEVPC is employed in this motor. {yields} The sectional power supply method is different to the others and effective. {yields} The performance gets worse with voltage and current limitations. - Abstract: To include features such as greater thrust density, higher efficiency without reducing the thrust stability, this paper proposes a section winding permanent magnet linear synchronous motor (SW-PMLSM), whose iron core is continuous, whereas winding is divided. The discrete system model of the motor is derived. With the definition of the current error vector and selection of the value function, the theory of the current error vector based prediction control (CEVPC) for the motor currents is explained clearly. According to the winding section feature, the motion region of the mover is divided into five zones, in which the implementation of the current predictive control method is proposed. Finally, the experimental platform is constructed and experiments are carried out. The results show: the current control effect has good dynamic response, and the thrust on the mover remains constant basically.

  20. High performance predictive current control of a three phase VSI: An experimental assessment

    Indian Academy of Sciences (India)

    Vikas Kumar; Prerna Gaur; A P Mittal

    2014-12-01

    Delay has a significant role to play in the implementation of the predictive current control scheme as large amount of calculations are involved. Compensating delay in the predictive current controller design can lead to an improved load current total harmonic distortion (THD) and also an increased switching frequency. Minimization of switching frequency while maintaining the lower value of load current THD requires multiple objective optimization which is achieved by optimizing a single objective function, constructed using weighting factors as a linear combination of individual objective function. The effect of weighting factor on the switching frequency minimization and the current tracking error with delay compensation for the two level voltage source inverter (VSI) are investigated in this paper. The outcomes of the predictive current control using an optimized weighting factor which is calculated using branch and bound algorithm with the delay compensation are compared with the PWM based current control scheme. The experimental tests are conducted on a 2.2 kW VSI to verify the simulation observations.

  1. Plasma Shape and Current Density Profile Control in Advanced Tokamak Operating Scenarios

    Science.gov (United States)

    Shi, Wenyu

    The need for new sources of energy is expected to become a critical problem within the next few decades. Nuclear fusion has sufficient energy density to potentially supply the world population with its increasing energy demands. The tokamak is a magnetic confinement device used to achieve controlled fusion reactions. Experimental fusion technology has now reached a level where tokamaks are able to produce about as much energy as is expended in heating the fusion fuel. The next step towards the realization of a nuclear fusion tokamak power plant is ITER, which will be capable of exploring advanced tokamak (AT) modes, characterized by a high fusion gain and plasma stability. The extreme requirements of the advanced modes motivates researchers to improve the modeling of the plasma response as well as the design of feedback controllers. This dissertation focuses on several magnetic and kinetic control problems, including the plasma current, position and shape control, and data-driven and first-principles-driven modeling and control of plasma current density profile and the normalized plasma pressure ratio betaN. The plasma is confined within the vacuum vessel by an external electromagnetic field, produced primarily by toroidal and poloidal field coils. The outermost closed plasma surface or plasma boundary is referred to as the shape of the plasma. A central characteristic of AT plasma regimes is an extreme elongated shape. The equilibrium among the electromagnetic forces acting on an elongated plasma is unstable. Moreover, the tokamak performance is improved if the plasma is located in close proximity to the torus wall, which guarantees an efficient use of available volume. As a consequence, feedback control of the plasma position and shape is necessary. In this dissertation, an Hinfinity-based, multi-input-multi-output (MIMO) controller for the National Spherical Torus Experiment (NSTX) is developed, which is used to control the plasma position, shape, and X

  2. Start Up Current Control of Buck-Boost Convertor-Fed Serial DC Motor

    Directory of Open Access Journals (Sweden)

    Yusuf SÖNMEZ

    2009-02-01

    Full Text Available Generally, DC motors are given preference for industrial applications such as electric locomotives, cranes, goods lifts. Because of they have high starting moment; they initially start with high current. This high start-up current must be decreased since it may damage windings of the motor and increases power consumption. It could be controlled by an appropriate driver system and controller. The nature of fuzzy logic control has adaptive characteristics that can achieve robust response to a system with uncertainty, parameter variation, and load disturbance. In this paper, fuzzy logic based control of start-up current of a Buck-Boost Converter fed serial DC motor is examined through computer simulation. In order to see the advantages of fuzzy logic control, classical PI control has applied to the same motor, under same circumstances and has been compared. C++ Builder software has been used for the simulation. According to the simulation results, plainly, fuzzy logic control has stronger responses than classical PI control and uses lower current at starting moment.

  3. Towards Current Profile Control in ITER: Potential Approaches and Research Needs

    Science.gov (United States)

    Schuster, E.; Barton, J. E.; Wehner, W. P.

    2014-10-01

    Many challenging plasma control problems still need to be addressed in order for the ITER Plasma Control System (PCS) to be able to successfully achieve the ITER project goals. For instance, setting up a suitable toroidal current density profile is key for one possible advanced scenario characterized by noninductive sustainment of the plasma current and steady-state operation. The nonlinearity and high dimensionality exhibited by the plasma demand a model-based current-profile control synthesis procedure that can accommodate this complexity through embedding the known physics within the design. The development of a model capturing the dynamics of the plasma relevant for control design enables not only the design of feedback controllers for regulation or tracking but also the design of optimal feedforward controllers for a systematic model-based approach to scenario planning, the design of state estimators for a reliable real-time reconstruction of the plasma internal profiles based on limited and noisy diagnostics, and the development of a fast predictive simulation code for closed-loop performance evaluation before implementation. Progress towards control-oriented modeling of the current profile evolution and associated control design has been reported following both data-driven and first-principles-driven approaches. An overview of these two approaches will be provided, as well as a discussion on research needs associated with each one of the model applications described above. Supported by the US Department of Energy under DE-SC0001334 and DE-SC0010661.

  4. Active and reactive power control of a current-source PWM-rectifier using space vectors

    Energy Technology Data Exchange (ETDEWEB)

    Salo, M.; Tuusa, H. [Tampere University of Technology (Finland). Department of Electrical Engineering, Power Electronics

    1997-12-31

    In this paper the current-source PWM-rectifier with active and reactive power control is presented. The control system is realized using space vector methods. Also, compensation of the reactive power drawn by the line filter is discussed. Some simulation results are shown. (orig.) 8 refs.

  5. Prevention of the disrupted enamel phenotype in Slc4a4-null mice using explant organ culture maintained in a living host kidney capsule.

    Directory of Open Access Journals (Sweden)

    Xin Wen

    Full Text Available Slc4a4-null mice are a model of proximal renal tubular acidosis (pRTA. Slc4a4 encodes the electrogenic sodium base transporter NBCe1 that is involved in transcellular base transport and pH regulation during amelogenesis. Patients with mutations in the SLC4A4 gene and Slc4a4-null mice present with dysplastic enamel, amongst other pathologies. Loss of NBCe1 function leads to local abnormalities in enamel matrix pH regulation. Loss of NBCe1 function also results in systemic acidemic blood pH. Whether local changes in enamel pH and/or a decrease in systemic pH are the cause of the abnormal enamel phenotype is currently unknown. In the present study we addressed this question by explanting fetal wild-type and Slc4a4-null mandibles into healthy host kidney capsules to study enamel formation in the absence of systemic acidemia. Mandibular E11.5 explants from NBCe1-/- mice, maintained in host kidney capsules for 70 days, resulted in teeth with enamel and dentin with morphological and mineralization properties similar to cultured NBCe1+/+ mandibles grown under identical conditions. Ameloblasts express a number of proteins involved in dynamic changes in H+/base transport during amelogenesis. Despite the capacity of ameloblasts to dynamically modulate the local pH of the enamel matrix, at least in the NBCe1-/- mice, the systemic pH also appears to contribute to the enamel phenotype. Extrapolating these data to humans, our findings suggest that in patients with NBCe1 mutations, correction of the systemic metabolic acidosis at a sufficiently early time point may lead to amelioration of enamel abnormalities.

  6. LVRT SCHEME OF WIND ENERGY SYSTEM USING PERMANENT MAGNET SYNCHRONOUS GENERATOR AND HYSTERESIS CURRENT CONTROLLER

    Directory of Open Access Journals (Sweden)

    E.RAJENDRAN

    2013-04-01

    Full Text Available In this research paper provided the information about low-voltage ride-through (LVRT scheme for the permanent magnet synchronous generator (PMSG, and wind energy conversion system. The dc-link voltage is uncomfortable by the generator side converter instead of the grid-side converter (GSC. Considering the nonlinear correlation between the generator speed (ωm and the dc-link voltage (Vdc, a dc-link Voltage controller is anticipated using a hysteresis current controller. Among all, low-voltage ride-through has been fundamental in the field, which is one of the most important challenges for wind energy conversion system. It is essential to design an included controller to protect the converter from overvoltage/overcurrent and to support the grid voltage during faults and recoveries. A unified dc-link voltage control scheme and hysteresis current controller based wind energy conversion system is proposed. The controllers for grid-side converters are coordinated to provide fault ride-through capability. The generator side is forced by space vector modulationand grid side implemented hysteresis current controller. The Grid Side Controller controls the grid active power and maximum power deliver to the grid. The ability of this control algorithm has been confirmed by simulation results.

  7. Negative sequence current control in wind power plants with VSC-HVDC connection

    DEFF Research Database (Denmark)

    Chaudhary, Sanjay; Teodorescu, Remus; Rodriguez, Pedro;

    2012-01-01

    Large offshore wind power plants may have multi-MW wind turbine generators (WTG) equipped with full-scale converters (FSC) and voltage source converter (VSC) based high voltaage direct-current (HVDC) transmission for grid connection. The power electronic converters in theWTG-FSC and the VSC-HVDC...... allow fast current control in the offshore grid. This paper presents a method of controlling the negative sequence current injection into the offshore grid from the VSC-HVDC as well as WTG-FSCs. This would minimize the power oscillations and hence reduce the dc voltage overshoots in the VSC-HVDC system...... sequence current control mitigates the power oscillations and therefore limits the dc voltage excursions in the VSC-HVDC system during the asymmetric faults....

  8. Study on Catastrophic Air Current Early-warning and Control System of Coalmines

    Directory of Open Access Journals (Sweden)

    L.F. Fang

    2016-02-01

    Full Text Available Catastrophic air current significantly influences the stability of ventilation system, and existing studies have not considered the flow characteristics of catastrophic air current when designing the control systems. To analyze the effects of different kinds of coalmine accidents on safety production, grey relation entropy theory was used to analyze the hazard assessment of coalmine accidents. Fluent software was employed to study the flow characteristics of catastrophic air current, and the catastrophic air current early-warning and control system of coalmine was researched according to the theoretical analysis and numerical simulation. The threat of fire accidents and roof accidents were larger than other accidents. The influence of temperature and CO volume fraction distribution of fire accidents to the tailwind side was larger than that of the weather side, and gradient decreased on the weather side. This system can effectively control the spread of fire and poisonous gas,

  9. Bending strain engineering in quantum spin hall system for controlling spin currents

    Science.gov (United States)

    Huang, Bing; Jin, Kyung-Hwan; Cui, Bin; Zhai, Feng; Mei, Jiawei; Liu, Feng

    2017-06-01

    Quantum spin Hall system can exhibit exotic spin transport phenomena, mediated by its topological edge states. Here the concept of bending strain engineering to tune the spin transport properties of a quantum spin Hall system is demonstrated. We show that bending strain can be used to control the spin orientation of counter-propagating edge states of a quantum spin system to generate a non-zero spin current. This physics mechanism can be applied to effectively tune the spin current and pure spin current decoupled from charge current in a quantum spin Hall system by control of its bending curvature. Furthermore, the curved quantum spin Hall system can be achieved by the concept of topological nanomechanical architecture in a controllable way, as demonstrated by the material example of Bi/Cl/Si(111) nanofilm. This concept of bending strain engineering of spins via topological nanomechanical architecture affords a promising route towards the realization of topological nano-mechanospintronics.

  10. Model of control of glow discharge electron gun current for microelectronics production applications

    Science.gov (United States)

    Denbnovetsky, S. V.; Melnyk, V. I.; Melnyk, I. V.; Tugay, B. A.

    2003-04-01

    The problems of simulation of discharge current control and its gas-dynamic stabilization for technological glow discharge electron guns with a cold cathode are considered in a paper. Such guns are successfully operated in soft vacuum and can be used in modern microelectronic technologies for providing of thermal operations with using different technological gases including active ones. The results of theoretical and experimental investigation of automatic control system of current of electron gun which were used for deposition of coatings in reactive gas medium are presented in article. Time of regulation for considered system did not exceed 400 ms. Is proved, that the automatic control of a current of a glow discharge electron gun by pressure variation its volume is effective on all operation range of pressure, and the minimum time of a current regulation can be tens -- hundred of ms, and this fact is allow to use in the majority of technological operations for microelectronic production.

  11. Rotor Current Control of DFIG for Improving Fault Ride - Through Using a Novel Sliding Mode Control Approach

    Science.gov (United States)

    Cai, Guowei; Liu, Cheng; Yang, Deyou

    2013-11-01

    The doubly fed induction generators (DFIG) have been recognized as the dominant technology used in wind power generation systems with the rapid development of wind power. However, continuous operation of DFIG may cause a serious wind turbine generators tripping accident, due to destructive over-current in the rotor winding which is caused by the power system fault or inefficient fault ride-through (FRT) strategy. A new rotor current control scheme in the rotor-side converter (RSC) ispresented to enhance FRT capacities of grid-connected DFIG. Due to the strongly nonlinear nature of DFIG and insensitive to DFIG parameter's variations, a novel sliding mode controller was designed. The controller combines extended state observer (ESO) with sliding model variable structure control theory. The simulation is carried out to verify the effectiveness of the proposed control approach under various types of grid disturbances. It is shown that the proposed controller provides enhanced transient features than the classic proportional-integral control. The proposed control method can effectively reduce over-current in the RSC, and the transient pulse value of electromagnetic torque is too large under power grid fault.

  12. A Versatile Control Scheme For Dynamic Voltage Restorer To Limit Downstream Fault Currents

    Directory of Open Access Journals (Sweden)

    A.Nagendra

    2014-12-01

    Full Text Available The Dynamic Voltage Restorer (DVR is a custom power device utilized to counteract voltage sags. It injects controlled three-phase ac voltages in series with the supply voltage, subsequent to voltage sag, to enhance voltage quality by adjusting the voltage magnitude, wave shape, and phase angle. The DVR is conventionally bypassed during a downstream fault to prevent potential adverse impacts on the fault and to protect the DVR components against the fault current. This paper proposes an augmented control strategy for the DVR that provides:1 voltage-sag compensation under balanced and unbalanced conditions and 2 a fault current interruption (FCI function. This paper introduces and evaluates an auxiliary control strategy for downstream fault current interruption in a radial distribution line by means of a dynamic voltage restorer (DVR. The proposed controller supplements the voltage-sag compensation control of the DVR. It does not require phaselocked loop and independently controls the magnitude and phase angle of the injected voltage for each phase. Fast least error squares digital filters are used to estimate the magnitude and phase of the measured voltages and effectively reduce the impacts of noise, harmonics, and disturbances on the estimated phasor parameters, and this enables effective fault current interrupting even under arcing fault conditions. The performance of the DVR for fault current interruption is analyzed by using MATLAB/SIMULINK software.

  13. Thoracic radiotherapy and breath control: current prospects; Radiotherapie thoracique et controle de la respiration: perspectives actuelles

    Energy Technology Data Exchange (ETDEWEB)

    Reboul, F.; Mineur, L.; Paoli, J.B.; Bodez, V.; Oozeer, R.; Garcia, R. [Institut Sainte-Catherine, 84 - Avignon (France)

    2002-11-01

    Three-dimensional conformal radiotherapy (3D CRT) is adversely affected by setup error and organ motion. In thoracic 3D CRT, breathing accounts for most of intra-fraction movements, thus impairing treatment quality. Breath control clearly exhibits dosimetric improvement compared to free breathing, leading to various techniques for gated treatments. We review benefits of different breath control methods -i.e. breath-holding or beam gating, with spirometric, isometric or X-ray respiration sensor- and argument the choice of expiration versus inspiration, with consideration to dosimetric concerns. All steps of 3D-CRT can be improved with breath control. Contouring of organs at risk (OAR) and target are easier and more accurate on breath controlled CT-scans. Inter- and intra-fraction target immobilisation allows smaller margins with better coverage. Lung outcome predictors (NTCP, Mean Dose, LV20, LV30) are improved with breath-control. In addition, inspiration breath control facilitates beam arrangement since it widens the distance between OAR and target, and leaves less lung normal tissue within the high dose region. Last, lung density, as of CT scan, is more accurate, improving dosimetry. Our institutions choice is to use spirometry driven, patient controlled high-inspiration breath-hold; this technique gives excellent immobilization results, with high reproducibility, yet it is easy to implement and costs little extra treatment time. Breath control, whatever technique is employed, proves superior to free breathing treatment when using 3D-CRT. Breath control should then be used whenever possible, and is probably mandatory for IMRT. (authors)

  14. Current control for a shunt hybrid active power filter using recursive integral PI

    Institute of Scientific and Technical Information of China (English)

    Wei ZHAO; An LUO; Ke PENG; Xia DENG

    2009-01-01

    This paper presents a current control method for a shunt hybrid active power filter(HAPF) using recursive integral Pl algorithm.The method improves the performance of the HAPF system by reducing the influence of detection accuracy,time delay of instruction current calculation and phase displacement of output filter.Fuzzy logic based set-point weighing algorithm is combined in the control scheme to enhance its robustness and anti-interference ability.The proposed algorithm is easy to implement for engineering applications and easy to compute.Experiment results have verified the validity of the proposed controller.Furthermore,the proposed recursive integral PI algorithm can also be applied in the control of periodic current as in AC drivers.

  15. High Performance Current Controller for Selective Harmonic Compensation in Active Power Filters

    DEFF Research Database (Denmark)

    Lascu, Cristian; Asiminoaei, Lucian; Boldea, I.;

    2007-01-01

    computational effort. The proposed controller design is based on the pole-zero cancellation technique, taking into account the load transfer function at each harmonic frequency. Two design methods are provided, which give controller transfer functions with superior frequency response. The complete current...... controller is realized as the superposition of all individual harmonic controllers. The frequency response of the entire closed loop control is optimal with respect to filtering objectives, i.e., the system provides good overall stability and excellent selectivity for interesting harmonics. This conclusion...

  16. Beam dumps, stoppers and Faraday cups at the SLC

    Energy Technology Data Exchange (ETDEWEB)

    Walz, D.R.; McFarlane, A.; Lewandowski, E.

    1989-04-01

    This presentation features most of the beam dumps and stoppers necessary to absorb and dissipate SLC e/sup +-/ beams with transverse sizes from several tens to a few hundred microns (..mu..m). Solutions are based on electromagnetic cascade shower calculations for N = 5 /times/ 10/sup 10/ e/bunch and momenta ranging from 1.2 GeV/c in the damping ring transport systems to 50 GeV/c in the arcs matching sections and the Final Focus region. 3 refs., 2 figs.

  17. Chromatic correction in the SLC bunch length compressors

    Energy Technology Data Exchange (ETDEWEB)

    Adolphsen, C.E.; Emma, P.J.; Fieguth, T.H.; Spence, W.L.

    1991-06-01

    The SLC Ring to Linac (RTL) transport lines employ intense bending and strong transverse focusing to produce the momentum compaction needed for bunch length compression prior to S-band acceleration. In the presence of the large rf induced energy spread needed for compression the consequent chromatic effects -- viz. the variation with energy of residual output dispersion and of the RTL transfer matrix, threaten to destroy the small emittances produced by the damping rings. We report on the tuning methods that have been developed and used to implement the sextupole based chromatic correction scheme. 6 refs., 4 figs.

  18. Evolutionary analysis of Slc11 mechanism of proton-coupled metal-ion transmembrane import

    Directory of Open Access Journals (Sweden)

    Mathieu F. M. Cellier

    2016-06-01

    Full Text Available Determination of the crystal structure of ScaDMT, a member of the Slc11 family, provided opportunity to advance understanding of proton-dependent metal-ion uptake by interfacing Slc11 molecular evolution and structural biology. Slc11 carriers belong to the ancient and broadly distributed APC superfamily characterized by the pseudo-symmetric LeuT-fold. This fold comprises two topologically inverted repeats (protomers that exchange alternate configurations during carrier cycling. Examining ScaDMT molecule inserted within a model membrane allowed to pinpoint residues that may interact with surrounding lipid solvent molecules. Three-dimensional mapping of Slc11-specific sites demonstrated they distribute at the protomer interface, along the transmembrane ion-conduction pathway. Functional sites were predicted by modeling hypothetical ScaDMT alternate conformers based on APC templates; these candidate homologous sites were found to co-localize with Slc11-specific sites, a distribution pattern that fits the functional diversity in the APC superfamily. Sites that diverged among eukaryotic Slc11 (Nramp types were located in transmembrane helices that may participate in discrete steps during co-substrate translocation, suggesting these sites influence transport activity. Adding some functional dimension to Slc11 carrier evolution will inform molecular understanding of metal-ion transport selectivity and regulation, Slc11 physiological roles and contribution to host resistance to microbial infection.

  19. Age-related expression profile of the SLC27A1 gene in chicken tissues.

    Science.gov (United States)

    Wang, Yan; Zhu, Qing; Zhao, Xiao-Ling; Yao, Yong-Gang; Liu, Yi-Ping

    2011-11-01

    The solute carrier family 27 (SLC27, also known as fatty acid transport proteins [FATPs]) plays important biological roles in cells. However, there is no report about the expression profile of SLC27 member in chicken. In this study, we quantified the expression of SLC27A1 (FATP1) mRNA in a mountainous black-boned chicken breed (MB) and a commercial meat type chicken breed (S01), to discern the tissue and age-related specific expression pattern and their potential involvement in fat deposition and muscle fatty acid metabolism. Real-time quantitative PCR assays were developed for accurate measurement of SLC27A1 mRNA levels in different tissues from chicken with different ages (0-12 weeks). Expression of SLC27A1 mRNA was detected in all tissues examined. There was a significantly age-related change of the SLC27A1 mRNAs in heart, breast muscle (BMW), leg muscle (LMW), liver, and abdominal fat (AF) tissues (P chicken had a higher expression of the SLC27A1 mRNA in breast muscle, subcutaneous fat, and heart tissues than the MB chicken. Our results showed that the expression of SLC27A1 mRNA in chicken tissues exhibits specific developmental changes and age-related patterns.

  20. Type 2 Diabetes Variants Disrupt Function of SLC16A11 through Two Distinct Mechanisms.

    Science.gov (United States)

    Rusu, Victor; Hoch, Eitan; Mercader, Josep M; Tenen, Danielle E; Gymrek, Melissa; Hartigan, Christina R; DeRan, Michael; von Grotthuss, Marcin; Fontanillas, Pierre; Spooner, Alexandra; Guzman, Gaelen; Deik, Amy A; Pierce, Kerry A; Dennis, Courtney; Clish, Clary B; Carr, Steven A; Wagner, Bridget K; Schenone, Monica; Ng, Maggie C Y; Chen, Brian H; Centeno-Cruz, Federico; Zerrweck, Carlos; Orozco, Lorena; Altshuler, David M; Schreiber, Stuart L; Florez, Jose C; Jacobs, Suzanne B R; Lander, Eric S

    2017-06-29

    Type 2 diabetes (T2D) affects Latinos at twice the rate seen in populations of European descent. We recently identified a risk haplotype spanning SLC16A11 that explains ∼20% of the increased T2D prevalence in Mexico. Here, through genetic fine-mapping, we define a set of tightly linked variants likely to contain the causal allele(s). We show that variants on the T2D-associated haplotype have two distinct effects: (1) decreasing SLC16A11 expression in liver and (2) disrupting a key interaction with basigin, thereby reducing cell-surface localization. Both independent mechanisms reduce SLC16A11 function and suggest SLC16A11 is the causal gene at this locus. To gain insight into how SLC16A11 disruption impacts T2D risk, we demonstrate that SLC16A11 is a proton-coupled monocarboxylate transporter and that genetic perturbation of SLC16A11 induces changes in fatty acid and lipid metabolism that are associated with increased T2D risk. Our findings suggest that increasing SLC16A11 function could be therapeutically beneficial for T2D. VIDEO ABSTRACT. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. Interactions between zinc transporter-8 gene (SLC30A8) and plasma zinc concentrations for impaired glucose regulation and type 2 diabetes.

    Science.gov (United States)

    Shan, Zhilei; Bao, Wei; Zhang, Yan; Rong, Ying; Wang, Xia; Jin, Yilin; Song, Yadong; Yao, Ping; Sun, Changhao; Hu, Frank B; Liu, Liegang

    2014-05-01

    Although both SLC30A8 rs13266634 single nucleotide polymorphism and plasma zinc concentrations have been associated with impaired glucose regulation (IGR) and type 2 diabetes (T2D), their interactions for IGR and T2D remain unclear. Therefore, to assess zinc-SLC30A8 interactions, we performed a case-control study in 1,796 participants: 218 newly diagnosed IGR patients, 785 newly diagnosed T2D patients, and 793 individuals with normal glucose tolerance. After adjustment for age, sex, BMI, family history of diabetes, and hypertension, the multivariable odds ratio (OR) of T2D associated with a 10 µg/dL higher plasma zinc level was 0.87 (95% CI 0.85-0.90). Meanwhile, the OR of SLC30A8 rs13266634 homozygous genotypes CC compared with TT was 1.53 (1.11-2.09) for T2D. Similar associations were found in IGR and IGR&T2D groups. Each 10 µg/dL increment of plasma zinc was associated with 22% (OR 0.78 [0.72-0.85]) lower odds of T2D in TT genotype carriers, 17% (0.83 [0.80-0.87]) lower odds in CT genotype carriers, and 7% (0.93 [0.90-0.97]) lower odds in CC genotype carriers (P for interaction = 0.01). Our study suggested that the C allele of rs13266634 was associated with higher odds of T2D, and higher plasma zinc was associated with lower odds. The inverse association of plasma zinc concentrations with T2D was modified by SLC30A8 rs13266634. Further studies are warranted to confirm our findings and clarify the mechanisms underlying the interaction between plasma zinc and the SLC30A8 gene in relation to T2D.

  2. Bat algorithm optimized fuzzy PD based speed controller for brushless direct current motor

    Directory of Open Access Journals (Sweden)

    K. Premkumar

    2016-06-01

    Full Text Available In this paper, design of fuzzy proportional derivative controller and fuzzy proportional derivative integral controller for speed control of brushless direct current drive has been presented. Optimization of the above controllers design is carried out using nature inspired optimization algorithms such as particle swarm, cuckoo search, and bat algorithms. Time domain specifications such as overshoot, undershoot, settling time, recovery time, and steady state error and performance indices such as root mean squared error, integral of absolute error, integral of time multiplied absolute error and integral of squared error are measured and compared for the above controllers under different operating conditions such as varying set speed and load disturbance conditions. The precise investigation through simulation is performed using simulink toolbox. From the simulation test results, it is evident that bat optimized fuzzy proportional derivative controller has superior performance than the other controllers considered. Experimental test results have also been taken and analyzed for the optimal controller identified through simulation.

  3. AVPR1a and SLC6A4 gene polymorphisms are associated with creative dance performance.

    Directory of Open Access Journals (Sweden)

    Rachel Bachner-Melman

    2005-09-01

    Full Text Available Dancing, which is integrally related to music, likely has its origins close to the birth of Homo sapiens, and throughout our history, dancing has been universally practiced in all societies. We hypothesized that there are differences among individuals in aptitude, propensity, and need for dancing that may partially be based on differences in common genetic polymorphisms. Identifying such differences may lead to an understanding of the neurobiological basis of one of mankind's most universal and appealing behavioral traits--dancing. In the current study, 85 current performing dancers and their parents were genotyped for the serotonin transporter (SLC6A4: promoter region HTTLPR and intron 2 VNTR and the arginine vasopressin receptor 1a (AVPR1a: promoter microsatellites RS1 and RS3. We also genotyped 91 competitive athletes and a group of nondancers/nonathletes (n = 872 subjects from 414 families. Dancers scored higher on the Tellegen Absorption Scale, a questionnaire that correlates positively with spirituality and altered states of consciousness, as well as the Reward Dependence factor in Cloninger's Tridimensional Personality Questionnaire, a measure of need for social contact and openness to communication. Highly significant differences in AVPR1a haplotype frequencies (RS1 and RS3, especially when conditional on both SLC6A4 polymorphisms (HTTLPR and VNTR, were observed between dancers and athletes using the UNPHASED program package (Cocaphase: likelihood ratio test [LRS] = 89.23, p = 0.000044. Similar results were obtained when dancers were compared to nondancers/nonathletes (Cocaphase: LRS = 92.76, p = 0.000024. These results were confirmed using a robust family-based test (Tdtphase: LRS = 46.64, p = 0.010. Association was also observed between Tellegen Absorption Scale scores and AVPR1a (Qtdtphase: global chi-square = 26.53, p = 0.047, SLC6A4 haplotypes (Qtdtphase: chi-square = 2.363, p = 0.018, and AVPR1a conditional on SCL6A4 (Tdtphase: LRS

  4. AVPR1a and SLC6A4 Gene Polymorphisms Are Associated with Creative Dance Performance.

    Directory of Open Access Journals (Sweden)

    2005-09-01

    Full Text Available Dancing, which is integrally related to music, likely has its origins close to the birth of Homo sapiens, and throughout our history, dancing has been universally practiced in all societies. We hypothesized that there are differences among individuals in aptitude, propensity, and need for dancing that may partially be based on differences in common genetic polymorphisms. Identifying such differences may lead to an understanding of the neurobiological basis of one of mankind's most universal and appealing behavioral traits-dancing. In the current study, 85 current performing dancers and their parents were genotyped for the serotonin transporter (SLC6A4: promoter region HTTLPR and intron 2 VNTR and the arginine vasopressin receptor 1a (AVPR1a: promoter microsatellites RS1 and RS3. We also genotyped 91 competitive athletes and a group of nondancers/nonathletes (n = 872 subjects from 414 families. Dancers scored higher on the Tellegen Absorption Scale, a questionnaire that correlates positively with spirituality and altered states of consciousness, as well as the Reward Dependence factor in Cloninger's Tridimensional Personality Questionnaire, a measure of need for social contact and openness to communication. Highly significant differences in AVPR1a haplotype frequencies (RS1 and RS3, especially when conditional on both SLC6A4 polymorphisms (HTTLPR and VNTR, were observed between dancers and athletes using the UNPHASED program package (Cocaphase: likelihood ratio test [LRS] = 89.23, p = 0.000044. Similar results were obtained when dancers were compared to nondancers/nonathletes (Cocaphase: LRS = 92.76, p = 0.000024. These results were confirmed using a robust family-based test (Tdtphase: LRS = 46.64, p = 0.010. Association was also observed between Tellegen Absorption Scale scores and AVPR1a (Qtdtphase: global chi-square = 26.53, p = 0.047, SLC6A4 haplotypes (Qtdtphase: chi-square = 2.363, p = 0.018, and AVPR1a conditional on SCL6A4 (Tdtphase: LRS

  5. AVPR1a and SLC6A4 gene polymorphisms are associated with creative dance performance.

    Science.gov (United States)

    Bachner-Melman, Rachel; Dina, Christian; Zohar, Ada H; Constantini, Naama; Lerer, Elad; Hoch, Sarah; Sella, Sarah; Nemanov, Lubov; Gritsenko, Inga; Lichtenberg, Pesach; Granot, Roni; Ebstein, Richard P

    2005-09-01

    Dancing, which is integrally related to music, likely has its origins close to the birth of Homo sapiens, and throughout our history, dancing has been universally practiced in all societies. We hypothesized that there are differences among individuals in aptitude, propensity, and need for dancing that may partially be based on differences in common genetic polymorphisms. Identifying such differences may lead to an understanding of the neurobiological basis of one of mankind's most universal and appealing behavioral traits--dancing. In the current study, 85 current performing dancers and their parents were genotyped for the serotonin transporter (SLC6A4: promoter region HTTLPR and intron 2 VNTR) and the arginine vasopressin receptor 1a (AVPR1a: promoter microsatellites RS1 and RS3). We also genotyped 91 competitive athletes and a group of nondancers/nonathletes (n = 872 subjects from 414 families). Dancers scored higher on the Tellegen Absorption Scale, a questionnaire that correlates positively with spirituality and altered states of consciousness, as well as the Reward Dependence factor in Cloninger's Tridimensional Personality Questionnaire, a measure of need for social contact and openness to communication. Highly significant differences in AVPR1a haplotype frequencies (RS1 and RS3), especially when conditional on both SLC6A4 polymorphisms (HTTLPR and VNTR), were observed between dancers and athletes using the UNPHASED program package (Cocaphase: likelihood ratio test [LRS] = 89.23, p = 0.000044). Similar results were obtained when dancers were compared to nondancers/nonathletes (Cocaphase: LRS = 92.76, p = 0.000024). These results were confirmed using a robust family-based test (Tdtphase: LRS = 46.64, p = 0.010). Association was also observed between Tellegen Absorption Scale scores and AVPR1a (Qtdtphase: global chi-square = 26.53, p = 0.047), SLC6A4 haplotypes (Qtdtphase: chi-square = 2.363, p = 0.018), and AVPR1a conditional on SCL6A4 (Tdtphase: LRS = 250

  6. SOME CONSIDERATIONS OVER THE INTERNAL CONTROL IN THE CONTEXT OF CURRENT ACCOUNTANCY REGULATIONS

    Directory of Open Access Journals (Sweden)

    Lenghel Dorin Radu

    2012-12-01

    Full Text Available Through the hereby study we set ourselves on an analysis over the internal control and the ways of implementation of it. The final purpose of our research is represented by the characteristics of the internal control system in the context of current accountancy regulations. The accomplishment of such goal has forced us to research the current literature in the area and also the legal regulations over internal control. Of course, the accomplishment of such a research was possible only after a pertinent analysis over the opinions expressed in specialty literature regarding this area. Our research wants to be with a theoretical and applicative character. It is based on analysing the internal control system, the methodology of internal control and the steps of internal control. We express our belief that the implementation of the internal control in a very exact manner comes as an aid to the company management and lead to the accomplishment of managerial objectives and policies. In what it regards the result of our research there can be drawn the following conclusions: from the legal regulations (OMFP nr. 3055/2009, there is no clear conclusion over the procedures and policies of implementation of internal control applicable to an economical entity; also there are not presented in a detailed way the types (forms of internal control, being presented in the legal regulations only a classification of them after the time in which they are exercised (before, during or after the finishing of the operations; also in the legal regulations there is developed a certain way of internal control, represented by the financial and accounting internal control, as if the other forms of internal control do not exist; in what regards the components of internal control, these are presented in another way, but similar to already known models of internal control (Coso and Coco; also in the legal regulations there are presented the general objectives of internal control

  7. SLC1 and SLC4 encode partially redundant acyl-coenzyme A 1-acylglycerol-3-phosphate O-acyltransferases of budding yeast

    DEFF Research Database (Denmark)

    Benghezal, Mohammed; Roubaty, Carole; Veepuri, Vijayanath

    2007-01-01

    Phosphatidic acid is the intermediate, from which all glycerophospholipids are synthesized. In yeast, it is generated from lysophosphatidic acid, which is acylated by Slc1p, an sn-2-specific, acyl-coenzyme A-dependent 1-acylglycerol-3-phosphate O-acyltransferase. Deletion of SLC1 is not lethal an......-phosphate O-acyltransferases but also be involved in fatty acid exchange at the sn-2-position of mature glycerophospholipids....

  8. Recessive mutations in SLC38A8 cause foveal hypoplasia and optic nerve misrouting without albinism.

    Science.gov (United States)

    Poulter, James A; Al-Araimi, Musallam; Conte, Ivan; van Genderen, Maria M; Sheridan, Eamonn; Carr, Ian M; Parry, David A; Shires, Mike; Carrella, Sabrina; Bradbury, John; Khan, Kamron; Lakeman, Phillis; Sergouniotis, Panagiotis I; Webster, Andrew R; Moore, Anthony T; Pal, Bishwanath; Mohamed, Moin D; Venkataramana, Anandula; Ramprasad, Vedam; Shetty, Rohit; Saktivel, Murugan; Kumaramanickavel, Govindasamy; Tan, Alex; Mackey, David A; Hewitt, Alex W; Banfi, Sandro; Ali, Manir; Inglehearn, Chris F; Toomes, Carmel

    2013-12-05

    Foveal hypoplasia and optic nerve misrouting are developmental defects of the visual pathway and only co-occur in connection with albinism; to date, they have only been associated with defects in the melanin-biosynthesis pathway. Here, we report that these defects can occur independently of albinism in people with recessive mutations in the putative glutamine transporter gene SLC38A8. Nine different mutations were identified in seven Asian and European families. Using morpholino-mediated ablation of Slc38a8 in medaka fish, we confirmed that pigmentation is unaffected by loss of SLC38A8. Furthermore, by undertaking an association study with SNPs at the SLC38A8 locus, we showed that common variants within this gene modestly affect foveal thickness in the general population. This study reveals a melanin-independent component underpinning the development of the visual pathway that requires a functional role for SLC38A8.

  9. Novel European SLC1A4 variant: infantile spasms and population ancestry analysis.

    Science.gov (United States)

    Conroy, Judith; Allen, Nicholas M; Gorman, Kathleen; O'Halloran, Eoghan; Shahwan, Amre; Lynch, Bryan; Lynch, Sally A; Ennis, Sean; King, Mary D

    2016-08-01

    SLC1A4 deficiency is a recently described neurodevelopmental disorder associated with microcephaly, global developmental delay, abnormal myelination, thin corpus callosum and seizures. It has been mainly reported in the Ashkenazi-Jewish population with affected individuals homozygous for the p.Glu256Lys variant. Exome sequencing performed in an Irish proband identified a novel homozygous nonsense SLC1A4 variant [p.Trp453*], confirming a second case of SLC1A4-associated infantile spasms. As this is the first European identified, population ancestry analysis of the Exome Aggregation Consortium database was performed to determine the wider ethnic background of SLC1A4 deficiency carriers. p.Glu256Lys was found in Hispanic and South Asian populations. Other potential disease-causing variants were also identified. Investigation for SLC1A4 deficiency should be performed regardless of ethnicity and extend to include unexplained early-onset epileptic encephalopathy.

  10. A PAC Based Current Feedforward Control for Three-Phase PWM Voltage-Type Converter

    Institute of Scientific and Technical Information of China (English)

    屈克庆; 陈国呈; 孙承波

    2004-01-01

    This paper presents a novel current feedforward control strategy for a three-phase pulse-width modulation (PWM) DC voltage-type converter based on phase and amplitude control (PAC). With right-angle triangle relation of phasors and principle of conservation of energy, a phasor adjustment method and the relevant low-frequency mathematical model of the system are analyzed in detail, both in rectification and regeneration modes for the converter, are discussed. For improving the traditional PAC dynamic performance, variable load current is detected indirectly by the change of the DC voltage, which is fed to the control system as an additional control variable to generate modulation index and phase angle. Also, the algorithm is derived and the system principle is introduced. Experimental results from a 3 kw laboratory device are included to demonstrate the effectiveness of the proposed control strategy.

  11. High-frequency, three-phase current controller implementation in an FPGA

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, M.; Round, S. D.; Kolar, J. W.

    2008-07-01

    Three phase rectifiers with switching frequencies of 500 kHz or more require high speed current controllers. At such high switching frequencies analog controllers as well as high speed digital signal processing (DSP) systems have limited performance. In this paper, two high speed current controller implementations using two different field-programmable gate arrays (FPGA) - one for switching frequencies up to 1 MHz and one for switching frequencies beyond 1 MHz - are presented to overcome this performance limitation. Starting with the digital system design all the blocks of the signal chain, containing analog-to-digital (A/D) interface, digital controller implementation using HW-multipliers and implementation of a novel high speed, high resolution pulse width modulation (PWM) are discussed and compared. Final measurements verify the performance of the controllers. (author)

  12. A NOVEL CONTROL STRATEGY FOR SINUSIODAL WAVE INVERTER WITH PI REGULATORS AND CAPACITOR CURRENT FEEDBACK

    Institute of Scientific and Technical Information of China (English)

    姜桂宾; 裴云庆; 王兆安

    2003-01-01

    Objective For the inverters used in UPS, it is important to maintain the pure sinusoidal AC output voltage waveform over all loading conditions and transients. Methods A novel sinusoidal output voltage control strategy is pregented in this paper. The output voltage is controlled by introducing filtering eapacitor current feedback. Two simple PI regulators are used for the current and voltage control loops. Results With the new control strategy, the inverter achieves very low output voltage distortion, good output voltage regulation and strong perturbation rejection, fast dynamic response, and good performance under nonlinear loads. The THD under capacitance rectifying load is better than 0.2%, the output voltage regulation within 0 to full load is less than 0.1%. The resting time under load transient is within 200μs. Conclusion The merits of the new control strategy include rapid response and good steady state stiffness.

  13. Controlling hollow relativistic electron beam orbits with an inductive current divider

    Energy Technology Data Exchange (ETDEWEB)

    Swanekamp, S. B.; Richardson, A. S.; Angus, J. R.; Cooperstein, G.; Hinshelwood, D. D.; Ottinger, P. F.; Rittersdorf, I. M.; Schumer, J. W.; Weber, B. V.; Zier, J. C. [Plasma Physics Division, Naval Research Laboratory, Washington, DC 20375 (United States)

    2015-02-15

    A passive method for controlling the trajectory of an intense, hollow electron beam is proposed using a vacuum structure that inductively splits the beam's return current. A central post carries a portion of the return current (I{sub 1}), while the outer conductor carries the remainder (I{sub 2}). An envelope equation appropriate for a hollow electron beam is derived and applied to the current divider. The force on the beam trajectory is shown to be proportional to (I{sub 2}-I{sub 1}), while the average force on the envelope (the beam width) is proportional to the beam current I{sub b} = (I{sub 2} + I{sub 1}). The values of I{sub 1} and I{sub 2} depend on the inductances in the return-current path geometries. Proper choice of the return-current geometries determines these inductances and offers control over the beam trajectory. Solutions using realistic beam parameters show that, for appropriate choices of the return-current-path geometry, the inductive current divider can produce a beam that is both pinched and straightened so that it approaches a target at near-normal incidence with a beam diameter that is on the order of a few mm.

  14. Model Predictive Control with Integral Action for Current Density Profile Tracking in NSTX-U

    Science.gov (United States)

    Ilhan, Z. O.; Wehner, W. P.; Schuster, E.; Boyer, M. D.

    2016-10-01

    Active control of the toroidal current density profile may play a critical role in non-inductively sustained long-pulse, high-beta scenarios in a spherical torus (ST) configuration, which is among the missions of the NSTX-U facility. In this work, a previously developed physics-based control-oriented model is embedded in a feedback control scheme based on a model predictive control (MPC) strategy to track a desired current density profile evolution specified indirectly by a desired rotational transform profile. An integrator is embedded into the standard MPC formulation to reject various modeling uncertainties and external disturbances. Neutral beam powers, electron density, and total plasma current are used as actuators. The proposed MPC strategy incorporates various state and actuator constraints directly into the control design process by solving a constrained optimization problem in real-time to determine the optimal actuator requests. The effectiveness of the proposed controller in regulating the current density profile in NSTX-U is demonstrated in closed-loop nonlinear simulations. Supported by the US DOE under DE-AC02-09CH11466.

  15. New Current Control Method of DC Power Supply for Magnetic Perturbation Coils on J-TEXT

    Institute of Scientific and Technical Information of China (English)

    ZENG Wubing; DING Yonghua; YI Bin; XU Hangyu; RAO Bo; ZHANG Ming; LIU Minghai

    2014-01-01

    In order to advance the research on suppressing tearing modes and driving plasma rotation,a DC power supply (PS) system has been developed for dynamic resonant magnetic perturbation (DRMP) coils and applied in the J-TEXT experiment.To enrich experimental phenomena in the J-TEXT tokamak,applying the circulating current four-quadrant operation mode in the DRMP DC PS system is proposed.By using the circulating current four-quadrant operation,DRMP coils can be smoothly controlled without the dead-time when the current polarity reverses.Essential circuit analysis,control optimization and simulation of desired scenarios have been performed for normal current.Relevant simulation and test results are also presented.

  16. Coherent control of injection currents in high-quality films of Bi2Se3

    CERN Document Server

    Bas, D A; Babakiray, S; Johnson, T A; Borisov, P; Stanescu, T D; Lederman, D; Bristow, A D

    2014-01-01

    Films of the topological insulator Bi2Se3 are grown by molecular beam epitaxy with in-situ reflection high-energy electron diffraction. The films are shown to be high-quality by X-ray reflectivity and diffraction and atomic-force microscopy. Quantum interference control of photocurrents is observed by excitation with harmonically related pulses and detected by terahertz radiation. The injection current obeys the expected excitation irradiance dependence, showing linear dependence on the fundamental pulse irradiance and square-root irradiance dependence of the frequency-doubled optical pulses. The injection current also follows a sinusoidal relative-phase dependence between the two excitation pulses. These results confirm the third-order nonlinear optical origins of the coherently controlled injection current. Experiments are compared to a tight-binding band structure to illustrate the possible optical transitions that occur in the creating the injection current.

  17. Indirect thermal control for improved reliability of Modular Multilevel Converter by utilizing circulating current

    DEFF Research Database (Denmark)

    Dowlatabadi, Mohammadkazem Bakhshizadeh; Ma, Ke; Loh, Poh Chiang;

    2015-01-01

    Modular Multilevel Converter (MMC) has recently become a popular multilevel topology for high-power applications, where the reliability performance is a crucial design consideration. In this paper the impacts of the circulating current in the MMC to the loss and thermal loading of power...... loading of the power devices, and by proper controlling the amount of circulating current, the temperature fluctuation or thermal cycling in the power device can be relieved, and thereby contributing to improved reliability performance according to many lifetime models/testing results for power devices....... semiconductor devices are comprehensively investigated. Also a novel control strategy by utilizing the circulating current is proposed to enhance the reliability performance of MMC in order to limit the amplitude of thermal cycles. It is concluded that the circulating current may change the losses and thermal...

  18. Ultrafast helicity control of surface currents in topological insulators with near-unity fidelity.

    Science.gov (United States)

    Kastl, Christoph; Karnetzky, Christoph; Karl, Helmut; Holleitner, Alexander W

    2015-03-26

    In recent years, a class of solid-state materials, called three-dimensional topological insulators, has emerged. In the bulk, a topological insulator behaves like an ordinary insulator with a band gap. At the surface, conducting gapless states exist showing remarkable properties such as helical Dirac dispersion and suppression of backscattering of spin-polarized charge carriers. The characterization and control of the surface states via transport experiments is often hindered by residual bulk contributions. Here we show that surface currents in Bi2Se3 can be controlled by circularly polarized light on a picosecond timescale with a fidelity near unity even at room temperature. We reveal the temporal separation of such ultrafast helicity-dependent surface currents from photo-induced thermoelectric and drift currents in the bulk. Our results uncover the functionality of ultrafast optoelectronic devices based on surface currents in topological insulators.

  19. Mitochondrial regulation of cell cycle progression through SLC25A43

    Energy Technology Data Exchange (ETDEWEB)

    Gabrielson, Marike; Reizer, Edwin [School of Health and Medical Sciences, Faculty of Medicine and Health, Örebro University, SE 70182 Örebro (Sweden); Stål, Olle [Department of Clinical and Experimental Medicine, Linköping University, SE 58185 Linköping (Sweden); Department of Oncology, Linköping University, SE 58185 Linköping (Sweden); Tina, Elisabet, E-mail: elisabet.tina@regionorebrolan.se [Department of Clinical Research Laboratory, Faculty of Medicine and Health, Örebro University, SE 70182 Örebro (Sweden)

    2016-01-22

    An increasing body of evidence is pointing towards mitochondrial regulation of the cell cycle. In a previous study of HER2-positive tumours we could demonstrate a common loss in the gene encoding for the mitochondrial transporter SLC25A43 and also a significant relation between SLC25A43 protein expression and S-phase fraction. Here, we investigated the consequence of suppressed SLC25A43 expression on cell cycle progression and proliferation in breast epithelial cells. In the present study, we suppressed SLC25A43 using siRNA in immortalised non-cancerous breast epithelial MCF10A cells and HER2-positive breast cancer cells BT-474. Viability, apoptosis, cell proliferation rate, cell cycle phase distribution, and nuclear Ki-67 and p21, were assessed by flow cytometry. Cell cycle related gene expressions were analysed using real-time PCR. We found that SLC25A43 knockdown in MCF10A cells significantly inhibited cell cycle progression during G{sub 1}-to-S transition, thus significantly reducing the proliferation rate and fraction of Ki-67 positive MCF10A cells. In contrast, suppressed SLC25A43 expression in BT-474 cells resulted in a significantly increased proliferation rate together with an enhanced G{sub 1}-to-S transition. This was reflected by an increased fraction of Ki-67 positive cells and reduced level of nuclear p21. In line with our previous results, we show a role for SLC25A43 as a regulator of cell cycle progression and proliferation through a putative mitochondrial checkpoint. These novel data further strengthen the connection between mitochondrial function and the cell cycle, both in non-malignant and in cancer cells. - Highlights: • Proposed cell cycle regulation through the mitochondrial transporter SLC25A43. • SLC25A43 alters cell proliferation rate and cell cycle progression. • Suppressed SLC25A43 influences transcription of cell cycle regulatory genes.

  20. A sensorless control method for capacitor voltage balance and circulating current suppression of modular multilevel converter

    DEFF Research Database (Denmark)

    Liu, Hui; Ma, Ke; Loh, Poh Chiang

    2015-01-01

    There are several problems in the Modular Multilevel Converter (MMC), such as the appearance of circulating current, capacitor voltage unbalance and the requirement for a high number of sensors. All these problems will decrease the reliability and raise the cost/uncertainty of using MMC solutions....... As a result, a sensorless control method is proposed in this paper, which targets to improve the performances of MMC in respect to the above mentioned disadvantages: To decrease the cost and simplify the physical implementation, a state observer is proposed and designed to estimate both the capacitor voltages...... and the circulating currents in order to replace the high numbers of sensors. Furthermore, a control method combining the circulating current suppression and the capacitor voltage balancing is conducted based on the proposed state observer. It is concluded that the proposed state observer and control method can...

  1. Modelling of a Vector-current Controlled UPFC and Comprehensive Comparison with the Power-angle Control Strategy

    Science.gov (United States)

    Ren, Bixing; Du, Wenjuan; Cai, Hui; Wang, Haifeng; Wang, Xiangfeng; Zhang, Jianpeng

    2017-05-01

    This paper establishes the non-linear dynamic mathematical model of the vector-current controlled unified power flow controller (UPFC) and the linearized model of the UPFC is derived in detail afterwards for the analysis of dynamic performance stability. Then, the paper carries out deep investigations on the comparison and analysis for the above two control strategies applied to the UPFC in the aspects of dynamic interaction and auxiliary damping effect. The relative gain array (RGA) method is used to assess the dynamic interactions among the multiple control functions of the UPFC, and damping torque analysis (DTA) method is used to compare the damping performance of the UPFC auxiliary damping controller. The results of quantitative comparison by RGA and DTA analysis show that the vector-current controlled UPFC exhibits better decoupling characteristic among multiple control loops, while the power-angle controlled UPFC exhibits better auxiliary damping performance. Conclusions are further validated by the non-linear simulation results via a two-area four-machine system.

  2. Effects of Direct Torque Control Switching Strategies on Common Voltage and Bearing Current

    Directory of Open Access Journals (Sweden)

    Mohammad Taghi Sadeghzadeh

    2012-04-01

    Full Text Available Bearing current sininduction motorsare considered a sone of the most damaging factors. Induced shaft voltage through the parasitic capacitors cause this type of current. Inthispaper,given the increasing importance of direct torque control of induction motorin industry, various switching tables are assessed in order to ensure the lowest common voltage while maintaining the performance characteristics of the drive. Finally best switching table based on the minimum CMV, less torque rippleand better quality out put reference tracking is proposed.

  3. Joystick control for powered mobility: current state of technology and future directions.

    Science.gov (United States)

    Dicianno, Brad E; Cooper, Rory A; Coltellaro, John

    2010-02-01

    Recent advancements in control interface technology have made the use of end devices such as power wheelchairs easier for individuals with disabilities, especially persons with movement disorders. In this article, we discuss the current state of control interface technology and the devices available clinically for power wheelchair control. We also discuss our research on novel hardware and software approaches that are revolutionizing joystick interface technology and allowing more customizability for individual users with special needs and abilities. Finally, we discuss the future of control interfaces and what research gaps remain.

  4. A case control study of premorbid and currently reported physical activity levels in chronic fatigue syndrome

    Directory of Open Access Journals (Sweden)

    Buchwald Dedra

    2006-11-01

    Full Text Available Abstract Background Patients with chronic fatigue syndrome typically report high levels of physical activity before becoming ill. Few studies have examined premorbid and current activity levels in chronically fatigued patients. Methods In a case-control study, 33 patients with chronic, unexplained, disabling fatigue attending a university-based clinic specializing in fatigue were compared to 33 healthy, age- and sex-matched controls. Patients rated their activity levels before their illness and currently, using scales designed for this purpose. Controls reported their level of activity of 2 years previously and currently. Chi-square analyses, Student's t tests, and Wilcoxon signed rank tests were used in pair matched analyses. Results Compared to healthy controls, patients with chronic, unexplained fatigue rated themselves as more active before their illness (p ≤ 0.001 and less active currently (p ≤ 0.001. The patients also reported they currently stood or walked less than the controls (median [inter-quartile range] = 4 2345 versus 9 [7.5–12] hours, p ≤ 0.001, and spent more time reclining (median [inter-quartile range] = 12 10111213141516 versus 8 [8–9.5] hours, p ≤ 0.001. These differences remained significant for the subset of patients who met strict criteria for chronic fatigue syndrome or fibromyalgia. Conclusion Patients with chronic, unexplained, disabling fatigue reported being more active before becoming ill than healthy controls. This finding could be explained by greater premorbid activity levels that could predispose to illness, or by an overestimation of previous activity. Either possibility could influence patients' perceptions of their current activity levels and their judgments of recovery. Perceived activity should be addressed as part of management of the illness.

  5. Characteristic Analysis and Control of a Hybrid Excitation Linear Eddy Current Brake

    Directory of Open Access Journals (Sweden)

    Baoquan Kou

    2015-07-01

    Full Text Available In this paper, a novel hybrid excitation linear eddy current brake is presented as a braking system for high-speed road and rail vehicles. The presence of the permanent magnets (PMs, whose flux lines in the primary core are oppositely directed with respect to the flux lines by the excitation windings, has the effect of mitigating the saturation of the iron in the teeth of the primary core. This allows the brake to be fed with more intense currents, improving the braking force. First, using the magnetic equivalent circuit method and the layer theory approach, the analytical model of the hybrid excitation linear eddy current brake was developed, which can account for the saturation effects occurring in the iron parts. The saturation effects make the design and control of eddy current brakes more difficult. Second, the relationship between the braking force characteristics and the design parameters were analyzed to provide useful information to the designers of eddy current brakes. Then, the controller of the hybrid excitation linear eddy current brake was designed to control the amplitude of the braking force. Finally, experimental measurements were conducted to verify the validity of the theoretical analysis.

  6. Homozygous SLC2A9 mutations cause severe renal hypouricemia.

    Science.gov (United States)

    Dinour, Dganit; Gray, Nicola K; Campbell, Susan; Shu, Xinhua; Sawyer, Lindsay; Richardson, William; Rechavi, Gideon; Amariglio, Ninette; Ganon, Liat; Sela, Ben-Ami; Bahat, Hilla; Goldman, Michael; Weissgarten, Joshua; Millar, Michael R; Wright, Alan F; Holtzman, Eliezer J

    2010-01-01

    Hereditary hypouricemia may result from mutations in the renal tubular uric acid transporter URAT1. Whether mutation of other uric acid transporters produces a similar phenotype is unknown. We studied two families who had severe hereditary hypouricemia and did not have a URAT1 defect. We performed a genome-wide homozygosity screen and linkage analysis and identified the candidate gene SLC2A9, which encodes the glucose transporter 9 (GLUT9). Both families had homozygous SLC2A9 mutations: A missense mutation (L75R) in six affected members of one family and a 36-kb deletion, resulting in a truncated protein, in the other. In vitro, the L75R mutation dramatically impaired transport of uric acid. The mean concentration of serum uric acid of seven homozygous individuals was 0.17 +/- 0.2 mg/dl, and all had a fractional excretion of uric acid >150%. Three individuals had nephrolithiasis, and three had a history of exercise-induced acute renal failure. In conclusion, homozygous loss-of-function mutations of GLUT9 cause a total defect of uric acid absorption, leading to severe renal hypouricemia complicated by nephrolithiasis and exercise-induced acute renal failure. In addition to clarifying renal handling of uric acid, our findings may provide a better understanding of the pathophysiology of acute renal failure, nephrolithiasis, hyperuricemia, and gout.

  7. Distributed Cooperative Current-Sharing Control of Parallel Chargers Using Feedback Linearization

    Directory of Open Access Journals (Sweden)

    Jiangang Liu

    2014-01-01

    Full Text Available We propose a distributed current-sharing scheme to address the output current imbalance problem for the parallel chargers in the energy storage type light rail vehicle system. By treating the parallel chargers as a group of agents with output information sharing through communication network, the current-sharing control problem is recast as the consensus tracking problem of multiagents. To facilitate the design, input-output feedback linearization is first applied to transform the nonidentical nonlinear charging system model into the first-order integrator. Then, a general saturation function is introduced to design the cooperative current-sharing control law which can guarantee the boundedness of the proposed control. The cooperative stability of the closed-loop system under fixed and dynamic communication topologies is rigorously proved with the aid of Lyapunov function and LaSalle invariant principle. Simulation using a multicharging test system further illustrates that the output currents of parallel chargers are balanced using the proposed control.

  8. Current-Loop Control for the Pitching Axis of Aerial Cameras via an Improved ADRC

    Directory of Open Access Journals (Sweden)

    BingYou Liu

    2017-01-01

    Full Text Available An improved active disturbance rejection controller (ADRC is designed to eliminate the influences of the current-loop for the pitching axis control system of an aerial camera. The improved ADRC is composed of a tracking differentiator (TD, an improved extended state observer (ESO, an improved nonlinear state error feedback (NLSEF, and a disturbance compensation device (DCD. The TD is used to arrange transient process. The improved ESO is utilized to observe the state extended by nonlinear dynamics, model uncertainty, and external disturbances. Overtime variation of the current-loop can be predicted by the improved ESO. The improved NLSEF is adopted to restrain the residual errors of the current-loop. The DCD is used to compensate the overtime variation of the current-loop in real time. The improved ADRC is designed based on a new nonlinear function newfal(·. This function exhibits enhanced continuity and smoothness compared to previously available nonlinear functions. Thus, the new nonlinear function can effectively decrease the high-frequency flutter phenomenon. The improved ADRC exhibits improved control performance, and disturbances of the current-loop can be eliminated by the improved ADRC. Finally, simulation experiments are performed. Results show that the improved ADRC displayed better performance than the proportional integral (PI control strategy and traditional ADRC.

  9. Inrush Current Suppression Circuit and Method for Controlling When a Load May Be Fully Energized

    Science.gov (United States)

    Schwerman, Paul (Inventor)

    2017-01-01

    A circuit and method for controlling when a load may be fully energized includes directing electrical current through a current limiting resistor that has a first terminal connected to a source terminal of a field effect transistor (FET), and a second terminal connected to a drain terminal of the FET. The gate voltage magnitude on a gate terminal of the FET is varied, whereby current flow through the FET is increased while current flow through the current limiting resistor is simultaneously decreased. A determination is made as to when the gate voltage magnitude on the gate terminal is equal to or exceeds a predetermined reference voltage magnitude, and the load is enabled to be fully energized when the gate voltage magnitude is equal to or exceeds the predetermined reference voltage magnitude.

  10. MISO Current-mode Biquad Filter with Independent Control of Pole Frequency and Quality Factor

    Directory of Open Access Journals (Sweden)

    W. Jaikla

    2012-09-01

    Full Text Available This article presents a three-inputs single-output biquadratic filter performing completely standard functions: low-pass, high-pass, band-pass, band-reject and all-pass functions, based on current controlled current conveyor transconductance amplifier (CCCCTA. The quality factor and pole frequency can be electronically/independently tuned via the input bias current. The proposed circuit uses 2 CCCCTAs and 2 grounded capacitors without external any resistors which is very suitable to further develop into an integrated circuit. The filter does not require double input current signal. Each function response can be selected by suitably selecting input signals with digital method. Moreover, the circuit possesses high output impedance which would be an ideal choice for current-mode cascading. The PSPICE simulation results are included to verify the workability of the proposed filter. The given results agree well with the theoretical anticipation.

  11. Theory and experiments on RF plasma heating, current drive and profile control in TORE SUPRA

    Energy Technology Data Exchange (ETDEWEB)

    Moreau, D.

    1994-01-01

    This paper reviews the main experimental and theoretical achievements related to the study of RF heating and non-inductive current drive and particularly phenomena related to the current density profile control and the potentiality of producing stationary enhanced performance regimes: description of the Lower Hybrid (LH) and Ion Cyclotron Resonant Frequency (ICRF) systems; long pulse coupling performance of the RF systems; observation of the transition to the so-called ``stationary LHEP regime`` in which the (flat) central current density and (peaked) electron temperature profiles are fully decoupled; experiments on ICRF sawtooth stabilization with the combined effect of LHCD modifying the current density profile; diffusion of fast electrons generated by LH waves; ramp-up experiments in which the LH power provided a significant part of the resistive poloidal flux and flux consumption scaling; theory of spectral wave diffusion and multipass absorption; fast wave current drive modelling with the Alcyon full wave code; a reflector LH antenna concept. 18 figs., 48 refs.

  12. The steady-state performance of a controlled current active filter

    Energy Technology Data Exchange (ETDEWEB)

    Duke, R.M. (Univ. of Canterbury, Christchurch (New Zealand). Dept. of Electrical and Electronic Engineering); Round, S.D. (Univ. of Minnesota, Minneapolis, MN (United States). Dept. of Electrical Engineering)

    1993-04-01

    An active filter that uses a high-frequency D-class asynchronous switching inverter for power system current distortion compensation is described. The distortion compensation technique involves deriving a signal corresponding to the distortion component of load current, and inverting and amplifying this signal for addition back to the supply current to cancel the load current distortion. A synthetic sinusoid is used to determine the distortion component in the time domain. Extensive computed and experimental results, illustrating the system's steady-state performance and ability to reduce the current harmonic distortion components, are presented. An intelligent controller is proposed to maintain the active filter's performance at the optimal operating point under varying load conditions.

  13. Current control loop design and analysis based on resonant regulators for microgrid applications

    DEFF Research Database (Denmark)

    Federico, de Bosio; Pastorelli, Michelle; de Sousa Ribeiro, Luiz Antonio

    2015-01-01

    Voltage and current control loops play an important role in the performance of microgrids employing power electronics voltage source inverters. Correct design of feedback loops is essential for the proper operation of these systems. This paper analyzes the influence of state feedback cross......-coupling in the design of resonant regulators for inner current loops in power converters operating in standalone microgrids. It is also demonstrated that the effect of state feedback cross-coupling degrades the performance of the control loops by increasing the steady-state error. Different resonant regulators...... structures are analyzed and compared, performing experimental tests to validate the results of the theoretical analysis....

  14. H∞ Robust Current Control for DFIG Based Wind Turbine subject to Grid Voltage Distortions

    DEFF Research Database (Denmark)

    Wang, Yun; Wu, Qiuwei; Gong, Wenming

    2016-01-01

    distortions considered include asymmetric voltage dips and grid background harmonics. An uncertain DFIG model is developed with uncertain factors originating from distorted stator voltage, and changed generator parameters due to the flux saturation effect, the skin effect, etc. Weighting functions......This paper proposes an H∞ robust current controller for doubly fed induction generator (DFIG) based wind turbines (WTs) subject to grid voltage distortions. The controller is to mitigate the impact of the grid voltage distortions on rotor currents with DFIG parameter perturbation. The grid voltage...

  15. Decoupled Double Synchronous Reference Frame Current Controller for Unbalanced Grid Voltage Conditions

    DEFF Research Database (Denmark)

    Reyes, M.; Rodriguez, Pedro; Vazquez, S.

    2012-01-01

    Due to the growing changes in the electrical network related to the new distributed generation scheme and the integration of renewable energy sources, new requirements for grid-connected power converters are being defined in the new grid codes. The injection of positive- and negative......-sequence current components is becoming necessary for achieving new capabilities like the reactive power injection during a grid fault. This paper deals with a fundamental issue in this topic, i.e., the performance of the current controller. Classical dq controllers, which are extensively used in industrial...

  16. MPPT control of Photovoltaic using SEPIC converter to reduce the input current ripples

    Directory of Open Access Journals (Sweden)

    M. R. Banaei

    2014-01-01

    Full Text Available This paper presents P&O control method for maximum power point tracking(MPPT of PV system under varying irradiation and temperature conditions. This algorithm will identify the suitable duty ratio in which the DC/DC SEPIC converter should be operated to maximize the power output. In this paper, the SEPIC converter has been compared with conventional boost converter about reducing the input current ripple. Also, both converters and their control strategies have been analyzed and simulated using Simulink/Matlab software. Simulation results show that the SEPIC converter reduces input current better than conventional boost converter.

  17. Controlling Confinement with Induced Toroidal Current in the Flexible Heliac TJ-II

    Energy Technology Data Exchange (ETDEWEB)

    Romero, J. A.; Lopez-Bruna, D.; Lopez-Fraguas, A.; Ascasibar, E.; TJ-II Team

    2002-07-01

    A method to control plasma particle an energy confinement in the TJ-II Heliac devices is reported A small toroidal current is induced in the plasma with the aid of a 0.2 Wb air core transformer. Plasma particle and energy confinement improve (degrade) with negative (positive) plasma current. For typical TJ-II discharges plasma density and temperature broaden considerably when plasma current is sufficiently negative, accounting for a 40% increase in stored energy. The experimental results agree qualitatively with the paradigm of instability growth rate modifications with magnetic shear. (Author) 18 refs.

  18. Multi-Objective Predictive Balancing Control of Battery Packs Based on Predictive Current

    Directory of Open Access Journals (Sweden)

    Wenbiao Li

    2016-04-01

    Full Text Available Various balancing topology and control methods have been proposed for the inconsistency problem of battery packs. However, these strategies only focus on a single objective, ignore the mutual interaction among various factors and are only based on the external performance of the battery pack inconsistency, such as voltage balancing and state of charge (SOC balancing. To solve these problems, multi-objective predictive balancing control (MOPBC based on predictive current is proposed in this paper, namely, in the driving process of an electric vehicle, using predictive control to predict the battery pack output current the next time. Based on this information, the impact of the battery pack temperature caused by the output current can be obtained. Then, the influence is added to the battery pack balancing control, which makes the present degradation, temperature, and SOC imbalance achieve balance automatically due to the change of the output current the next moment. According to MOPBC, the simulation model of the balancing circuit is built with four cells in Matlab/Simulink. The simulation results show that MOPBC is not only better than the other traditional balancing control strategies but also reduces the energy loss in the balancing process.

  19. A naturally occurring mutation in the SLC21A6 gene causing impaired membrane localization of the hepatocyte uptake transporter.

    Science.gov (United States)

    Michalski, Christoph; Cui, Yunhai; Nies, Anne T; Nuessler, Andreas K; Neuhaus, Peter; Zanger, Ulrich M; Klein, Kathrin; Eichelbaum, Michel; Keppler, Dietrich; Konig, Jorg

    2002-11-08

    The organic anion transporter SLC21A6 (also known as OATP2, OATP-C, or LST-1) is involved in the hepatocellular uptake of a variety of endogenous and xenobiotic substances and drugs. We analyzed 81 human liver samples by immunoblotting and found one with a strongly reduced amount of SLC21A6 protein suggesting mutations in the SLC21A6 gene. The SLC21A6 cDNA from this sample contained five base pair changes in one allele; three of the mutations resulted in amino acid substitutions designated SLC21A6-N130D, SLC21A6-P155T, and SLC21A6-L193R. The former two were polymorphisms (SLC21A6*1b and SLC21A6*4), whereas SLC21A6-L193R represents the first naturally occurring mutation identified in one allele of the SLC21A6 gene, which affects protein maturation and organic anion transport. We introduced each of the mutations into the SLC21A6 cDNA and established stably transfected MDCKII cells expressing the respective mutant SLC21A6 protein. Immunofluorescence microscopy and uptake measurements were used to study localization and transport properties of the mutated proteins. Both proteins carrying the polymorphisms were sorted to the lateral membrane like wild-type SLC21A6, but their transport properties for the substrates cholyltaurine and 17beta-glucuronosyl estradiol were altered. Importantly, most of the mutant protein SLC21A6-L193R was retained intracellularly, and this single amino acid exchange abolished transport function.

  20. Path Following Control of an AUV under the Current Using the SVR-ADRC

    Directory of Open Access Journals (Sweden)

    Zheping Yan

    2014-01-01

    Full Text Available A novel active disturbance rejection control (ADRC controller is proposed based on support vector regression (SVR. The SVR-ADRC is designed to force an underactuated autonomous underwater vehicle (AUV to follow a path in the horizontal plane with the ocean current disturbance. It is derived using SVR algorithm to adjust the coefficients of the nonlinear state error feedback (ELSEF part in ADRC to deal with nonlinear variations at different operating points. The trend of change about ELSEF coefficients in the simulation proves that the designed SVR algorithm maintains the characteristics of astringency and stability. Furthermore, the path following errors under current in simulation has proved the high accuracy, strong robustness, and stability of the proposed SVR-ADRC. The contributions of the proposed controller are to improve the characteristics of ADRC considering the changing parameters in operating environment which make the controller more adaptive for the situation.

  1. A GPS-Based Control Framework for Accurate Current Sharing and Power Quality Improvement in Microgrids

    DEFF Research Database (Denmark)

    Golsorkhi, Mohammad; Savaghebi, Mehdi; Lu, Dylan;

    2016-01-01

    consensus protocol to ensure proportional sharing of average power. The voltage conditioning scheme produces compensation signals at fundamental and dominant harmonics to improve the voltage quality at a sensitive load bus. Experimental results are presented to validate the efficacy of the proposed method.......This paper proposes a novel hierarchical control strategy for improvement of load sharing and power quality in ac microgrids. This control framework is composed of a droop based controller at the primary level, and a combination of distributed power sharing and voltage conditioning schemes...... dynamic response. The droop coefficient, which acts as a virtual resistance is adaptively changed as a function of the peak current. This strategy not only simplifies the control design but also improves the current sharing accuracy at high loading conditions. The distributed power sharing scheme uses...

  2. The Current Status of Baculovirus and Their Implication for Insect Pest Control

    Directory of Open Access Journals (Sweden)

    Arman Wijonarko

    2001-07-01

    Full Text Available Baculovirus have been promoted as the promising bioinsecticides for their pest control potential for more than half a century. But only a few have been successful as biological control agent, and almost none has been proven as commercial success, or widely used for large-scale insect pest control. The bioinsecticides currently represent only a small fraction of the world pesticide market. The successful of the Bt crop marked a special achievement in the bioinsecticide market growth. How about the baculoviruses? The main hurdle for baculovirus to be developed as bioinsecticide is its poor performance compare to synthetic chemical ones, include the speed of kill, and host range. It is important to understand the nature of baculovirus, and explore the possibilities to develop new way in applying the baculovirus as bioinsecticides. Key words: current status, baculovirus, insect control

  3. Design of Current Controller for Two Quadrant DC Motor Drive by Using Model Order Reduction Technique

    CERN Document Server

    Ramesh, K; Nirmalkumar, A; Gurusamy, G

    2010-01-01

    In this paper, design of current controller for a two quadrant DC motor drive was proposed with the help of model order reduction technique. The calculation of current controller gain with some approximations in the conventional design process is replaced by proposed model order reduction method. The model order reduction technique proposed in this paper gives the better controller gain value for the DC motor drive. The proposed model order reduction method is a mixed method, where the numerator polynomial of reduced order model is obtained by using stability equation method and the denominator polynomial is obtained by using some approximation technique preceded in this paper. The designed controllers responses were simulated with the help of MATLAB to show the validity of the proposed method.

  4. Controlling fluctuations and transport in the reversed field pinch with edge current drive and plasma biasing

    Energy Technology Data Exchange (ETDEWEB)

    Craig, D.J.G.

    1998-09-01

    Two techniques are employed in the Madison Symmetric Torus (MST) to test and control different aspects of fluctuation induced transport in the Reversed Field Pinch (RFP). Auxiliary edge currents are driven along the magnetic field to modify magnetic fluctuations, and the particle and energy transport associated with them. In addition, strong edge flows are produced by plasma biasing. Their effect on electrostatic fluctuations and the associated particle losses is studied. Both techniques are accomplished using miniature insertable plasma sources that are biased negatively to inject electrons. This type of emissive electrode is shown to reliably produce intense, directional current without significant contamination by impurities. The two most important conclusions derived from these studies are that the collective modes resonant at the reversal surface play a role in global plasma confinement, and that these modes can be controlled by modifying the parallel current profile outside of the reversal surface. This confirms predictions based on magnetohydrodynamic (MHD) simulations that auxiliary current drive in the sense to flatten the parallel current profile can be successful in controlling magnetic fluctuations in the RFP. However, these studies expand the group of magnetic modes believed to cause transport in MST and suggest that current profile control efforts need to address both the core resonant magnetic modes and those resonant at the reversal surface. The core resonant modes are not significantly altered in these experiments; however, the distribution and/or amplitude of the injected current is probably not optimal for affecting these modes. Plasma biasing generates strong edge flows with shear and particle confinement likely improves in these discharges. These experiments resemble biased H modes in other magnetic configurations in many ways. The similarities are likely due to the common role of electrostatic fluctuations in edge transport.

  5. [Current situation of endemic status, prevention and control of neglected zoonotic diseases in China].

    Science.gov (United States)

    Liu, Lu; Zhu, Hong-Run; Yang, Guo-Jing

    2013-06-01

    Neglected zoonotic diseases not only threaten the health of human, especially to the livestock keepers in poverty-stricken areas but also cause great economic losses to the animal husbandry. This paper reviews the current situation of the endemic status, prevention and control of neglected zoonotic diseases existing in China including rabies, bovine tuberculosis, brucellosis, anthrax, leptospirosis, echinococcosis, cysticercosis, leishmaniasis and fascioliasis, so as to provide the basic information for better controlling, even eliminating, the neglected zoonotic diseases in China.

  6. Load Torque Compensator for Model Predictive Direct Current Control in High Power PMSM Drive Systems

    DEFF Research Database (Denmark)

    Preindl, Matthias; Schaltz, Erik

    2010-01-01

    behaviour. It compensates the load torque influence on the speed control setting a feed forward torque value, i.e. current reference value. The benefits are twice. The speed controller reaches immediately the speed reference value avoiding offsets which must be compensated by the weak integrator. Moreover......, a better response to load torque variations which are detected and compensated leading to small speed variations is obtained....

  7. Application of drive circuit based on L298N in direct current motor speed control system

    Science.gov (United States)

    Yin, Liuliu; Wang, Fang; Han, Sen; Li, Yuchen; Sun, Hao; Lu, Qingjie; Yang, Cheng; Wang, Quanzhao

    2016-10-01

    In the experiment of researching the nanometer laser interferometer, our design of laser interferometer circuit system is up to the wireless communication technique of the 802.15.4 IEEE standard, and we use the RF TI provided by Basic to receive the data on speed control system software. The system's hardware is connected with control module and the DC motor. However, in the experiment, we found that single chip microcomputer control module is very difficult to drive the DC motor directly. The reason is that the DC motor's starting and braking current is larger than the causing current of the single chip microcomputer control module. In order to solve this problem, we add a driving module that control board can transmit PWM wave signal through I/O port to drive the DC motor, the driving circuit board can come true the function of the DC motor's positive and reversal rotation and speed adjustment. In many various driving module, the L298N module's integrated level is higher compared with other driver module. The L298N model is easy to control, it not only can control the DC motor, but also achieve motor speed control by modulating PWM wave that the control panel output. It also has the over-current protection function, when the motor lock, the L298N model can protect circuit and motor. So we use the driver module based on L298N to drive the DC motor. It is concluded that the L298N driver circuit module plays a very important role in the process of driving the DC motor in the DC motor speed control system.

  8. Molecular Genetic Regulation of Slc30a8/ZnT8 Reveals a Positive Association With Glucose Tolerance.

    Science.gov (United States)

    Mitchell, Ryan K; Hu, Ming; Chabosseau, Pauline L; Cane, Matthew C; Meur, Gargi; Bellomo, Elisa A; Carzaniga, Raffaella; Collinson, Lucy M; Li, Wen-Hong; Hodson, David J; Rutter, Guy A

    2016-01-01

    Zinc transporter 8 (ZnT8), encoded by SLC30A8, is chiefly expressed within pancreatic islet cells, where it mediates zinc (Zn(2+)) uptake into secretory granules. Although a common nonsynonymous polymorphism (R325W), which lowers activity, is associated with increased type 2 diabetes (T2D) risk, rare inactivating mutations in SLC30A8 have been reported to protect against T2D. Here, we generate and characterize new mouse models to explore the impact on glucose homeostasis of graded changes in ZnT8 activity in the β-cell. Firstly, Slc30a8 was deleted highly selectively in these cells using the novel deleter strain, Ins1Cre. The resultant Ins1CreZnT8KO mice displayed significant (P < .05) impairments in glucose tolerance at 10 weeks of age vs littermate controls, and glucose-induced increases in circulating insulin were inhibited in vivo. Although insulin release from Ins1CreZnT8KO islets was normal, Zn(2+) release was severely impaired. Conversely, transgenic ZnT8Tg mice, overexpressing the transporter inducibly in the adult β-cell using an insulin promoter-dependent Tet-On system, showed significant (P < .01) improvements in glucose tolerance compared with control animals. Glucose-induced insulin secretion from ZnT8Tg islets was severely impaired, whereas Zn(2+) release was significantly enhanced. Our findings demonstrate that glucose homeostasis in the mouse improves as β-cell ZnT8 activity increases, and remarkably, these changes track Zn(2+) rather than insulin release in vitro. Activation of ZnT8 in β-cells might therefore provide the basis of a novel approach to treating T2D.

  9. European genome-wide association study identifies SLC14A1 as a new urinary bladder cancer susceptibility gene.

    Science.gov (United States)

    Rafnar, Thorunn; Vermeulen, Sita H; Sulem, Patrick; Thorleifsson, Gudmar; Aben, Katja K; Witjes, J Alfred; Grotenhuis, Anne J; Verhaegh, Gerald W; Hulsbergen-van de Kaa, Christina A; Besenbacher, Soren; Gudbjartsson, Daniel; Stacey, Simon N; Gudmundsson, Julius; Johannsdottir, Hrefna; Bjarnason, Hjordis; Zanon, Carlo; Helgadottir, Hafdis; Jonasson, Jon Gunnlaugur; Tryggvadottir, Laufey; Jonsson, Eirikur; Geirsson, Gudmundur; Nikulasson, Sigfus; Petursdottir, Vigdis; Bishop, D Timothy; Chung-Sak, Sei; Choudhury, Ananya; Elliott, Faye; Barrett, Jennifer H; Knowles, Margaret A; de Verdier, Petra J; Ryk, Charlotta; Lindblom, Annika; Rudnai, Peter; Gurzau, Eugene; Koppova, Kvetoslava; Vineis, Paolo; Polidoro, Silvia; Guarrera, Simonetta; Sacerdote, Carlotta; Panadero, Angeles; Sanz-Velez, José I; Sanchez, Manuel; Valdivia, Gabriel; Garcia-Prats, Maria D; Hengstler, Jan G; Selinski, Silvia; Gerullis, Holger; Ovsiannikov, Daniel; Khezri, Abdolaziz; Aminsharifi, Alireza; Malekzadeh, Mahyar; van den Berg, Leonard H; Ophoff, Roel A; Veldink, Jan H; Zeegers, Maurice P; Kellen, Eliane; Fostinelli, Jacopo; Andreoli, Daniele; Arici, Cecilia; Porru, Stefano; Buntinx, Frank; Ghaderi, Abbas; Golka, Klaus; Mayordomo, José I; Matullo, Giuseppe; Kumar, Rajiv; Steineck, Gunnar; Kiltie, Anne E; Kong, Augustine; Thorsteinsdottir, Unnur; Stefansson, Kari; Kiemeney, Lambertus A

    2011-11-01

    Three genome-wide association studies in Europe and the USA have reported eight urinary bladder cancer (UBC) susceptibility loci. Using extended case and control series and 1000 Genomes imputations of 5 340 737 single-nucleotide polymorphisms (SNPs), we searched for additional loci in the European GWAS. The discovery sample set consisted of 1631 cases and 3822 controls from the Netherlands and 603 cases and 37 781 controls from Iceland. For follow-up, we used 3790 cases and 7507 controls from 13 sample sets of European and Iranian ancestry. Based on the discovery analysis, we followed up signals in the urea transporter (UT) gene SLC14A. The strongest signal at this locus was represented by a SNP in intron 3, rs17674580, that reached genome-wide significance in the overall analysis of the discovery and follow-up groups: odds ratio = 1.17, P = 7.6 × 10(-11). SLC14A1 codes for UTs that define the Kidd blood group and are crucial for the maintenance of a constant urea concentration gradient in the renal medulla and, through this, the kidney's ability to concentrate urine. It is speculated that rs17674580, or other sequence variants in LD with it, indirectly modifies UBC risk by affecting urine production. If confirmed, this would support the 'urogenous contact hypothesis' that urine production and voiding frequency modify the risk of UBC.

  10. Power Management Based Current Control Technique for Photovoltaic-Battery Assisted Wind-Hydro Hybrid System

    Science.gov (United States)

    Ram Prabhakar, J.; Ragavan, K.

    2013-07-01

    This article proposes new power management based current control strategy for integrated wind-solar-hydro system equipped with battery storage mechanism. In this control technique, an indirect estimation of load current is done, through energy balance model, DC-link voltage control and droop control. This system features simpler energy management strategy and necessitates few power electronic converters, thereby minimizing the cost of the system. The generation-demand (G-D) management diagram is formulated based on the stochastic weather conditions and demand, which would likely moderate the gap between both. The features of management strategy deploying energy balance model include (1) regulating DC-link voltage within specified tolerances, (2) isolated operation without relying on external electric power transmission network, (3) indirect current control of hydro turbine driven induction generator and (4) seamless transition between grid-connected and off-grid operation modes. Furthermore, structuring of the hybrid system with appropriate selection of control variables enables power sharing among each energy conversion systems and battery storage mechanism. By addressing these intricacies, it is viable to regulate the frequency and voltage of the remote network at load end. The performance of the proposed composite scheme is demonstrated through time-domain simulation in MATLAB/Simulink environment.

  11. Simple voltage-controlled current source for wideband electrical bioimpedance spectroscopy: circuit dependences and limitations

    Science.gov (United States)

    Seoane, F.; Macías, R.; Bragós, R.; Lindecrantz, K.

    2011-11-01

    In this work, the single Op-Amp with load-in-the-loop topology as a current source is revisited. This circuit topology was already used as a voltage-controlled current source (VCCS) in the 1960s but was left unused when the requirements for higher frequency arose among the applications of electrical bioimpedance (EBI). The aim of the authors is not only limited to show that with the currently available electronic devices it is perfectly viable to use this simple VCCS topology as a working current source for wideband spectroscopy applications of EBI, but also to identify the limitations and the role of each of the circuit components in the most important parameter of a current for wideband applications: the output impedance. The study includes the eventual presence of a stray capacitance and also an original enhancement, driving with current the VCCS. Based on the theoretical analysis and experimental measurements, an accurate model of the output impedance is provided, explaining the role of the main constitutive elements of the circuit in the source's output impedance. Using the topologies presented in this work and the proposed model, any electronic designer can easily implement a simple and efficient current source for wideband EBI spectroscopy applications, e.g. in this study, values above 150 kΩ at 1 MHz have been obtained, which to the knowledge of the authors are the largest values experimentally measured and reported for a current source in EBI at this frequency.

  12. Genetic Polymorphism of the Serotonin Transporter Gene, SLC6A4 rs16965628, Is Associated with Obsessive Compulsive Disorder.

    Science.gov (United States)

    Cengiz, Mujgan; Okutan, Saide Nur; Bayoglu, Burcu; Sakalli Kani, Ayse; Bayar, Reha; Kocabasoglu, Nese

    2015-05-01

    Obsessive compulsive disorder (OCD) is a psychiatric disorder characterized by obsessive ideas and compulsive behaviors. Genetic studies have centered on candidate genes involved in OCD etiology related to serotonergic and dopaminergic systems. In this study, the relationship between cathechol-O-methyltransferase (COMT) -287A/G (rs2097063), serotonin transporters 5-HTTLPR I/D, and SLC6A4 rs16965628 polymorphisms in 80 OCD patients and 100 healthy controls was determined. Patients and controls were genotyped for COMT rs2097063 and SLC6A4 rs16965628 polymorphisms by real-time polymerase chain reaction (PCR). The 5-HTTLPR I/D polymorphism was genotyped using PCR and agarose gel electrophoresis. Severity of symptoms was checked with a Yale-Brown Obsession Compulsion Scale (Y-BOCS). When the OCD group and controls were compared, no significant difference was found between COMT -287A/G (rs2097063), 5-HTTLPR I/D polymorphisms, and OCD. However, a significant difference was found between 5-HTT rs16965628 polymorphism and OCD (p=0.025, OR=3.43, 95% CI 1.41-10.35). In addition, the G allele frequency was found to be higher for rs16965628 in the OCD group. No significant difference was observed between COMT -287A/G (rs2097063), SLC6A4 rs16965628, and 5-HTTLPR I/D polymorphisms and Y-BOCS scores (p>0.05). There was also lack of correlation between Yale-Brown scores and gender of OCD patients. On the other hand, combined genotypes of SLC6A4 rs16965628 GG+GC were found to be risk factors for OCD development (p=0.02, OR=3.464; 95% CI 1.214-9.883) in logistic regression analysis adjusted for age and gender. Our findings suggest that subjects carrying the G allele of rs16965628 have genetic susceptibility to OCD. These data are the first to suggest that polymorphism in serotonin transporter (rs16965628) is associated with the development of OCD in the Turkish population.

  13. Optimum Peak Current Hysteresis Control for Energy Recovering Converter in CDI Desalination

    Directory of Open Access Journals (Sweden)

    Alberto M. Pernía

    2014-06-01

    Full Text Available Capacitive De-Ionization (CDI is becoming a suitable alternative for desalination. The low cost of the materials required and its reduced energy consumption can be critical factors for developing this technique. CDI technology does not require a high-pressure system and the energy storage capability of CDI cells allows it to be reused in other CDI cells, thus minimizing consumption. The goal of the power stage responsible of the energy recovery is transferring the stored energy from one cell to another with the maximum possible efficiency, thus allowing the desalination process to continue. Assuming hysteresis current control is implemented at the DC/DC (direct current converter, this paper aims to determine the optimum peak current through the inductor in each switching period with a view to maximizing overall efficiency. The geometrical parameters of the desalination cell and the NaCl concentration modify the cell electrical properties. The peak current control of the power stage should be adapted to the cell characteristics so that the efficiency behavior of the whole CDI system can be improved. The mathematical model defined in this paper allows the CDI plant automation using the peak inductor current as control variable, adapting its value to the salt concentration during the desalination process.

  14. Compensation methods applied in current control schemes for large AC drive systems

    DEFF Research Database (Denmark)

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus;

    2012-01-01

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...

  15. Controlling the on/off current ratio of ferroelectric field-effect transistors

    NARCIS (Netherlands)

    Katsouras, I.; Zhao, D.; Spijkman, M.J.; Li, M.; Blom, P.W.M.; Leeuw, D.M. de; Asadi, K.

    2015-01-01

    The on/off current ratio in organic ferroelectric field-effect transistors (FeFETs) is largely determined by the position of the threshold voltage, the value of which can show large device-to-device variations. Here we show that by employing a dual-gate layout for the FeFET, we can gain full control

  16. Small-signal model of a decoupled double synchronous reference frame current controller

    DEFF Research Database (Denmark)

    Dowlatabadi, Mohammadkazem Bakhshizadeh; Hjerrild, Jester; Kocewiak, Lukasz;

    2016-01-01

    the dq signals are not dc anymore, and therefore, linearization cannot be done. In this paper a Decoupled Double Synchronous Frame PLL is used to eliminate the oscillations in the dq frame signals. The small signal model of this PLL including an unbalanced current controller is presented in this paper....

  17. A current controller of grid-connected converter for harmonic damping in a distribution network

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Chen, Zhe

    2011-01-01

    Harmonic resonance caused by the increased use of shunt-connected capacitors in LCL-filters and power factor correction devices may become a serious power quality challenge in electric distribution systems. A voltage-detection method based on current control is developed to damp harmonic resonanc...

  18. Flexible Microgrid Power Quality Enhancement Using Adaptive Hybrid Voltage and Current Controller

    DEFF Research Database (Denmark)

    He, Jinwei; Li, Yun Wei; Blaabjerg, Frede

    2014-01-01

    To accomplish superior harmonic compensation performance using distributed generation (DG) unit power electronics interfaces, an adaptive hybrid voltage and current controlled method (HCM) is proposed in this paper. It shows that the proposed adaptive HCM can reduce the numbers of low-pass/bandpa...

  19. Mitigation of grid-current distortion for LCL-filtered grid-connected voltage-source inverter with inverter-side current control

    DEFF Research Database (Denmark)

    Xin, Zhen; Mattavelli, Paolo; Yao, WenLi

    2017-01-01

    Due to the low inductance of an LCL-filter, the grid current generated by an LCL-filtered Voltage Source Inverter (VSI) is sensitive to low-order grid-voltage harmonics. This issue is especially tough for the control system with Inverter Current Feedback (ICF), because the grid-current harmonics...... can freely flow into the filter capacitor without control. To cope with this issue, this paper develops an approach for the ICF control system to suppress the grid-current harmonics without adding extra sensors. The proposed method applies harmonic controllers and feedforward scheme simultaneously......, and the instability risk introduced by the feedforward loop can be ingeniously avoided through a special design of the feedforward position, which maintains the inherent stability characteristic of the ICF control system. The effectiveness of the proposed method and the correctness of the theoretical analyses...

  20. Assessment of current practices in creating and using passwords as a control mechanism for information access

    Directory of Open Access Journals (Sweden)

    P. L. Wessels

    2007-11-01

    Full Text Available One of the critical issues in managing information within an organization is to ensure that proper controls exist and are applied in allowing people access to information. Passwords are used extensively as the main control mechanism to identify users wanting access to systems, applications, data files, network servers or personal information. In this article, the issues involved in selecting and using passwords are discussed and the current practices employed by users in creating and storing passwords to gain access to sensitive information are assessed. The results of this survey conclude that information managers cannot rely only on users to employ proper password control in order to protect sensitive information.

  1. Virtual-Impedance-Based Control for Voltage-Source and Current-Source Converters

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Li, YunWei; Blaabjerg, Frede;

    2015-01-01

    The virtual impedance concept is increasingly used for the control of power electronic systems. Generally, the virtual impedance loop can either be embedded as an additional degree of freedom for active stabilization and disturbance rejection, or be employed as a command reference generator...... for the converters to provide ancillary services. This paper presents an overview of the virtual-impedance-based control strategies for voltage-source and current-source converters. The control output impedance shaping attained by the virtual impedances is generalized first using the impedance-based models...

  2. Model Predictive Current Control for High-Power Grid-Connected Converters with Output LCL Filter

    DEFF Research Database (Denmark)

    Delpino, Hernan Anres Miranda; Teodorescu, Remus; Rodriguez, Pedro

    2009-01-01

    A model predictive control strategy for a highpower, grid connected 3-level neutral clamped point converter is presented. Power losses constraints set a limit on commutation losses so reduced switching frequency is required, thus producing low frequency current harmonics. To reduce these harmonics...... an LCL filter is used. The proposed control strategy allows control of the active and reactive power fed into the grid, reduce the switching frequency within acceptable operational margins and keep balance of the DC-link capacitor voltages while avoiding excitation of the filter resonance frequencies....

  3. Filtering and Control of High Speed Motor Current in a Flywheel Energy Storage System

    Science.gov (United States)

    Kenny, Barbara H.; Santiago, Walter

    2004-01-01

    The NASA Glenn Research Center has been developing technology to enable the use of high speed flywheel energy storage units in future spacecraft for the last several years. An integral part of the flywheel unit is the three phase motor/generator that is used to accelerate and decelerate the flywheel. The motor/generator voltage is supplied from a pulse width modulated (PWM) inverter operating from a fixed DC voltage supply. The motor current is regulated through a closed loop current control that commands the necessary voltage from the inverter to achieve the desired current. The current regulation loop is the innermost control loop of the overall flywheel system and, as a result, must be fast and accurate over the entire operating speed range (20,000 to 60,000 rpm) of the flywheel. The voltage applied to the motor is a high frequency PWM version of the DC bus voltage that results in the commanded fundamental value plus higher order harmonics. Most of the harmonic content is at the switching frequency and above. The higher order harmonics cause a rapid change in voltage to be applied to the motor that can result in large voltage stresses across the motor windings. In addition, the high frequency content in the motor causes sensor noise in the magnetic bearings that leads to disturbances for the bearing control. To alleviate these problems, a filter is used to present a more sinusoidal voltage to the motor/generator. However, the filter adds additional dynamics and phase lag to the motor system that can interfere with the performance of the current regulator. This paper will discuss the tuning methodology and results for the motor/generator current regulator and the impact of the filter on the control. Results at speeds up to 50,000 rpm are presented.

  4. Modeling the Spin Motor Current of the International Space Station's Control Moment Gyroscopes

    Science.gov (United States)

    Pereira, Miguel A.

    2008-01-01

    The International Space Station (ISS) attitude control is provided by two means: The Russian Segment uses thrusters and the U.S. Segment uses double-gimbaled control moment gyroscopes (CMG). CMGs are used as momentum exchange devices, providing non propulsive attitude control for the vehicle. The CMGs are very important for the ISS program because, first, they save propellant - which needs to be transferred to the Station in special cargo vehicles - and, second, they provide the microgravity environment on the Station - which is necessary for scientific experiments planned for the ISS mission. Since 2002, when one of the CMG on the ISS failed, all CMGs are closely monitored. High gimbal rates, vibration spikes, unusual variations of spin motor current and bearing temperatures are of great concern, since these parameters are the CMG health indicators. The telemetry analysis of these and some other CMG parameters is used to determine constrains and make changes to the CMGs operation on board. These CMG limitations, in turn, may limit the ISS attitude control capabilities and may be critical to ISS operation. Therefore, it is important to know whether the CMG parameter is nominal or out of family, and why. The goal of this project is to analyze an important CMG parameter - spin motor current. Some operational decisions are made now based on the spin motor current signatures. The spin motor current depends on gimbal rates, ISS rates, and spin bearing friction. The spin bearing friction in turn depends on the bearing temperatures, wheel rates, normal load - which is a function of gimbal and wheel rates - lubrication, etc. The first task of this project is to create a spin motor current mathematical model based on CMG dynamics model and the current knowledge on bearing friction in microgravity.

  5. Modeling the Spin Motor Current of the International Space Station's Control Moment Gyroscopes

    Science.gov (United States)

    Pereira, Miguel A.

    2008-01-01

    The International Space Station (ISS) attitude control is provided by two means: The Russian Segment uses thrusters and the U.S. Segment uses double-gimbaled control moment gyroscopes (CMG). CMGs are used as momentum exchange devices, providing non propulsive attitude control for the vehicle. The CMGs are very important for the ISS program because, first, they save propellant - which needs to be transferred to the Station in special cargo vehicles - and, second, they provide the microgravity environment on the Station - which is necessary for scientific experiments planned for the ISS mission. Since 2002, when one of the CMG on the ISS failed, all CMGs are closely monitored. High gimbal rates, vibration spikes, unusual variations of spin motor current and bearing temperatures are of great concern, since these parameters are the CMG health indicators. The telemetry analysis of these and some other CMG parameters is used to determine constrains and make changes to the CMGs operation on board. These CMG limitations, in turn, may limit the ISS attitude control capabilities and may be critical to ISS operation. Therefore, it is important to know whether the CMG parameter is nominal or out of family, and why. The goal of this project is to analyze an important CMG parameter - spin motor current. Some operational decisions are made now based on the spin motor current signatures. The spin motor current depends on gimbal rates, ISS rates, and spin bearing friction. The spin bearing friction in turn depends on the bearing temperatures, wheel rates, normal load - which is a function of gimbal and wheel rates - lubrication, etc. The first task of this project is to create a spin motor current mathematical model based on CMG dynamics model and the current knowledge on bearing friction in microgravity.

  6. Deregulated SLC2A1 Promotes Tumor Cell Proliferation and Metastasis in Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Shiyan Yan

    2015-07-01

    Full Text Available Gastric cancer (GC is one of the common reasons of cancer-related death with few biomarkers for diagnosis and prognosis. Solute carrier family 2 (facilitated glucose transporter member 1 protein SLC2A1, also known as glucose transporter type 1 (GLUT1, has been associated with tumor progression, metastasis, and poor prognosis in many human solid tumors. However, little is reported about its clinical significance and biological functions in GC. Here we observed a strong up-regulation of SLC2A1 in patients with GC and found that SLC2A1 was significantly correlated with depth of invasion and clinical stage. Additionally, over-expression of SLC2A1 in GC cells promotes cellular proliferation and metastasis in vitro and enhances tumor growth in vivo as well as enhancement of glucose utilization. Meanwhile, elevated SLC2A1 also contributes to tumor metastasis in vitro. Our results indicate SLC2A1 exhibits a pivotal role in tumor growth, metastasis and glucose metabolism, and also suggest SLC2A1 as a promising target for gastric cancer therapy.

  7. Hartnup disorder: polymorphisms identified in the neutral amino acid transporter SLC1A5.

    Science.gov (United States)

    Potter, S J; Lu, A; Wilcken, B; Green, K; Rasko, J E J

    2002-10-01

    Hartnup disorder is an inborn error of renal and gastrointestinal neutral amino acid transport. The cloning and functional characterization of the 'system B0' neutral amino acid transporter SLC1A5 led to it being proposed as a candidate gene for Hartnup disorder. Linkage analysis performed at 19q13.3, the chromosomal position of SLC1A5, was suggestive of an association with the Hartnup phenotype in some families. However, SLC1A5 was not linked to the Hartnup phenotype in other families. Linkage analysis also excluded an alternative candidate region at 11q13 implicated by a putative mouse model for Hartnup disorder. Sequencing of the coding region of SLC1A5 in Hartnup patients revealed two coding region polymorphisms. These mutations did not alter the predicted amino acid sequence of SLC1A5 and were considered unlikely to play a role in Hartnup disorder. There were no mutations in splice sites flanking each exon. Quantitative RT-PCR of SLC1A5 messenger RNA in affected and unaffected subjects did not support systemic differences in expression as an explanation for Hartnup disorder. In the six unrelated Hartnup pedigrees studied, examination of linkage at 19q13.3, polymorphisms in the coding sequence and quantitation of expression of SLC1A5 did not suffice to explain the defect in neutral amino acid transport.

  8. Improved PHIP polarization using a precision, low noise, voltage controlled current source

    Science.gov (United States)

    Agraz, Jose; Grunfeld, Alexander; Cunningham, Karl; Li, Debiao; Wagner, Shawn

    2013-10-01

    Existing para-hydrogen induced polarization (PHIP) instrumentation relies on magnetic fields to hyperpolarize substances. These hyperpolarized substances have enhanced magnetic resonance imaging (MRI) signals over 10,000 fold, allowing for MRI at the molecular level. Required magnetic fields are generated by energizing a solenoid coil with current produced by a voltage controlled voltage source (VCVS), also known as a power supply. A VCVS lacks the current regulation necessary to keep magnetic field fluctuations to a minimum, which results in low PHIP polarization. A voltage controlled current source (VCCS) is an electric circuit that generates a steady flow of electrons proportional to an input voltage. A low noise VCCS provides the solenoid current flow regulation necessary to generate a stable static magnetic field (Bo). We discuss the design and implementation of a low noise, high stability, VCCS for magnetic field generation with minimum variations. We show that a precision, low noise, voltage reference driving a metal oxide semiconductor field effect transistor (MOSFET) based current sink, results in the current flow control necessary for generating a low noise and high stability Bo. In addition, this work: (1) compares current stability for ideal VCVS and VCCS models using transfer functions (TF), (2) develops our VCCS design's TF, (3) measures our VCCS design's thermal & 1/f noise, and (4) measures and compares hydroxyethyl-propionate (HEP) polarization obtained using a VCVS and our VCCS. The hyperpolarization of HEP was done using a PHIP instrument developed in our lab. Using our VCCS design, HEP polarization magnitude data show a statistically significant increase in polarization over using a VCVS. Circuit schematic, bill of materials, board layout, TF derivation, and Matlab simulations code are included as supplemental files.

  9. Improved PHIP polarization using a precision, low noise, voltage controlled current source.

    Science.gov (United States)

    Agraz, Jose; Grunfeld, Alexander; Cunningham, Karl; Li, Debiao; Wagner, Shawn

    2013-10-01

    Existing para-hydrogen induced polarization (PHIP) instrumentation relies on magnetic fields to hyperpolarize substances. These hyperpolarized substances have enhanced magnetic resonance imaging (MRI) signals over 10,000 fold, allowing for MRI at the molecular level. Required magnetic fields are generated by energizing a solenoid coil with current produced by a voltage controlled voltage source (VCVS), also known as a power supply. A VCVS lacks the current regulation necessary to keep magnetic field fluctuations to a minimum, which results in low PHIP polarization. A voltage controlled current source (VCCS) is an electric circuit that generates a steady flow of electrons proportional to an input voltage. A low noise VCCS provides the solenoid current flow regulation necessary to generate a stable static magnetic field (Bo). We discuss the design and implementation of a low noise, high stability, VCCS for magnetic field generation with minimum variations. We show that a precision, low noise, voltage reference driving a metal oxide semiconductor field effect transistor (MOSFET) based current sink, results in the current flow control necessary for generating a low noise and high stability Bo. In addition, this work: (1) compares current stability for ideal VCVS and VCCS models using transfer functions (TF), (2) develops our VCCS design's TF, (3) measures our VCCS design's thermal & 1/f noise, and (4) measures and compares hydroxyethyl-propionate (HEP) polarization obtained using a VCVS and our VCCS. The hyperpolarization of HEP was done using a PHIP instrument developed in our lab. Using our VCCS design, HEP polarization magnitude data show a statistically significant increase in polarization over using a VCVS. Circuit schematic, bill of materials, board layout, TF derivation, and Matlab simulations code are included as supplemental files.

  10. Joule heating of the ITER TF cold structure: Effects of vertical control coil currents and ELMS

    Energy Technology Data Exchange (ETDEWEB)

    Radovinsky, A.; Pillsbury, R.D. Jr.

    1993-11-09

    The toroidal field coil and support structures for ITER are maintained at cryogenic temperatures. The time-varying currents in the poloidal field coil system will induce eddy currents in these structures. The associated Joule dissipation will cause local heating and require heat removal which will show up as a load on the cryogenic system. Studies of Joule heating of the ITER TF cold structure (TFCS) due to the currents in the poloidal field coil system are presented. The two regimes considered in this study are the plasma vertical stability control and the Edge Loss Mode (ELM) events. The 3-D, thin-shell, eddy current program, EDDYCUFF was used to analyze the eddy currents and Joule losses in the cold structure. The current versus time scenarios were defined. Four control coil options were studied. All schemes use coils external to the TF cold structure. Analyses of power depositions during the plasma vertical stability control were performed for each of the four options. For each of these options three different recovery times were assumed. The times were 3, 1, and 1/3 seconds. Sets of four sequential ELMs, as well as isolated ELMs have been studied for various sets of active PF coils. The results showed that the lowest average power dissipation in the TF cold structure occurs when a subset of PF2 and PF7 are active, and all the other PF coils are passive. The general conclusion is that to minimize power dissipation in the TF cold structure it is preferable that only coils PF2 and PF7 are active. The other coils (PF3-PF6) should be passive and driven by a condition of constant flux. It is recommended in particular, that coils PF3 and PF5 be allowed to change currents to conserve flux, since they provide the maximum shielding of the TFCS from the fields caused by the active coils.

  11. A Galvanostatic Modeling for Preparation of Electrodeposited Nanocrystalline Coatings by Control of Current Density

    Institute of Scientific and Technical Information of China (English)

    Ali Mohammad Rashidi

    2012-01-01

    The correlation between the grain size of electrodeposited coatings and the current densities was modeled by considering galvanostatic conditions. In order to test the model by experimental results, nanocrystalline (NC) nickel samples were deposited at different current densities using a Watts bath. The grain size of the deposits was evaluated by X-ray diffraction (XRD) technique. Model predictions were validated by finding a curve being the best-fit to the experimental results which were gathered from literature for different NC coatings in addition to those data measured in this research for NC nickel coatings. According to our model, the variation of grain size with the reciprocal of the current density follows a power law. A good agreement between the experimental results and model predictions was observed which indicated that the derived analytical model is applicable for producting the nanocrystalline electrodeposits with the desired grain size by controling current density.

  12. An inductance Fourier decomposition-based current-hysteresis control strategy for switched reluctance motors

    Science.gov (United States)

    Hua, Wei; Qi, Ji; Jia, Meng

    2017-05-01

    Switched reluctance machines (SRMs) have attracted extensive attentions due to the inherent advantages, including simple and robust structure, low cost, excellent fault-tolerance and wide speed range, etc. However, one of the bottlenecks limiting the SRMs for further applications is its unfavorable torque ripple, and consequently noise and vibration due to the unique doubly-salient structure and pulse-current-based power supply method. In this paper, an inductance Fourier decomposition-based current-hysteresis-control (IFD-CHC) strategy is proposed to reduce torque ripple of SRMs. After obtaining a nonlinear inductance-current-position model based Fourier decomposition, reference currents can be calculated by reference torque and the derived inductance model. Both the simulations and experimental results confirm the effectiveness of the proposed strategy.

  13. Over-limiting Current and Control of Dendritic Growth by Surface Conduction in Nanopores

    CERN Document Server

    Han, Ji-Hyung; Bai, Peng; Bazant, Martin Z

    2014-01-01

    Understanding over-limiting current (faster than diffusion) is a long-standing challenge in electrochemistry with applications in desalination and energy storage. Known mechanisms involve either chemical or hydrodynamic instabilities in unconfined electrolytes. Here, it is shown that over-limiting current can be sustained by surface conduction in nano pores, without any such instabilities, and used to control dendritic growth during electrodeposition. Copper electrode posits are grown in anodized aluminum oxide membranes with polyelectrolyte coatings to modify the surface charge. At low currents, uniform electroplating occurs, unaffected by surface modification due to thin electric double layers, but the morphology changes dramatically above the limiting current. With negative surface charge, growth is enhanced along the nanopore surfaces, forming surface dendrites and nanotubes behind a deionization shock. With positive surface charge, dendrites avoid the surfaces and are either guided along the nanopore cen...

  14. A Current-mode Electronically Controllable Multifunction Biquadratic Filter Using CCCIIs

    Directory of Open Access Journals (Sweden)

    MONTREE SIRIPRUCHYANUN

    2013-03-01

    Full Text Available This article presents a current-mode multifunction biquadratic filter performing completely standard functions low-pass, high-pass, band-pass, band-reject and all-pass functions. The circuit principle is based on second-generation current-controlled current conveyor (CCCII with three input terminals and one output terminal. The features of the circuit are that, the pole frequency can be electronically tuned via the input bias currents. The circuit topology is very simple, consisting of merely 2 CCCIIs and 2 grounded capacitors. Without any external resistor and using only grounded elements, the proposed circuit is very comfortable to further develop into an integrated circuit architecture. The PSpice simulation results are shown. The given results agree well with the theoretical anticipation. The total power consumption is approximately 1.87mW at ±1.5V power supply voltages.

  15. Plasma Charge Current for Controlling and Monitoring Electron Beam Welding with Beam Oscillation

    Directory of Open Access Journals (Sweden)

    Valeriy Shchavlev

    2012-12-01

    Full Text Available Electron beam welding (EBW shows certain problems with the control of focus regime. The electron beam focus can be controlled in electron-beam welding based on the parameters of a secondary signal. In this case, the parameters like secondary emissions and focus coil current have extreme relationships. There are two values of focus coil current which provide equal value signal parameters. Therefore, adaptive systems of electron beam focus control use low-frequency scanning of focus, which substantially limits the operation speed of these systems and has a negative effect on weld joint quality. The purpose of this study is to develop a method for operational control of the electron beam focus during welding in the deep penetration mode. The method uses the plasma charge current signal as an additional informational parameter. This parameter allows identification of the electron beam focus regime in electron-beam welding without application of additional low-frequency scanning of focus. It can be used for working out operational electron beam control methods focusing exactly on the welding. In addition, use of this parameter allows one to observe the shape of the keyhole during the welding process.

  16. Plasma charge current for controlling and monitoring electron beam welding with beam oscillation.

    Science.gov (United States)

    Trushnikov, Dmitriy; Belenkiy, Vladimir; Shchavlev, Valeriy; Piskunov, Anatoliy; Abdullin, Aleksandr; Mladenov, Georgy

    2012-12-14

    Electron beam welding (EBW) shows certain problems with the control of focus regime. The electron beam focus can be controlled in electron-beam welding based on the parameters of a secondary signal. In this case, the parameters like secondary emissions and focus coil current have extreme relationships. There are two values of focus coil current which provide equal value signal parameters. Therefore, adaptive systems of electron beam focus control use low-frequency scanning of focus, which substantially limits the operation speed of these systems and has a negative effect on weld joint quality. The purpose of this study is to develop a method for operational control of the electron beam focus during welding in the deep penetration mode. The method uses the plasma charge current signal as an additional informational parameter. This parameter allows identification of the electron beam focus regime in electron-beam welding without application of additional low-frequency scanning of focus. It can be used for working out operational electron beam control methods focusing exactly on the welding. In addition, use of this parameter allows one to observe the shape of the keyhole during the welding process.

  17. Smart monitoring system based on adaptive current control for superconducting cable test

    Energy Technology Data Exchange (ETDEWEB)

    Arpaia, Pasquale [Department of Electrical Engineering and Information Technology, University of Naples Federico II, 80125 Napoli (Italy); Technology Department, European Organization for Nuclear Research (CERN), 1217 Geneva (Switzerland); Ballarino, Amalia; Montenero, Giuseppe [Technology Department, European Organization for Nuclear Research (CERN), 1217 Geneva (Switzerland); Daponte, Vincenzo [Technology Department, European Organization for Nuclear Research (CERN), 1217 Geneva (Switzerland); Department of Electronics, Information, and Bioengineering, Polytechnic of Milan, 20133 Milano (Italy); Svelto, Cesare [Department of Electronics, Information, and Bioengineering, Polytechnic of Milan, 20133 Milano (Italy)

    2014-12-15

    A smart monitoring system for superconducting cable test is proposed with an adaptive current control of a superconducting transformer secondary. The design, based on Fuzzy Gain Scheduling, allows the controller parameters to adapt continuously, and finely, to the working variations arising from transformer nonlinear dynamics. The control system is integrated in a fully digital control loop, with all the related benefits, i.e., high noise rejection, ease of implementation/modification, and so on. In particular, an accurate model of the system, controlled by a Fuzzy Gain Scheduler of the superconducting transformer, was achieved by an experimental campaign through the working domain at several current ramp rates. The model performance was characterized by simulation, under all the main operating conditions, in order to guide the controller design. Finally, the proposed monitoring system was experimentally validated at European Organization for Nuclear Research (CERN) in comparison to the state-of-the-art control system [P. Arpaia, L. Bottura, G. Montenero, and S. Le Naour, “Performance improvement of a measurement station for superconducting cable test,” Rev. Sci. Instrum.83, 095111 (2012)] of the Facility for the Research on Superconducting Cables, achieving a significant performance improvement: a reduction in the system overshoot by 50%, with a related attenuation of the corresponding dynamic residual error (both absolute and RMS) up to 52%.

  18. DSP Based Control Implementation of an AC/DC Converter with Improved Input Current Distortion

    Directory of Open Access Journals (Sweden)

    WISUTMETHEEKORN, P.

    2011-05-01

    Full Text Available This paper presents a digital signal processor based control of an AC/DC converter with nearly unity power factor. Normally, the output voltage of a single-phase AC/DC converter comprises a voltage ripple with twice line-frequency. This affects the voltage control loop and leads to the converter input current distortion. The purposed method is designed to avoid the effect of the output voltage ripple. To verify the proposed control method, MATLAB/Simulink is used for system simulation. A hardware prototype is setup. A low cost digital signal processing chip dsPIC30F4011 is employed as a digital controller to control a CUK AC/DC converter. The converter specifications are 48V output voltage and 250W output power. From the simulation and the experimental results shown that the input current distortion of the purposed system is reduced and lower than the AC/DC converter that controlled by the conventional proportional-integral controller.

  19. Smart monitoring system based on adaptive current control for superconducting cable test.

    Science.gov (United States)

    Arpaia, Pasquale; Ballarino, Amalia; Daponte, Vincenzo; Montenero, Giuseppe; Svelto, Cesare

    2014-12-01

    A smart monitoring system for superconducting cable test is proposed with an adaptive current control of a superconducting transformer secondary. The design, based on Fuzzy Gain Scheduling, allows the controller parameters to adapt continuously, and finely, to the working variations arising from transformer nonlinear dynamics. The control system is integrated in a fully digital control loop, with all the related benefits, i.e., high noise rejection, ease of implementation/modification, and so on. In particular, an accurate model of the system, controlled by a Fuzzy Gain Scheduler of the superconducting transformer, was achieved by an experimental campaign through the working domain at several current ramp rates. The model performance was characterized by simulation, under all the main operating conditions, in order to guide the controller design. Finally, the proposed monitoring system was experimentally validated at European Organization for Nuclear Research (CERN) in comparison to the state-of-the-art control system [P. Arpaia, L. Bottura, G. Montenero, and S. Le Naour, "Performance improvement of a measurement station for superconducting cable test," Rev. Sci. Instrum. 83, 095111 (2012)] of the Facility for the Research on Superconducting Cables, achieving a significant performance improvement: a reduction in the system overshoot by 50%, with a related attenuation of the corresponding dynamic residual error (both absolute and RMS) up to 52%.

  20. Vitamin D3 transactivates the zinc and manganese transporter SLC30A10 via the Vitamin D receptor.

    Science.gov (United States)

    Claro da Silva, Tatiana; Hiller, Christian; Gai, Zhibo; Kullak-Ublick, Gerd A

    2016-10-01

    Vitamin D3 regulates genes critical for human health and its deficiency is associated with an increased risk for osteoporosis, cancer, diabetes, multiple sclerosis, hypertension, inflammatory and immunological diseases. To study the impact of vitamin D3 on genes relevant for the transport and metabolism of nutrients and drugs, we employed next-generation sequencing (NGS) and analyzed global gene expression of the human-derived Caco-2 cell line treated with 500nM vitamin D3. Genes involved in neuropeptide signaling, inflammation, cell adhesion and morphogenesis were differentially expressed. Notably, genes implicated in zinc, manganese and iron homeostasis were largely increased by vitamin D3 treatment. An ∼10-fold increase in ceruloplasmin and ∼4-fold increase in haptoglobin gene expression suggested a possible association between vitamin D and iron homeostasis. SLC30A10, the gene encoding the zinc and manganese transporter ZnT10, was the chiefly affected transporter, with ∼15-fold increase in expression. SLC30A10 is critical for zinc and manganese homeostasis and mutations in this gene, resulting in impaired ZnT10 function or expression, cause manganese intoxication, with Parkinson-like symptoms. Our NGS results were validated by real-time PCR in Caco-2 cells, as well as in duodenal biopsies taken from healthy human subjects treated with 0.5μg vitamin D3 daily for 10 days. In addition to increasing gene expression of SLC30A10 and the positive control TRPV6, vitamin D3 also increased ZnT10 protein expression, as indicated by Western blot and cytofluorescence. In silico identification of potential vitamin D responsive elements (VDREs) in the 5'-flanking region of the SLC30A10 promoter and dual-luciferase reporter assay showed enhanced promoter activity in the presence of vitamin D receptor (VDR) and retinoid X receptor (RXR) constructs, as well as vitamin D3, but not when one of these factors was absent. Electrophoretic mobility shift assay (EMSA) and