Gratieri, Taís; Kalia, Yogeshvar N
2013-02-01
The architecture and composition of the stratum corneum make it a particularly effective barrier against the topical and transdermal delivery of hydrophilic molecules and ions. As a result, different strategies have been explored in order to expand the range of therapeutic agents that can be administered by this route. Iontophoresis involves the application of a small electric potential to increase transport into and across the skin. Since current flow is preferentially via transport pathways with at least some aqueous character, it is ideal for hydrosoluble molecules containing ionisable groups. Hence, the physicochemical properties that limit partitioning and passive diffusion through the intercellular lipid matrix are beneficial for electrically-assisted delivery. The presence of fixed ionisable groups in the skin (pI 4-4.5) means that application of the electric field results in a convective solvent flow (i.e., electroosmosis) in the direction of ion motion so as to neutralise membrane charge. Hence, under physiological conditions, cation electrotransport is due to both electromigration and electroosmosis-their relative contribution depends on the formulation conditions and the physicochemical properties of the permeant. Different mathematical models have been developed to provide a theoretical framework in order to explain iontophoretic transport kinetics. They usually involve solutions of the Nernst-Planck equation - using either the constant field (Goldman) or electroneutrality (Nernst) approximations - with or without terms for the convective solvent flow component. Investigations have also attempted to elucidate the nature of ion transport pathways and to explain the effect of current application on the electrical properties of the skin-more specifically, the stratum corneum. These studies have led to the development of different equivalent circuit models. These range from simple parallel arrangements of a resistor and a capacitor to the inclusion of the
Fang, J Y; Wang, R J; Huang, Y B; Wu, P C; Tsai, Y H
2001-04-01
The aim of this present study was to investigate the in vitro transdermal iontophoretic delivery of three diclofenac salts--diclofenac sodium (DFS), diclofenac potassium (DFP), and diclofenac diethylammonium (DFD). A series of physicochemical and electrical variables which might affect iontophoretic permeation of diclofenac salts was studied. Application of 0.3 mA/cm2 current density significantly increased the transdermal flux of diclofenac salts as compared to passive transport. The iontophoretic enhancement increased in the order of DFS>DFP>DFD. The permeability coefficient of diclofenac salts all decreased with increasing donor concentration during iontophoresis. The addition of buffer ions and salt ions such as NaCl, KCl, and C4H12ClN reduced the permeation of diclofenac salts due to competition. However, this effect was lesser for DFD than for DFS and DFP. Comparing the various application modes of iontophoresis, the discontinuous on/off mode showed lower but more constant flux than the continuous mode.
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
AC/DC current ratio in a current superimposition variable flux reluctance machine
Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki
2018-05-01
We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Reducing AC-Winding Losses in High-Current High-Power Inductors
DEFF Research Database (Denmark)
Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.
2009-01-01
Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...
Passive and iontophoretic delivery of three diclofenac salts across various skin types.
Fang, J; Wang, R; Huang, Y; Wu, P C; Tsai, Y
2000-11-01
The in vitro permeation of three diclofenac salts--diclofenac sodium (DFS), diclofenac potassium (DFP) and diclofenac diethylammonium (DFD)-across skin by both passive and iontophoretic transport were investigated. Various skin types were used as the barriers to elucidate the mechanism controlling transdermal delivery of diclofenac salts. The importance of the intercellular (paracellular) route for both DFS and DFP in passive permeation was elucidated. The transfollicular route constitutes an important permeation pathway for DFS but not for DFP. The route and mechanism for transdermal iontophoresis of DFD across the skin was somewhat different to that of the other salts. Hair follicles may be a more important pathway for DFD than for DFS and DFP under iontophoresis, while the intercellular lipid pathway showed the opposite result. Combination of iontophoresis and a penetration enhancer, cardamom oil, did not show a synergistic effect on diclofenac salt permeation. The results of this investigation suggest that the transdermal mechanism and the route of diclofenac salt uptake via passive and iontophoretic transport can be affected by their counterions.
Iontophoretic transdermal drug delivery: a multi-layered approach.
Pontrelli, Giuseppe; Lauricella, Marco; Ferreira, José A; Pena, Gonçalo
2017-12-11
We present a multi-layer mathematical model to describe the transdermal drug release from an iontophoretic system. The Nernst-Planck equation describes the basic convection-diffusion process, with the electric potential obtained by solving the Laplace's equation. These equations are complemented with suitable interface and boundary conditions in a multi-domain. The stability of the mathematical problem is discussed in different scenarios and a finite-difference method is used to solve the coupled system. Numerical experiments are included to illustrate the drug dynamics under different conditions. © The authors 2016. Published by Oxford University Press on behalf of the Institute of Mathematics and its Applications. All rights reserved.
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
Patient considerations in the use of transdermal iontophoretic fentanyl for acute postoperative pain
Directory of Open Access Journals (Sweden)
Hartrick CT
2016-04-01
Full Text Available Craig T Hartrick,1 Cecile R Pestano,1 Li Ding,2 Hassan Danesi,2 James B Jones,2 1Beaumont Health System, Troy, MI, 2The Medicines Company, Parsippany, NJ, USA Abstract: Opioids are commonly used in the management of moderate-to-severe postoperative pain. Patient-controlled analgesic techniques are recognized as preferred administration methods. Previously, research has focused on intravenously administered opioids via a programmable pump. More recently, an iontophoretic transdermal system (ITS, which is patient controlled, has been developed. The focus of this review is on pain management using the fentanyl ITS during the 24–72-hour time period immediately following surgery. Fentanyl ITS offers a needle-free alternative to traditional intravenous (IV patient-controlled analgesia (PCA system that is as effective and safe as IV PCA. This system is easy to use for both patients and nurses. The use of fentanyl ITS is generally associated with a better ease-of-care profile, including a greater ease of mobility, from a patients' perspective when compared with morphine IV PCA. Keywords: patient-controlled analgesia, fentanyl iontophoretic transdermal system, ease of care, mobility, patient perspective, review
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
Del Río-Sancho, S; Serna-Jiménez, C E; Sebastián-Morelló, M; Calatayud-Pascual, M A; Balaguer-Fernández, C; Femenía-Font, A; Kalia, Y N; Merino, V; López-Castellano, A
2017-01-30
Memantine is a non-competitive N-methyl-d-aspartate (NMDA) receptor antagonist used in the treatment of moderate to severe dementia including the symptoms of Alzheimer's disease (AD). It is administered orally but compliance, swallowing problems and the routine use of multiple medications in elderly AD patients means that an alternative route of administration would be of interest. The aim of the present study was to develop memantine hydrochloride occlusive transdermal therapeutic systems (TTS) for passive and iontophoretic delivery across the skin. Polyvinyl pyrrolidone (PVP) and a mixture with polyvinyl alcohol (PVA) were employed as polymeric matrices. The study involved the TTS characterization in addition to quantification of the memantine transport across porcine skin in vitro. The evaluation of the TTS physical properties suggested that systems were made more mechanically resistant by including PVA (6%) or high concentrations of PVP (24%). Moreover, a linear correlation was observed between the concentration of PVP and the bioadhesion of the systems. Drug delivery experiments showed that the highest transdermal flux provided by a passive TTS (PVP 24% w/w limonene) was 8.89±0.81μgcm -2 h -1 whereas the highest iontophoretic transport was 46.4±3.6μgcm -2 h -1 . These innovative TTS would enable two dosage regimens that could lead to therapeutic plasma concentrations. Copyright © 2016 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.
2011-01-01
The single-layer coils with a diameter of 250 mm and 12 turns were manufactured with YBCO tapes with a CuNi- or Cu-Tape. The AC over-current tests were carried out in subcooled liquid nitrogen at 66 K and 74 K to develop power transformers with current limiting function. The AC over-current was two to seven times larger than the I c of conductor and it was reduced to the same level of I c . The I c of model coils did not degrade. The test results showed the possibility of YBCO superconducting transformers with current limiting function. We are developing elemental technology for 66 kV/6.9 kV 20 MVA-class YBCO power transformer. The YBCO transformer is considered to have a possibility to stabilize the power system by improving function of fault current limiting. Current limiting behavior functions over critical current flows. There is a possibility that superconducting characteristic may be damaged due to increase in temperature of YBCO tapes. Therefore, we have taken a measure to combine YBCO tape with CuNi tape or Cu Tape. We manufactured model coils using these conductors and conducted the AC over-current tests. The test current was two to seven times larger than the I c of conductor and it was damped with time from its maximum value according to the generation of conductor resistance. We verified the effectiveness of current limiting characteristics. In these tests, the I c of model coil did not degrade. We consider this conductor to be able to withstand AC over-current with the function of current limiting.
Accounting for Dark Current Accumulated during Readout of Hubble's ACS/WFC Detectors
Ryon, Jenna E.; Grogin, Norman A.; Coe, Dan A.; ACS Team
2018-06-01
We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We develop a method to estimate the readout dark noise properties in ACS/WFC observations. We update the error (ERR) extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. In recent data, this amounts to about 5 e-/pixel added variance in the rows farthest from the WFC serial registers, and about 7 to 30 e-/pixel added variance along the stable hot columns. We also flag unstable hot columns in the superbias data quality (DQ) extensions. The new reference file pipeline for ACS/WFC implements these updates to our superbias creation process.
Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2017-11-01
Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.
n value and Jc distribution dependence of AC transport current losses in HTS conductors
International Nuclear Information System (INIS)
Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke
2004-01-01
Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
International Nuclear Information System (INIS)
Miyagi, D.; Amadutsumi, Y.; Takahashi, N.; Tsukamoto, O.
2007-01-01
AC transport current losses of coated conductors with ferromagnetic substrates are higher than the loss calculated by the Norris equation. In order to reduce the AC transport current loss we propose in this paper a structure of the coated conductor that has wider substrate than the SC (Superconducting) layer. The current distribution and AC loss of the proposed model are analyzed by means of FEM. The AC transport current loss is reduced due to the change of current density distribution near the edge of SC layer, consequent to the high value of magnetic permeability of the ferromagnetic substrate, that is wider than the SC layer
DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview
Directory of Open Access Journals (Sweden)
Anil K. Rai
2015-08-01
Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control
International comparison of AC-DC current transfer standards
Heine, G.; Garcocz, M.; Waldmann, W.
2017-01-01
The measurements of the international comparison of ac-dc current transfer standards identified as EURAMET.EM-K12 started in June 2012 and were completed in December 2014. Twenty NMIs in the EURAMET region and one NMI in the AFRIMET region took part: BEV (Austria), CMI (Czech Republic), PTB (Germany), METAS (Switzerland), JV (Norway), UME (Turkey), GUM (Poland), IPQ (Portugal), CEM (Spain), INRIM (Italy), SP (Sweden), DANIAmet-MI-Trescal (Denmark), BIM (Bulgaria), MKEH (Hungary), SIQ (Slovenia), LNE (France), NSAI NML (Ireland), VSL (The Netherlands), NPL (United Kingdom), Metrosert (Estonia), NIS (Egypt). The comparison was proposed to link the National Metrology Institutes organised in EURAMET to the key comparison CCEM-K12. The ac-dc current transfer difference of each travelling standard had been measured at its nominal current 10 mA and 5 A at the following frequencies: 10 Hz, 55 Hz, 1 kHz, 10 kHz, 20 kHz, 50 kHz, 100 kHz. The test points were selected to link the results with the equivalent CCEM Key Comparison (CCEM-K12), through five NMIs participating in both EURAMET and CCEM key comparisons (PTB, JV, NPL, SP and BEV). The report shows the degree of equivalence in the EURAMET region and also the degree of equivalence with the corresponding CCEM reference value. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).
International Nuclear Information System (INIS)
Polak, M.; Jansak, L.
2000-01-01
We experimentally studied the effects of a single artificial defect and a linear array of artificial defects on I-V curves, critical currents and transport current ac losses of 55 filament untwisted Bi-2223/Ag tapes. The artificial defect was a small hole drilled into the tape. The reduction in the critical current measured on a 1 cm long section due to one hole of diameter 0.9 mm was 33% and that due to a linear array of seven similar holes was 62%. The slopes of the I-V curves, n, measured in this section were 33, 16 and 5.8 in the original sample, in the sample with one defect and the sample with seven defects, respectively. Both I c and the slope reduction were smaller if the distance between the potential taps was increased. The transport current ac losses at 50 Hz and I rms = 10 A in the sample with one defect measured in a 1 cm long section were practically the same as those in the original sample (4.1x10 -4 W m -1 ), but they increased by 83% in the sample with a linear array of seven defects. The measured increase in losses per unit length was the smaller, the larger the distance between the potential taps. A comparison between the measured and calculated losses revealed that a formal application of the Norris equations for loss calculations in samples with local defects leads to an overestimation of the ac losses. A procedure for the calculation of transport current losses in samples with local defects based on the Norris model is proposed and verified. (author)
Current Control of Grid Converters Connected with Series AC Capacitor
DEFF Research Database (Denmark)
Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang
2015-01-01
The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...... this paper proposes a fourth-order resonant controller in the stationary frame, which guarantees a zero steady-state current tracking error for the grid converters with series LC filter. This method is then implemented in a three-phase experimental system for verification, where the current harmonics below...... the LC filter resonance frequency are effectively eliminated. Experimental results confirm the validity of the proposed current control scheme....
AC Transport Current Loss in a Coated Superconductor in the Bean Model
National Research Council Canada - National Science Library
Carr, Jr, W. J
2004-01-01
A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...
Study of plasma equilibrium during the AC current reversal phase in STOR-M
International Nuclear Information System (INIS)
Xiao, C.
2002-01-01
Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)
DEFF Research Database (Denmark)
Li, Xiao-Fen; Grivel, Jean-Claude; Abrahamsen, Asger B.
2012-01-01
We have numerically proved that the dependence of AC susceptibility χ of a E(J) power law superconducting thin disc on many parameters can be reduced to one penetration parameter h, with E the electric field and J the current density. Based on this result, we propose a way of measuring the critical...... current density Jc of superconducting thin films by AC susceptibility. Compared with the normally used method based on the peak of the imaginary part, our method uses a much larger range of the AC susceptibility curve, thus allowing determination of the temperature (T) dependence of Jc from a normally...
Superconductive AC current limiter
International Nuclear Information System (INIS)
Bekhaled, M.
1987-01-01
This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate
AC losses in a type II superconductor strip with inhomogeneous critical current distribution
International Nuclear Information System (INIS)
Tsukamoto, Osami
2005-01-01
Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions
Pumping $ac$ Josephson current in the Single Molecular Magnets by spin nutation
Abdollahipour, B.; Abouie, J.; Rostami, A. A.
2012-01-01
We demonstrate that an {\\it ac} Josephson current is pumped through the Single Molecular Magnets (SMM) by the spin nutation. The spin nutation is generated by applying a time dependent magnetic field to the SMM. We obtain the flowing charge current through the junction by working in the tunneling limit and employing Green's function technique. At the resonance conditions some discontinuities and divergencies are appeared in the normal and Josephson currents, respectively. Such discontinuities...
Low field critical currents and ac losses of thin film niobium--tin superconductors
International Nuclear Information System (INIS)
Howard, R.E.
1977-01-01
The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model
Transcranial alternating current stimulation (tACS
Directory of Open Access Journals (Sweden)
Andrea eAntal
2013-06-01
Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process
International Nuclear Information System (INIS)
Suenaga, M.; Klamut, C.; Bussiere, J.F.
1976-01-01
The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables
Compensation methods applied in current control schemes for large AC drive systems
DEFF Research Database (Denmark)
Rus, D. C.; Preda, N. S.; Teodorescu, Remus
2012-01-01
The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...
Finite element modelling of electric currents in AC submerged arc furnaces
CSIR Research Space (South Africa)
Mc Dougall, I
2007-01-01
Full Text Available and the power ratings is not a hindrance. 2. MATHEMATICAL FORMULATION As the frequency of the current is low, the quasi-static form of Maxwell’s equations is solved. (1) (2) (3) (4) where E denotes the electric field intensity, H the magnetic field... of Electric Currents in AC Submerged Arc Furnaces 637 REFERENCES [1] Bermudez, A., Muniz, M.C., Pena, F. , Bullon, J., “ Numerical Computation of the Electromagnetic Field in the Electrodes of a Three-Phase Arc Furnace”, Int. Jnl for Numerical Methods...
International Nuclear Information System (INIS)
Alamgir, A.K.M.; Gu, C.; Han, Z.
2006-01-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance
Energy Technology Data Exchange (ETDEWEB)
Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2006-07-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.
Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors
Energy Technology Data Exchange (ETDEWEB)
Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)
1996-05-01
The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)
Schonberger, Robert B.; Worden, William S.; Shahmohammadi, Kaveh; Menn, Kirsten; Silverman, Tyler J.; Stout, Robert G.; Shelley, Kirk H.; Silverman, David G.
2007-01-01
Objective: Assessments of endothelial cell function with acetylcholine have typically used systemic, regional intra-arterial, or iontophoretic delivery of drug. Each of these techniques induces systemic and/or local changes that compromise their safety or effectiveness. Using translucent drug preparations applied under laser Doppler flowmetry (LDF) probes, we tested whether local vasodilation can be induced with non-iontophoretic transdermal delivery of acetylcholine and how such dilation would compare to the dilation achieved with topical nitroglycerin in healthy volunteers. Methods: Ten subjects without known vascular disease were recruited for LDF monitoring at sites of drug application for this preliminary investigation. Topical acetylcholine chloride, nitroglycerin, and placebo were applied via translucent patches to the forehead directly below LDF probes. Results: LDF readings increased by 406 percent (245 percent to 566 percent) and 36 percent (26 percent to 46 percent), respectively, at the acetylcholine and placebo sites (p = .005 by Wilcoxon Signed Rank Test (WSRT) for acetylcholine vs. placebo); and they increased by 365 percent (179 percent to 550 percent) at the nitroglycerin site (p = .005 by WSRT for nitroglycerin vs. placebo; p = .6 vs. acetylcholine). Conclusion: Transdermal delivery of acetylcholine can induce significant local vasodilatory responses comparable to those achieved with nitroglycerin without requiring iontophoresis. The means of transdermal delivery and monitoring described herein may constitute a new minimally invasive way to interrogate the microvasculature and thereby assess the microcirculatory changes induced by various disorders and therapeutic interventions. PMID:17876370
Nijhuis, Arend; ten Kate, Herman H.J.
1994-01-01
AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC
Complex state variable- and disturbance observer-based current controllers for AC drives
DEFF Research Database (Denmark)
Dal, Mehmet; Teodorescu, Remus; Blaabjerg, Frede
2013-01-01
In vector-controlled AC drives, the design of current controller is usually based on a machine model defined in synchronous frame coordinate, where the drive performance may be degraded by both the variation of the machine parameters and the cross-coupling between the d- and q-axes components...... of the stator current. In order to improve the current control performance an alternative current control strategy was proposed previously aiming to avoid the undesired cross-coupling and non-linearities between the state variables. These effects are assumed as disturbances arisen in the closed-loop path...... of the parameter and the cross-coupling effect. Moreover, it provides a better performance, smooth and low noisy operation with respect to the complex variable controller....
Energy Technology Data Exchange (ETDEWEB)
Litzenberger, Wayne; Lava, Val
1994-08-01
References are contained for HVDC systems, converter stations and components, overhead transmission lines, cable transmission, system design and operations, simulation of high voltage direct current systems, high-voltage direct current installations, and flexible AC transmission system (FACTS).
Directory of Open Access Journals (Sweden)
Toralf eNeuling
2012-09-01
Full Text Available Transcranial direct current stimulation (tDCS has been applied in numerous scientific studies over the past decade. However, the possibility to apply tDCS in therapy of neuropsychiatric disorders is still debated. While transcranial magnetic stimulation (TMS has been approved for treatment of major depression in the United States by the Food and Drug Administration (FDA, tDCS is not as widely accepted. One of the criticisms against tDCS is the lack of spatial specificity. Focality is limited by the electrode size (35 cm2 are commonly used and the bipolar arrangement. However, a current flow through the head directly from anode to cathode is an outdated view. Finite element (FE models have recently been used to predict the exact current flow during tDCS. These simulations have demonstrated that the current flow depends on tissue shape and conductivity. Toface the challenge to predict the location, magnitude and direction of the current flow induced by tDCS and transcranial alternating current stimulation (tACS, we used a refined realistic FE modeling approach. With respect to the literature on clinical tDCS and tACS, we analyzed two common setups for the location of the stimulation electrodes which target the frontal lobe and the occipital lobe, respectively. We compared lateral and medial electrode configuration with regard to theirusability. We were able to demonstrate that the lateral configurations yielded more focused stimulation areas as well as higher current intensities in the target areas. The high resolution of our simulation allows one to combine the modeled current flow with the knowledge of neuronal orientation to predict the consequences of tDCS and tACS. Our results not only offer a basis for a deeper understanding of the stimulation sites currently in use for clinical applications but also offer a better interpretation of observed effects.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
International Nuclear Information System (INIS)
Cha, Y.S.; Niemann, R.C.; Hull, J.R.; Youngdahl, C.A.; Lanagan, M.T.; Nakade, M.; Hara, T.
1995-06-01
Liquid helium boil-off experiments are conducted to determine the heat leakage rate of a pair of BSCCO 2223 high-temperature superconductor current leads made by sinter forging. The experiments are carried out in both DC and AC conditions and with and without an intermediate heat intercept. Current ranges are from 0-500 A for DC tests and 0-1,000 A rms for AC tests. The leads are self-cooled. Results show that magnetic hysteresis (AC) losses for both the BSCCO leads and the low-temperature superconductor current jumper are small for the current range. It is shown that significant reduction in heat leakage rate (liquid helium boil-off rate) is realized by using the BSCCO superconductor leads. At 100 A, the heat leakage rate of the BSCCO/copper binary lead is approximately 29% of that of the conventional copper lead. Further reduction in liquid helium boil-off rate can be achieved by using an intermediate heat intercept. For example, at 500 K, the heat leakage rate of the BSCCO/copper binary lead is only 7% of that of the conventional copper lead when an intermediate heat intercept is used
A Robust Suboptimal Current Control of an Interlink Converter for a Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Ismi Rosyiana Fitri
2018-05-01
Full Text Available A hybrid AC/DC microgrid is established with the aim of exploiting numerous types of renewable energy to meet the needs of different loads. The microgrid is decomposed by AC DC sub-grids which are connected by an interlink converter (IC. To maintain the security and reliability of the microgrid, an automatic controller for the interlink converter is needed. In this paper, we propose a Linear Matrix Inequalities (LMI-based current control method for the interlink converter. As the main features here, the interlink converter permits bidirectional power exchange between both sub-grids when a power–demand imbalance occurs in one sub-grid regardless of the converter system parameters. Simulations with various filter parameters are performed using the Matlab/Simulink software to validate the effectiveness of the proposed controller. In comparison with the existing Linear Quadratic Regulator (LQR-based current control, the proposed method is more robust against unknown system parameters and high load perturbation.
AC losses in superconductors: a multi-scale approach for the design of high current cables
International Nuclear Information System (INIS)
Escamez, Guillaume
2016-01-01
The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB_2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB_2 demonstrator [fr
Fractional Modeling of the AC Large-Signal Frequency Response in Magnetoresistive Current Sensors
Directory of Open Access Journals (Sweden)
Sergio Iván Ravelo Arias
2013-12-01
Full Text Available Fractional calculus is considered when derivatives and integrals of non-integer order are applied over a specific function. In the electrical and electronic domain, the transfer function dependence of a fractional filter not only by the filter order n, but additionally, of the fractional order α is an example of a great number of systems where its input-output behavior could be more exactly modeled by a fractional behavior. Following this aim, the present work shows the experimental ac large-signal frequency response of a family of electrical current sensors based in different spintronic conduction mechanisms. Using an ac characterization set-up the sensor transimpedance function is obtained considering it as the relationship between sensor output voltage and input sensing current,[PLEASE CHECK FORMULA IN THE PDF]. The study has been extended to various magnetoresistance sensors based in different technologies like anisotropic magnetoresistance (AMR, giant magnetoresistance (GMR, spin-valve (GMR-SV and tunnel magnetoresistance (TMR. The resulting modeling shows two predominant behaviors, the low-pass and the inverse low-pass with fractional index different from the classical integer response. The TMR technology with internal magnetization offers the best dynamic and sensitivity properties opening the way to develop actual industrial applications.
Experimental Study on the Influence of AC Stray Current on the Cathodic Protection of Buried Pipe
Directory of Open Access Journals (Sweden)
Qingmiao Ding
2016-01-01
Full Text Available The size of the damaged area of the coating and its position on the pipeline impacted the cathodic protection potential, and there was a damaged area of the greatest impact value. When damaged area was 300 mm2, the IR drop was the largest, and this situation could easily lead to inadequate protection; when the parallel spacing between pipeline and interference source was unchanged, the measured value curves of cathodic protection potential presented “U” shaped trend with the increasing stray current interference intensity. Under certain parallel spacing between pipeline and interference source, high alternating stray current intensity would cause serious negative offsets, so that the overprotection of the pipeline occurred, and make the coating crack; there was a parallel threshold length. When less than the threshold, the pipe-ground potential increases rapidly with the parallel length increasing. In order to judge whether a pipeline was interference by AC stray current and the risk of stray current corrosion, we should make a comprehensive analysis of the cathodic protection energizing potential, the switch-off potential, AC pipe-soil potential, IR drops, and so on.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
A MEMS AC current sensor for residential and commercial electricity end-use monitoring
International Nuclear Information System (INIS)
Leland, E S; Wright, P K; White, R M
2009-01-01
This paper presents a novel prototype MEMS sensor for alternating current designed for monitoring electricity end-use in residential and commercial environments. This new current sensor design is comprised of a piezoelectric MEMS cantilever with a permanent magnet mounted on the cantilever's free end. When placed near a wire carrying AC current, the magnet is driven sinusoidally, producing a voltage in the cantilever proportional to the current being measured. Analytical models were developed to predict the applicable magnetic forces and piezoelectric voltage output in order to guide the design of a sensor prototype. This paper also details the fabrication process for this sensor design. Released piezoelectric MEMS cantilevers have been fabricated using a four-mask process and aluminum nitride as the active piezoelectric material. Dispenser-printed microscale composite permanent magnets have been integrated, resulting in the first MEMS-scale prototypes of this current sensor design
Energy Technology Data Exchange (ETDEWEB)
Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)
2014-11-15
Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.
International Nuclear Information System (INIS)
Matsushita, Teruo; Yamafuji, Kaoru; Sakamoto, Nobuyoshi.
1977-01-01
In case of applying superconductors to electric machinery or high intensity field magnets for fusion reactors, the superconductors are generally expected to be sensible to small field fluctuation besides DC magnetic field. The behavior of superconductors in DC magnetic field superimposed with small AC magnetic field has been investigated often experimentally, and the result has been obtained that the critical current at which DC flow voltage begins to appear extremely decreased or disappeared. Some theoretical investigations have been carried out on this phenomenon so far, however, their application has been limited to the region where frequency is sufficiently low or which is close to the critical magnetic field. Purpose of this report is to deal with the phenomenon in more unified way by analyzing the behavior of magnetic flux lines in a superconductor under a superimposed small AC field using the criticalstate model including viscous force. In order to solve the fundamental equation in this report, first the solution has been obtained in the quasi-static state neglecting viscous force, then about the cases that current density J is not more than Jc and J is larger than Jc, concerning the deviation from the quasi-static limit by employing successive approximation. Current-voltage characteristics have been determined by utilizing the above results. This method seems to be most promising at present except the case of extremely high frequency. (Wakatsuki, Y.)
Khair, Ummul; Jabbar Lubis, Abdul; Agustha, Indra; Dharmawati; Zulfin, M.
2017-12-01
The current electricity needs is very primary, all objects including electronics require power, it encourages people not to be able to save electricity so the theft of electric power would be done. The use of ACS712 current sensor as the sensor with arduino uno would find out the power consumption continuously and prevent the theft of electricity because of the use of electricity which has been determined by PLN and the people fetl that it is not enough for every house, so the author made a tool for prevention of theft of electric power by using the arduino uno, buzzer, ACS712 current sensor, lcd, and relay then the power usage can be controlled according to the use to prevent the occurrence of theft of electricity so the use can be seen directly on the lcd 16x2and GSM modem to give information to employees of PLN so that it can reduceelectrical theft by the public.
DEFF Research Database (Denmark)
Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez
2017-01-01
This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid applicat......This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid......, and added into the conventional droop plus virtual impedance control. In the control architecture, the reference voltages of the inverters are generated by the primary control loop which consists of a droop control and a virtual impedance. The secondary control is used to compensate the voltage drop...
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Study of the mechanisms of flux enhancement through hairless mouse skin by pulsed DC iontophoresis
International Nuclear Information System (INIS)
Pikal, M.J.; Shah, S.
1991-01-01
Enhanced iontophoretic transport using pulsed DC is usually explained by citing the observed decrease in skin resistance caused by an increase in AC pulse frequency at very small currents. Alternately, it has been suggested that the on-to-off nature of pulsed DC imparts an impact energy to the fluid, thereby increasing transport. This report provides a test of these mechanisms for enhanced delivery via pulsed iontophoresis. The DC resistance of hairless mouse skin during continuous and pulsed DC iontophoresis is measured as a function of time for selected pulse frequencies and duty cycles using current densities ranging from 0.1 to 1.0 mA/cm2. As a test of the impact energy mechanism, the iontophoretic transport of 14C-glucose measured with pulsed DC is compared with similar data obtained previously using continuous DC. It is suggested that pulsed current can yield lower resistance and enhanced drug delivery provided that (a) the steady-state current during the on phase of the pulse is very small and (b) the frequency is low enough to allow depolarization of the skin during the off phase of the pulse. The glucose transport results suggest that the impact energy concept does not apply to iontophoresis
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Analysis of the ac SQUID with low inductance and low critical current
DEFF Research Database (Denmark)
Sørensen, O. H.
1976-01-01
The properties of the ac SQUID magnetometer has been analyzed. The results are valid in the low-inductance low-critical-current regime, where the Lri0 producted is belowthe value at which the relation between the enclosed and externally applied magnetic dc flux becomes reentrant. The effects...... of the screening current circulating in the SQUID ring as well as of the SQUID-ring time constant, tau-Lr/R9 are taken into account. Here LR IS THE SQUID-ring inductance, and R is the shunt resistance in the shunted junction model assumed to describe the weak link. It is shown that for finite values of omegatau...... constriuctively with the result that the optimal response occurs at a definite and finite value of omegatau. If omegatau is increased beyond this optimal value the weak link behavior is dominated by the Ohmic current channel implying that only if the shunt conductance contains a term depending...
Directory of Open Access Journals (Sweden)
Rui Li
2016-12-01
Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Joshi, Nitin; Lemke, John; Danesi, Hassan
2016-04-01
Fentanyl iontophoretic transdermal system (ITS) is a patient-controlled analgesia system used for the management of acute postoperative pain. The first-generation fentanyl ITS was an integrated one-piece system; however, corrosion that could limit reliability was detected in a small number of systems. A second-generation fentanyl ITS was designed to separate the hydrogels in the Drug Unit from the electronic circuit of the Controller during manufacture and storage, removing the primary cause of corrosion and thereby improving reliability. No evidence of corrosion has been observed in over 10,000 systems tested in real-time aging studies for the second generation fentanyl ITS. The second generation fentanyl ITS design features combine to ensure safe operation of the system with high reliability.
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Energy Technology Data Exchange (ETDEWEB)
Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-08-15
A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.
Energy Technology Data Exchange (ETDEWEB)
Liu, Qi [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Zhang, Guomin, E-mail: gmzhang@mail.iee.ac.cn [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yang, Hua [Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Li, Zhenming; Liu, Wei [China Electric Power Research Institute, Beijing 100192 (China); Jing, Liwei [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yu, Hui; Liu, Guole [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China)
2016-09-15
Highlights: • Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/ Ag tape with AC transport current was reported for the first time. • The measurement are performed as a function of different temperature (20 K–30 K), transport current (AC and DC) and operating frequency (50 Hz–250 Hz). • The study is concentrated on the research of quench development, and the discussions of NZPV and MQE values. - Abstract: In applications, superconducting wires may carry AC or DC transport current. Thus, it is important to understand the behavior of normal zone propagation in conductors and magnets under different current conditions in order to develop an effective quench protection system. In this paper, quench behavior of Ag sheathed Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2} (Sr-122 in the family of iron-based superconductor) tapes with AC and DC transport current is reported. The measurements are performed as a function of different temperature (20 K–30 K), varying transport current and operating frequency (50 Hz–250 Hz). The focus of the research is the minimum quench energy (MQE), the normal zone propagation velocity (NZPV) and the comparison of the related results with AC and DC transport current.
Hybrid superconducting a.c. current limiter extrapolation 63 kV-1 250 A
Tixador, P.; Levêque, J.; Brunet, Y.; Pham, V. D.
1994-04-01
Following the developement of a.c. superconducting wires a.c. current superconducting limiters have emerged. These limiters limit the fault currents nearly instantaneously, without detection nor order giver and may be suitable for high voltages. They are based on the natural transition from the superconducting state to the normal resistive state by overstepping the critical current of a superconducting coil which limits or triggers the limitation. Our limiter device consists essentially of two copper windings coupled through a saturable magnetic circuit and of a non inductively wound superconducting coil with a reduced current compared to the line current. This design allows a simple superconducting cable and reduced cryogenic losses but the dielectric stresses are high during faults. A small model (150 V/50 A) has experimentally validated our design. An industrial scale current limiter is designed and the comparisons between this design and other superconducting current limiters are given. Les courants de court-circuit sur les grands réseaux électriques ne cessent d'augmenter. Dans ce contexte sont apparus les limiteurs supraconducteurs de courant suite au développement des brins supraconducteurs alternatifs. Ces limiteurs peuvent limiter les courants de défaut presque instantanément, sans détection de défaut ni donneur d'ordre et ils sont extrapolables aux hautes tensions. Ils sont fondés sur la transition naturelle de l'état supraconducteur à l'état normal très résistif par dépassement du courant critique d'un enroulement supraconducteur qui limite ou déclenche la limitation. Notre limiteur est composé de deux enroulements en cuivre couplés par un circuit magnétique saturable et d'une bobine supraconductrice à courant réduit par rapport au courant de la ligne. Cette conception permet un câble supraconducteur simple et des pertes cryogéniques réduites mais les contraintes diélectriques en régime de défaut sont importantes. Une maquette
Efficacy of low level electric current (A-C) for controlling quagga mussles in the Welland Canal
Energy Technology Data Exchange (ETDEWEB)
Fears, C. [Delta Applied Technology, Inc., Pittsburgh, PA (United States); Mackie, G.L. [Water Systems Analysts, Guelph, Ontario (Canada)
1995-06-01
The efficacy of systems (for which patents are pending) which use low-voltage A-C currents for preventing settlement and attachment by zebra mussels were tested with steel rods and plates placed near the intake of a pulp and paper plant in the Welland Canal at Thorold, Ontario. Six racks made of 16 ft. (4.9 m), 2x4s (5.1 x 10.2 cm) were placed into the Welland Canal on August 5, 1994. One rack had 1/8th in (3.2 mm) diam x 12 in (30.5 cm) long steel rods, each separated by 2 in (5.1 cm) attached to pressure treated wood and concrete blocks and an A-C current of 16 v (or 8 v/in); rack 2 had steel rods of the same configuration but 12 v (or 6 v/in) was applied; rack 3 was identical to these but no current was applied and was used as a rod control. The remaining three racks had steel plates, each plate being 3 in (7.6 cm) wide X 24 in (61 cm) long X 1/4 in (6.4 mm) thick and separated by 2 in (5.1 cm); one had 12 v applied (or 6 v/in), another had 16 v applied (or 8 v/in), and the third had no current and was used as a plate control. The racks were placed on the upstream and downstream side of the intake at a depth of about 7 ft (2.1 m) where the mussels populations were heaviest (as determined by SCUBA diving). All mussels were quagga mussels (Dreissena bugensis). The racks were pulled in mid November after settlement was complete and the results showed: (1) complete prevention of settlement of both new recruits and translocators at 8 volts/in with steel rods on both wood and concrete surfaces and with steel plate trash bars; (2) partial prevention of settlement at 6 volts/in with steel rods on both wood and concrete surfaces and steel plates; and (3) that, at current kilowatt hr rates, total efficacy at 8 volts/in would cost approximately $10.80/day/1000 sq ft using rods to protect concrete walls and about $16.32/day/1000 sq ft to protect 3 in wide x 1/4 in thick trash bars. These costs can be reduced even further with pulse dosed AC currents.
A simulation of a multifilamentary wire carrying a transport current in an AC applied field
International Nuclear Information System (INIS)
Rem, P.C.; Hartmann, R.A.; Dijkstra, D.; Van Beckum, F.P.H.; Van de Klundert, L.J.M.
1986-01-01
The problem of calculating the current distribution in a multi-filamentary wire subjected to a time-dependent field becomes difficult as soon as the non-linearity due to the saturation of layers of filaments can be neglected no more. Such a problem can be solved approximately if the shape of the boundaries between unsaturated regions can be prescribed on the basis of general considerations such as symmetry arguments. For cases involving both a transport current and an applied field, however, little is known about the boundaries and their time-dependence behaviour. For such cases a brute force numerical calculation may provide an answer. The results presented below were calculated for a combination of DC transport current and AC applied field
Directory of Open Access Journals (Sweden)
Tal eSela
2012-02-01
Full Text Available The process of evaluating risks and benefits involves a complex neural network that includes the dorsolateral prefrontal cortex (DLPFC. It has been proposed that in conflict and reward situations, theta-band (4–8 Hz oscillatory activity in the frontal cortex may reflect an electrophysiological mechanism for coordinating neural networks monitoring behavior, as well as facilitating task-specific adaptive changes. The goal of the present study was to investigate the hypothesis that theta-band oscillatory balance between right and left frontal and prefrontal regions, with a predominance role to the right hemisphere, is crucial for regulatory control during decision-making under risk. In order to explore this hypothesis, we used transcranial Alternating Current Stimulation (tACS, a novel technique that provides the opportunity to explore the functional role of neuronal oscillatory activities and to establish a causal link between specific oscillations and functional lateralization in risky decision-making situations. For this aim, healthy participants were randomly allocated to one of three stimulation groups (LH stimulation / RH stimulation / Sham stimulation, with active AC stimulation delivered in a frequency-dependent manner (at 6.5 Hz; 1mA peak to-peak. During the AC stimulation, participants performed the Balloon Analog Risk Task. This experiment revealed that participants receiving LH stimulation displayed riskier decision-making style compared to sham and RH stimulation groups. However, there was no difference in decision-making behaviors between sham and RH stimulation groups. The current study extends the notion that DLPFC activity is critical for adaptive decision-making in the context of risk-taking and emphasis the role of theta-band oscillatory activity during risky decision-making situations.
DEFF Research Database (Denmark)
Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten
1998-01-01
be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Methods, systems and apparatus for controlling operation of two alternating current (AC) machines
Gallegos-Lopez, Gabriel [Torrance, CA; Nagashima, James M [Cerritos, CA; Perisic, Milun [Torrance, CA; Hiti, Silva [Redondo Beach, CA
2012-02-14
A system is provided for controlling two AC machines. The system comprises a DC input voltage source that provides a DC input voltage, a voltage boost command control module (VBCCM), a five-phase PWM inverter module coupled to the two AC machines, and a boost converter coupled to the inverter module and the DC input voltage source. The boost converter is designed to supply a new DC input voltage to the inverter module having a value that is greater than or equal to a value of the DC input voltage. The VBCCM generates a boost command signal (BCS) based on modulation indexes from the two AC machines. The BCS controls the boost converter such that the boost converter generates the new DC input voltage in response to the BCS. When the two AC machines require additional voltage that exceeds the DC input voltage required to meet a combined target mechanical power required by the two AC machines, the BCS controls the boost converter to drive the new DC input voltage generated by the boost converter to a value greater than the DC input voltage.
International Nuclear Information System (INIS)
Zav'yalov, D. V.; Kryuchkov, S. V.
2008-01-01
The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.
Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles
Energy Technology Data Exchange (ETDEWEB)
Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)
2011-02-15
The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.
2006-01-01
therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
International Nuclear Information System (INIS)
Nayak, P.K.; Ravi, S. . sravi@iitg.ernet.in
2008-01-01
We have prepared a series of compounds (La 1-x Y x ) 2 Ba 2 CaCu 5 O 2 for x = 0 to 0.5 by adding a CaCuO 2 layer to the parent compound La 2 Ba 2 Cu 4 O 2 and by doping Y in place of La. These materials are also prepared by adding 5 wt% of Ag to enhance the intergranular coupling and critical current density. X-ray diffraction measurements show that all the samples are essentially in single phase form and the patterns could be refined using P4/mmm space group in tetragonal cell. The typical lattice parameters are found to be a = b 3.856 A, c = 11.576 A for x = 0.5 sample. Temperature variations of dc electrical resistivity measured on the above samples show that they exhibit superconductivity with T c ranging from 60 to 75 K. Temperature and ac field amplitude variation of ac susceptibility have been measured on the above samples. The field variation of ac susceptibility data has been analyzed by using Bean critical state model. Using both temperature and field variations of ac susceptibility data, the material dependent parameters, such as critical current density as a function of temperature and effective volume fraction grains have been estimated. The Ag doped samples show relatively large critical current density compared to pure samples due to improved intergranular coupling. (author)
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
International Nuclear Information System (INIS)
Fumagalli, L; Ferrari, G; Sampietro, M; Casuso, I; MartInez, E; Samitier, J; Gomila, G
2006-01-01
Nanoscale capacitance imaging with attofarad resolution (∼1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale
Energy Technology Data Exchange (ETDEWEB)
Fumagalli, L [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Ferrari, G [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Sampietro, M [Dipartimento di Elettronica e Informazione, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 (Italy); Casuso, I [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); MartInez, E [Plataforma de Nanotecnologia, Parc Cientific de Barcelona, C/ Josep Samitier 1-5, 08028-Barcelona (Spain); Samitier, J [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain); Gomila, G [Departament d' Electronica, Universitat de Barcelona, C/MartIi Franques 1, 08028 Barcelona (Spain)
2006-09-28
Nanoscale capacitance imaging with attofarad resolution ({approx}1 aF) of a nano-structured oxide thin film, using ac current sensing atomic force microscopy, is reported. Capacitance images are shown to follow the topographic profile of the oxide closely, with nanometre vertical resolution. A comparison between experimental data and theoretical models shows that the capacitance variations observed in the measurements can be mainly associated with the capacitance probed by the tip apex and not with positional changes of stray capacitance contributions. Capacitance versus distance measurements further support this conclusion. The application of this technique to the characterization of samples with non-voltage-dependent capacitance, such as very thin dielectric films, self-assembled monolayers and biological membranes, can provide new insight into the dielectric properties at the nanoscale.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
Poplawski, Steven; Johnson, Matthew; Philips, Philip; Eberhart, Leopold H J; Koch, Tilo; Itri, Loretta M
2016-12-01
Fentanyl iontophoretic transdermal system (ITS) [IONSYS ® , The Medicines Company, Parsippany, NJ, USA] is a needle-free, patient-controlled, postoperative opioid pain management treatment. It is indicated for the short-term management of acute postoperative pain in adults requiring opioid analgesia in the hospital. The safety and effectiveness of fentanyl ITS for acute postoperative pain management has been demonstrated in a range of surgery and patient types studied in seven phase 3 trials (three placebo-controlled trials and four active-comparator trials). The majority of the patients in the phase 3 trials had undergone either abdominal/pelvic, orthopedic, or thoracic surgery. Consistent with the prescribing information, physicians in clinical practice may treat patients with this system following any type of surgery including those that may not have been included in the phase 3 trials. The purpose of this case series is to illustrate how fentanyl ITS is being utilized for postoperative pain management in real-world clinical practice following a variety of surgeries and in current pain management protocols that may have evolved since the completion of the phase 3 program. There are seven cases from three clinical centers described within this case series, each using fentanyl ITS according to the prescribing information. The surgery types included are bariatric (N = 3), prostate (N = 2), colorectal (N = 1), and perirectal abscess drainage (N = 1). A systematic review of each patient chart was conducted via a standardized retrospective assessment by the clinicians who managed each patient. Additionally, each healthcare professional was interviewed regarding their overall experience and key learnings using fentanyl ITS. Overall, fentanyl ITS was effective and well tolerated in these case reports in current-day clinical practice settings. These case studies are informative about fentanyl ITS use shortly after product approval and set the stage for
Directory of Open Access Journals (Sweden)
Alisa Berger
2018-04-01
Full Text Available Motor control is associated with synchronized oscillatory activity at alpha (8–12 Hz and beta (12–30 Hz frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females aged between 18 and 30 (M = 22.35 ± 3.62 participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions for 20 min via small gel electrodes (3,14 cm2 Ag/AgCl, amperage = 1 mA. Before and three time-points after tACS (immediately, 30 min and 1 day, bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS. Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that
Berger, Alisa; Pixa, Nils H; Steinberg, Fabian; Doppelmayr, Michael
2018-01-01
Motor control is associated with synchronized oscillatory activity at alpha (8-12 Hz) and beta (12-30 Hz) frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS) is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females) aged between 18 and 30 ( M = 22.35 ± 3.62) participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions) for 20 min via small gel electrodes (3,14 cm 2 Ag/AgCl, amperage = 1 mA). Before and three time-points after tACS (immediately, 30 min and 1 day), bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG) and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS). Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that tACS
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Chen, Wenjie; Liserre, Marco
2015-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....
A direct power conversion topology for grid integrations of hybrid AC/DC resources
DEFF Research Database (Denmark)
Liu, Xiong; Loh, Poh Chiang; Wang, Peng
2012-01-01
and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Liserre, Marco; Blaabjerg, Frede
2013-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
Directory of Open Access Journals (Sweden)
Vanessa eKrause
2016-01-01
Full Text Available The primary motor cortex (M1 contributes to the acquisition and early consolidation of a motor sequence. Although the relevance of M1 excitability for motor learning has been supported, the significance of M1 oscillations remains an open issue. This study aims at investigating to what extent retrieval of a newly learned motor sequence can be differentially affected by motor-cortical transcranial alternating (tACS and direct current stimulation (tDCS. Alpha (10 Hz, beta (20 Hz or sham tACS was applied in 36 right-handers. Anodal or cathodal tDCS was applied in 30 right-handers. Participants learned an eight-digit serial reaction time task (SRTT; sequential vs. random with the right hand. Stimulation was applied to the left M1 after SRTT acquisition at rest for ten minutes. Reaction times were analyzed at baseline, end of acquisition, retrieval immediately after stimulation and reacquisition after eight further sequence repetitions.Reaction times during retrieval were significantly faster following 20 Hz tACS as compared to 10 Hz and sham tACS indicating a facilitation of early consolidation. TDCS yielded faster reaction times, too, independent of polarity. No significant differences between 20 Hz tACS and tDCS effects on retrieval were found suggesting that 20 Hz effects might be associated with altered motor-cortical excitability. Based on the behavioural modulation yielded by tACS and tDCS one might speculate that altered motor-cortical beta oscillations support early motor consolidation possibly associated with neuroplastic reorganization.
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
A Floquet-Green's function approach to mesoscopic transport under ac bias
International Nuclear Information System (INIS)
Wu, B H; Cao, J C
2008-01-01
The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias
International Nuclear Information System (INIS)
Romanovskii, V.; Watanabe, K.; Awaji, S.
2013-01-01
Highlights: •Overloaded AC states are investigated to understand the mechanisms of there formation. •There exist characteristic time windows defining the existence of stable overloaded AC states. •Limiting values of the electric field, current and temperature are higher than the quench ones. -- Abstract: The macroscopic thermal and electrodynamical phenomena occurring in high-T c superconductors during overloaded AC states are theoretically investigated to understand the basic physical mechanisms, which are characteristic for the stable formation of the operating modes when the peak current exceeds the critical current of a superconductor during AC modes. It is shown that there exist characteristic time windows defining the existence of stable overloaded AC states. They identify the stability boundary of the overloaded AC states. Therefore, there is the maximum allowable value of a peak current of stable overloaded AC regimes at the given charging rate, cooling conditions and properties of a superconductor and a matrix. The results obtained prove that the limiting peak current is higher than the corresponding quench current defining the stability margin of DC states. It monotonically increases with the charging rate. Besides, in the stable overloaded AC states, the peak values of the electric field and temperature may be also noticeably higher than the corresponding quench values. They depend on the peak current and charging rate at the given cooling conditions. As a result, high-T c superconducting tapes can stably work under intensive AC modes without instability onset when the peak of applied currents may significantly exceed not only the critical current but also the corresponding values of DC-quench currents
Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response
Energy Technology Data Exchange (ETDEWEB)
Ligneris, Benoit des; Aubin, Marcel; Cave, Julian
2003-04-15
We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.
Stretched exponential relaxation and ac universality in disordered dielectrics
DEFF Research Database (Denmark)
Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens
2007-01-01
This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Directory of Open Access Journals (Sweden)
Danielle C. A. S. de Santana
2017-01-01
Full Text Available Ruthenium (Ru complexes have been studied as promising anticancer agents. Ru nitrosyl complex (Ru-NO is one which acts as a pro-drug for the release of nitric oxide (NO. The Ru-aqueous complex formed by the exchange of NO for a water molecule after NO release could also possess therapeutic effects. This study evaluates the influence of iontophoresis on enhancing the skin penetration of Ru-NO and Ru-aqueous and assesses its applicability as a tool in treating diverse skin diseases. Passive and iontophoretic (0.5 mA·cm−2 skin permeation of the complexes were performed for 4 h. The amount of Ru and NO in the stratum corneum (SC, viable epidermis (VE, and receptor solution was quantified while the influence of iontophoresis and irradiation on NO release from Ru-NO complex was also evaluated. Iontophoresis increased the amount of Ru-NO and Ru-aqueous recovered from the receptor solution by 15 and 400 times, respectively, as compared to passive permeation. Iontophoresis produced a higher accumulation of Ru-aqueous in the skin layers as compared to Ru-NO. At least 50% of Ru-NO penetrated the SC was stable after 4 h. The presence of Ru-NO in this skin layer suggests that further controlled release of NO can be achieved by photo-stimulation after iontophoresis.
Magneto-optical measurements on high-temperature superconductors influenced by AC-fields
International Nuclear Information System (INIS)
Che'Rose, Simon
2007-01-01
In this work magneto-optical measurements on YBa 2 Cu 3 O 7-x and MgB 2 thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB 2 the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
Iwakuma, M; Funaki, K
2002-01-01
The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
Control of a resonant d.c.-link converter for a.c. motor drives
Directory of Open Access Journals (Sweden)
Astrid Petterteig
1992-10-01
Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Study of the electric Held in HTS tape caused by perpendicular AC magnetic field
International Nuclear Information System (INIS)
Roiberg, V; Kopansky, F.
2004-01-01
Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Innovations in electrophoretic deposition: Alternating current and pulsed direct current methods
International Nuclear Information System (INIS)
Chávez-Valdez, Alejandra; Boccaccini, Aldo R.
2012-01-01
This review summarizes emerging developments in the field of alternating current (AC) and pulsed direct current (DC) electrophoretic deposition (EPD) in aqueous or organic media. Numerous applications of AC-EPD are discussed including two major groups of investigations: (i) AC-EPD to suppress water hydrolysis at high voltages in inorganic (ceramic) coatings and (ii) AC-EPD for deposition of biological entities. The deposition, purification and manipulation of carbon nanotubes and nanoparticles by AC-EPD to form specific arrays, for development of sensors and other electronic devices and the application of AC-EPD as method for separation of particles according to their shape or size are also presented. Other applications reviewed relate to the fabrication by AC-EPD of toxic gas sensors from oxides and superconducting layers. The main materials being examined by AC-EPD are inorganic, including carbon nanotubes, TiO 2 nanoparticles, Al 2 O 3 , Si, SnO 2 , ZnO and WO 3 and biological entities, e.g. bacteria cells. For pulsed EPD, the applications reviewed are divided in pulsed current and pulsed voltage EPD. Among the applications of pulsed EPD, the formation of thick films from aqueous suspensions without water decomposition, the fabrication of multilayer and composite materials and the size-selective deposition of ceramic nanoparticles are the most important investigated to date, based on the quality of the coatings and deposits obtained and their relevance for applications.
AC losses and stability on large cable-in-conduit superconductors
Bruzzone, Pierluigi
1998-12-01
The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
AC Loss Analysis of MgB2-Based Fully Superconducting Machines
Feddersen, M.; Haran, K. S.; Berg, F.
2017-12-01
Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.
AC Conductivity and Dielectric Properties of Borotellurite Glass
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors
International Nuclear Information System (INIS)
Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.
1997-01-01
Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics
A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation
Directory of Open Access Journals (Sweden)
Cuidong Xu
2015-09-01
Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.
Modeling photovoltaic systems for AC appliances
Directory of Open Access Journals (Sweden)
Andreea Maria Neaca
2009-10-01
Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.
Fixed switching frequency applied in single-phase boost AC to DC converter
International Nuclear Information System (INIS)
Chen, T.-C.; Ren, T.-J.; Ou, J.-C.
2009-01-01
The fixed switching frequency control for a single-phase boost AC to DC converter to achieve a sinusoidal line current and unity power factor is proposed in this paper. The relation between the line current error and the fixed switching frequency was developed. For a limit line current error, the minimum switching frequency for a boost AC to DC converter can be achieved. The proposed scheme was implemented using a 32-bit digital signal processor TMS320C32. Simulations and experimental results demonstrate the feasibility and fast dynamic response of the proposed control strategy.
AC impedance behavior of a practical-size single-cell SOFC under DC current
Energy Technology Data Exchange (ETDEWEB)
Momma, Akihiko; Kaga, Yasuo; Takano, Kiyonami; Nozaki, Ken; Negishi, Akira; Kato, Ken; Kato, Tohru [Fuel Cell Group, Energy Electronics Institute, National Institute of Advanced Industrial Science and Technology, Umezono Tsukuba-shi, Ibaraki 305-8568 (Japan); Inagaki, Toru; Yoshida, Hiroyuki [Energy Use R and D Center, The Kansai Electric Power Company, Inc., 11-20 Nakoji, 3-Chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei; Hoshino, Koji; Akbay, Taner; Akikusa, Jun; Yamada, Masaharu; Chitose, Norihisa [Central Research Institute, Naka Research Center, Mitsubishi Materials Corp. 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)
2004-10-29
AC impedance measurements were carried out using practical-size planar disc-type SOFC which employs lanthanum gallate as a solid electrolyte. The data were obtained under practical conditions of gas flow rate and DC current. Under these conditions, the gas conversion impedance (GCI), which originates from the change of the electromotive force (EMF) caused by the change in anodic gaseous concentrations along the flow direction, was observed in the low-frequency range of the data obtained. The overlapping impedance together with GCI on the low-frequency arc was also estimated. Experimentally obtained GCI was in good agreement with that calculated. It was concluded that GCI was predominant in the impedance data obtained under practical conditions. The shift of the high-frequency intercept in the complex impedance diagrams was shown to appear as a result of the change in the distribution of gaseous composition in the anode. The dependency of the low-frequency arc on temperature was also shown, and it was assumed that the overlapped impedance varies as the temperature changes. The validity of the impedance measurement, as a diagnostic means to evaluate the gas flow in SOFC stack, was suggested.
Analytical theory and possible detection of the ac quantum spin Hall effect.
Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y
2017-07-11
We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Modelling and measurement of ac loss in BSCCO/Ag-tape windings
International Nuclear Information System (INIS)
Oomen, M P; Nanke, R; Leghissa, M
2003-01-01
High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications
Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor
DEFF Research Database (Denmark)
Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan
2012-01-01
to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...
Directory of Open Access Journals (Sweden)
Dohoon Kwon
2017-10-01
Full Text Available A new modeling method for high voltage direct current (HVDC systems and associated controllers is presented for the power system simulator for engineering (PSS/E simulation environment. The aim is to improve the estimation of the transient DC voltage and current in the event of an AC line-to-ground fault. The proposed method consists primary of three interconnected modules for (a equation conversion; (b control-mode selection; and (c DC-line modeling. Simulation case studies were carried out using PSS/E and a power systems computer aided design/electromagnetic transients including DC (PSCAD/EMTDC model of the Jeju– Haenam HVDC system in Korea. The simulation results are compared with actual operational data and the PSCAD/EMTDC simulation results for an HVDC system during single-phase and three-phase line-to-ground faults, respectively. These comparisons show that the proposed PSS/E modeling method results in the improved estimation of the dynamic variation in the DC voltage and current in the event of an AC network fault, with significant gains in computational efficiency, making it suitable for real-time analysis of HVDC systems.
Boguslawsky, Iliya; Hayakawa, Masashi
2017-01-01
In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.
Directory of Open Access Journals (Sweden)
Duong Minh Bui
2016-03-01
Full Text Available Transient situations of a uni-grounded low-voltage AC microgrid are simulated in this paper, which include different fault tests and operation transition test between the grid-connected and islanded modes of the uni-grounded microgrid. Based on transient simulation results, available fault protection methods are proposed for the main and back-up protection of a uni-grounded AC microgrid. Main contributions of this paper are (i analysing transient responses of a typically uni-grounded lowvoltage AC microgrid from line-to-line, single line-to-ground, three-phase faults and a microgrid operation transition test; and (ii proposing available fault protection methods for uni-grounded AC microgrids, such as non-directional/directional overcurrent protection solutions, under/over voltage protection solutions, differential protection, voltage-restrained overcurrent protection, and other protection principles not based on high fault currents (e.g. total harmonic distortion detection of phase currents and voltages, or protection methods using symmetrical sequence components of current and voltage.
Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid
Directory of Open Access Journals (Sweden)
Mahmudreza Changizian
2017-11-01
Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.
AC Losses and Their Thermal Effect in High Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2015-01-01
In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...
AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2016-01-01
In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...
AC-driven organic light emission devices with carbon nanotubes
Jeon, So-Yeon; Yu, SeGi
2017-02-01
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
AC-driven Organic Light Emission Devices with Carbon Nanotubes
Energy Technology Data Exchange (ETDEWEB)
Jeon, So-Yeon [Sungkyunkwan University, Suwon (Korea, Republic of); Yu, SeGi [Hankuk University of Foreign Studies, Yongin (Korea, Republic of)
2017-02-15
We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.
Fault-current limiter using a superconducting coil
International Nuclear Information System (INIS)
Boenig, H.J.; Paice, D.A.
1982-01-01
A novel circuit, consisting of solid-state diodes and a biased superconducting coil, for limiting the fault currents in three-phase ac systems is presented. A modification of the basic circuit results in a solid-state ac breaker with current-limiting features. The operating characteristics of the fault-current limiter and the ac breaker are analyzed. An optimization procedure for sizing the superconducting coil is derived
Simulation of the AC corona phenomenon with experimental validation
International Nuclear Information System (INIS)
Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R
2017-01-01
The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)
AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2011-01-01
While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.
International Nuclear Information System (INIS)
Goldfarb, R.B.; Clark, A.F.
1985-01-01
Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement
She, Xu; Chokhawala, Rahul Shantilal; Bray, James William; Sommerer, Timothy John; Zhou, Rui; Zhang, Di
2017-08-29
A high-voltage direct-current (HVDC) transmission system includes an alternating current (AC) electrical source and a power converter channel that includes an AC-DC converter electrically coupled to the electrical source and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and the DC-AC inverter each include a plurality of legs that includes at least one switching device. The power converter channel further includes a commutating circuit communicatively coupled to one or more switching devices. The commutating circuit is configured to "switch on" one of the switching devices during a first portion of a cycle of the H-bridge switching circuits and "switch off" the switching device during a second portion of the cycle of the first and second H-bridge switching circuits.
Bifurcation theory of ac electric arcing
International Nuclear Information System (INIS)
Christen, Thomas; Peinke, Emanuel
2012-01-01
The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)
Ac susceptibility of a Bi-2223/Ag tape in a perpendicular field
International Nuclear Information System (INIS)
Savvides, N.; Mueller, K.-H.
1999-01-01
Full text: We report experimental measurements and theoretical calculations of the real ( X ') and imaginary or loss ( X '') parts of the ac susceptibility as a function of temperature T = 4 - 130 K, frequency ω/2π = 5 Hz - 5 kHz and ac magnetic field amplitude μ 0 H m = 0.02 - 7 mT for of a monofilament silver-sheathed Bi-2223 tape. The susceptibilities consist of a hysteretic component due to ac loss ( Xsc '') in the superconductor core and an eddy current component due to eddy current loss ( Xed '') in the silver sheath. At high temperatures the low frequency limit is used to calculate the hysteretic and eddy current susceptibilities while at low temperatures the susceptibility is found to be due to eddy currents flowing along the edges of the tape. The measured loss at low frequencies (< 50 Hz) and high temperatures is dominated by the hysteresis loss which varies with amplitude but is essentially independent of frequency. At higher frequencies the eddy current loss of the silver sheath becomes dominant and it increases dramatically with frequency at both low and high temperatures
International Nuclear Information System (INIS)
Kerns, C.R.
1977-01-01
A device is provided for detecting the current level of a dc signal. It includes an even harmonic modulator to which a reference ac signal is applied. The unknown dc signal acts on the reference ac signal so that the output of the modulator includes an even harmonic whose amplitude is proportional to the unknown dc current. The device may be used to provide overcurrent protection for proportional wire chambers
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
A nonlinear model for AC induced corrosion
Directory of Open Access Journals (Sweden)
N. Ida
2012-09-01
Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.
AC application of second generation HTS wire
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
Darmann, Francis Anthony
2013-10-08
A fault current limiter (FCL) includes a series of high permeability posts for collectively define a core for the FCL. A DC coil, for the purposes of saturating a portion of the high permeability posts, surrounds the complete structure outside of an enclosure in the form of a vessel. The vessel contains a dielectric insulation medium. AC coils, for transporting AC current, are wound on insulating formers and electrically interconnected to each other in a manner such that the senses of the magnetic field produced by each AC coil in the corresponding high permeability core are opposing. There are insulation barriers between phases to improve dielectric withstand properties of the dielectric medium.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)
2007-10-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.
2007-01-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates
A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids
Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun
2016-04-01
This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.
Energy Technology Data Exchange (ETDEWEB)
Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2004-10-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.
International Nuclear Information System (INIS)
Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z
2004-01-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field
Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications
Directory of Open Access Journals (Sweden)
Vorobyov Maxim
2014-10-01
Full Text Available Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or voltage is crossing the zero point. Zero crossing sensors are used to solve this problem. They consist of current or voltage measurement unit and zero crossing detector. Different approaches are used for zero crossing: hardware or software. Hardware approach is simple but it has low precision. Software approach has high precision but it is complicated and expensive. In this paper a simple low cost high precision approach is presented. It takes all advantages from both approaches. While tested with two types of microcontrollers the precision of experimental measurement is 25 μs - 40 μs.
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs
AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications
Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.
2017-12-01
This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-03-01
Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes
Hydrogel iontophoresis for gentamicin administration to the rabbit eye
Eljarrat-Binstock, Esther; Raiskup, Frederik; Frucht-Pery, Joseph; Domb, Abraham J.
2005-04-01
Iontophoresis (IONT) is a non-invasive technique in which a low electric current is used to enhance the penetration of charged molecules into tissue. This technique has been used in various fields of medicine, mostly in transdermal drug delivery. This study was aimed to evaluate the efficacy and the distribution profile of gentamicin using corneal IONT on infected and healthy rabbit eyes. Corneal iontophoresis of gentamicin sulfate was studied using drug-loaded disposable hydrogel probes mounted on a portable iontophoretic device, applying a low current for 60 seconds. This study confirmed that a triple iontophoretic treatment of gentamicin for only 60 seconds (0.5mA) significantly reduces the count of pseudomonas in the infected cornea to a non-infectious level. Peak gentamicin concentrations at the healthy corneas (363.1 +/- 127.3 μg/g) and at the aqueous humor (29.4 +/- 17.4 μg/ml) were reached immediately and two hours after a single iontophoretic treatment, respectively. The concentration versus time profile of gentamicin following iontophoresis revealed a gentamicin half life of 2.07 h in the anterior chamber, and a clearance of 1.73 μl/min from the anterior chamber to the posterior segments of the eye. This study indicates that a short iontophoretic treatment using gentamicin-loaded hydrogels has a potential clinical value in treating corneal infections, by increasing drug penetration to the eye and maintaining therapeutic levels for more than eight hours.
A Comparison of Alternating Current and Direct Current Electrospray Ionization for Mass Spectrometry
Sarver, Scott A.; Chetwani, Nishant; Dovichi, Norman J.; Go, David B.; Gartner, Carlos A.
2014-04-01
A series of studies comparing the performance of alternating current electrospray ionization (AC ESI) mass spectrometry (MS) and direct current electrospray ionization (DC ESI) MS have been conducted, exploring the absolute signal intensity and signal-to-background ratios produced by both methods using caffeine and a model peptide as targets. Because the high-voltage AC signal was more susceptible to generating gas discharges, the operating voltage range of AC ESI was significantly smaller than that for DC ESI, such that the absolute signal intensities produced by DC ESI at peak voltages were one to two orders of magnitude greater than those for AC ESI. Using an electronegative nebulizing gas, sulfur hexafluoride (SF6), instead of nitrogen (N2) increased the operating range of AC ESI by ~50 %, but did not appreciably improve signal intensities. While DC ESI generated far greater signal intensities, both ionization methods produced comparable signal-to-background noise, with AC ESI spectra appearing qualitatively cleaner. A quantitative calibration analysis was performed for two analytes, caffeine and the peptide MRFA. AC ESI utilizing SF6 outperforms all other techniques for the detection of MRFA, producing chromatographic limits of detection nearly one order of magnitude lower than that of DC ESI utilizing N2, and one-half that of DC ESI utilizing SF6. However, DC ESI outperforms AC ESI for the analysis of caffeine, indicating that improvements in spectral quality may benefit certain compounds or classes of compounds, on an individual basis.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-01-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received
Direct current power delivery system and method
Zhang, Di; Garces, Luis Jose; Dai, Jian; Lai, Rixin
2016-09-06
A power transmission system includes a first unit for carrying out the steps of receiving high voltage direct current (HVDC) power from an HVDC power line, generating an alternating current (AC) component indicative of a status of the first unit, and adding the AC component to the HVDC power line. Further, the power transmission system includes a second unit for carrying out the steps of generating a direct current (DC) voltage to transfer the HVDC power on the HVDC power line, wherein the HVDC power line is coupled between the first unit and the second unit, detecting a presence or an absence of the added AC component in the HVDC power line, and determining the status of the first unit based on the added AC component.
Phase-locking of driven vortex lattices with transverse ac force and periodic pinning
International Nuclear Information System (INIS)
Reichhardt, Charles; Kolton, Alejandro B.; Dominguez, Daniel; Gronbech-Jensen, Niels
2001-01-01
For a vortex lattice moving in a periodic array we show analytically and numerically that a new type of phase locking occurs in the presence of a longitudinal dc driving force and a transverse ac driving force. This phase locking is distinct from the Shapiro step phase locking found with longitudinal ac drives. We show that an increase in critical current and a fundamental phase-locked step width scale with the square of the driving ac amplitude. Our results should carry over to other systems such as vortex motion in Josephson-junction arrays
DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-05-01
Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
Photovoltaic system with improved AC connections and method of making same
Energy Technology Data Exchange (ETDEWEB)
Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony
2018-02-13
An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
AC losses of single-core MgB{sub 2} wires with different metallic sheaths
Energy Technology Data Exchange (ETDEWEB)
Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.
2015-12-15
Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.
Nair, Anroop; Vyas, Hiral; Shah, Jigar; Kumar, Ashok
2011-01-01
Utilization of chemical penetration enhancers in conjunction with iontophoresis is regarded as the most effective method to enhance the passage of molecules across the skin barrier. A systematic approach to enhance the transdermal delivery of metoprolol tartrate and the subsequent release of the drug depot in the skin was investigated. Gel formulations with proximate viscosity were prepared and assessed for the effect of polymers (carbopol, hydroxypropyl methyl cellulose, and methyl cellulose), permeation enhancers (5% w/w, sodium lauryl sulfate (SLS), dimethyl formamide, n-methyl-2-pyrrolidone, and polyethylene glycol 400), and the combination approach (permeation enhancers with iontophoresis-0.5 mA/cm² on the drug delivery. The flux values observed in passive (4.59-5.89 µg/cm²/h) and iontophoresis (37.99-41.57 µg/cm²/h) processes revealed that the permeation of metoprolol was not influenced by the polymers studied, under similar conditions, and further studies were carried out using carbopol gel as a representative polymer. Appreciable enhancement (~5-fold) in drug delivery was observed with SLS in the passive process while the optimum iontophoretic delivery condition ensured better delivery (~7-fold). Combination of iontophoresis with SLS further enhanced the drug delivery (~9-fold) and leads to noticeable drug retention in the skin as well. Moreover, the drug retained in the cutaneous layer of the skin eventually released over a period of time (5 days) and followed a near first order profile. This study concludes that the combination of iontophoresis with SLS augmented the metoprolol delivery and rendered skin drug depot, which eventually released over a period of time.
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
International Nuclear Information System (INIS)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency
Energy Technology Data Exchange (ETDEWEB)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)
2008-01-15
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
Directory of Open Access Journals (Sweden)
Tongkun Lan
2018-01-01
Full Text Available AC (alternating current system backup protection setting calculation is an important basis for ensuring the safe operation of power grids. With the increasing integration of modular multilevel converter based high voltage direct current (MMC-HVDC into power grids, it has been a big challenge for the AC system backup protection setting calculation, as the MMC-HVDC lacks the fault self-clearance capability under pole-to-pole faults. This paper focused on the pole-to-pole faults analysis for the AC system backup protection setting calculation. The principles of pole-to-pole faults analysis were discussed first according to the standard of the AC system protection setting calculation. Then, the influence of fault resistance on the fault process was investigated. A simplified analytic approach of pole-to-pole faults in MMC-HVDC for the AC system backup protection setting calculation was proposed. In the proposed approach, the derived expressions of fundamental frequency current are applicable under arbitrary fault resistance. The accuracy of the proposed approach was demonstrated by PSCAD/EMTDC (Power Systems Computer-Aided Design/Electromagnetic Transients including DC simulations.
Electromigration failures under bidirectional current stress
Tao, Jiang; Cheung, Nathan W.; Hu, Chenming
1998-01-01
Electromigration failure under DC stress has been studied for more than 30 years, and the methodologies for accelerated DC testing and design rules have been well established in the IC industry. However, the electromigration behavior and design rules under time-varying current stress are still unclear. In CMOS circuits, as many interconnects carry pulsed-DC (local VCC and VSS lines) and bidirectional AC current (clock and signal lines), it is essential to assess the reliability of metallization systems under these conditions. Failure mechanisms of different metallization systems (Al-Si, Al-Cu, Cu, TiN/Al-alloy/TiN, etc.) and different metallization structures (via, plug and interconnect) under AC current stress in a wide frequency range (from mHz to 500 MHz) has been study in this paper. Based on these experimental results, a damage healing model is developed, and electromigration design rules are proposed. It shows that in the circuit operating frequency range, the "design-rule current" is the time-average current. The pure AC component of the current only contributes to self-heating, while the average (DC component) current contributes to electromigration. To ensure longer thermal-migration lifetime under high frequency AC stress, an additional design rule is proposed to limit the temperature rise due to self-joule heating.
DC injection into low voltage AC networks
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.
Energy Technology Data Exchange (ETDEWEB)
Weiss, Roland [Siemens AG, Erlangen (Germany); Boeke, Ulrich [Philips Group Innovation-Research, Eindhoven (Netherlands); Maurer, Wilhelm [Infineon Technologies AG, Neubiberg (Germany); Zeltner, Stefan [Fraunhofer-Inst. fuer Integrierte Systeme und Bauelementetechnologie (IISB), Erlangen (Germany)
2012-07-01
The joint undertaking ''Direct Current Components and Grid'' (DCC+G) takes on the strategic challenge to reduce energy consumption and thus the reduction of CO{sub 2} emission caused by commercially used buildings through research in the fields of Direct Current distribution at a voltage level of {+-} 380 V. The major energy consumers in commercially used buildings, ready for the ''net-zero-energy'' goal of the European Union, are heat pumps for heating, ventilation systems, air conditioning units, cooling units (HVAC), lighting systems and information technology. All these components and subsystems have in common, that the most efficient versions would benefit from a direct current supply. Additionally the local producers of electric energy like photovoltaic systems usually generate DC-current. A Direct Current distribution grid within buildings would avoid the repeating conversion from DC and AC an vice versa and therefore reduce conversion losses. Important components of a direct current distribution grid are central, smart, high efficient, bidirectional rectifiers replacing the large number of small, less efficient rectifiers used today. Such large central rectifiers units could additionally be used to actively improve the power quality of the smart local AC distribution grid. One major part of the described activities is to show energy savings of about 5 % of electrical energy with a 2-phase direct current distribution grid using a voltage level of {+-} 380 V. (orig.)
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
International Nuclear Information System (INIS)
Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.
2012-01-01
Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC
Transport ac loss studies of YBCO coated conductors with nickel alloy substrates
International Nuclear Information System (INIS)
Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T
2003-01-01
Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection
Xu, Pengfei; Zhang, Bo; Wang, Zezhong; Chen, Shuiming; He, Jinliang
2017-12-01
By synchronous measurement of corona current and the water droplet deformation process on a conductor surface, different types of corona discharge are visualized when AC voltage is applied on a line-ground electrode system. The corona characteristics are closely related to the applied voltage and water supply rate. With the increase of AC voltage, the positive Taylor cone discharge firstly appears and then disappears, replaced by the dripping and crashing discharge. Furthermore, the number of pulses in each pulse train increases with the increase of applied voltage. The mechanism of the transfer from the positive Taylor cone discharge to the dripping and crashing discharge is found to be related to the oscillation process of the water droplet. The water supply rate also has a great influence on the characteristics of corona currents. The number of positive pulse trains increases linearly when the water supply rate gets larger, leading to a higher audible noise and radio interference level from the AC corona, which is quite different from that of the DC corona. The difference between the AC and DC coronas under rainfall conditions is analyzed finally.
Kvitkovic, J.; Hatwar, R.; Pamidi, S. V.; Fleshler, S.; Thieme, C.
2015-12-01
The temperature dependence of the critical current and AC losses were measured on American Superconductor Corporation's (AMSC) second generation high temperature superconducting (2G HTS) wire produced by Rolling Assisted Biaxially Textured Substrate (RABiTS) and Metal Organic Deposition (MOD) process. Wires manufactured with two types of substrates were characterized. The magnetic substrate with composition Ni5a%W exhibits a magnetic signature and has non-negligible AC losses in AC power applications. A new nonmagnetic substrate with an alloy composition Ni9a%W has been developed by AMSC to address the AC losses in 2G HTS. The data presented show that the performance of the new conductor is identical to the conductor with magnetic substrate in terms of critical current density. The data on AC losses demonstrate the absence of ferromagnetic loss component in the new conductor and significantly reduced AC losses at low to moderate values of I/Ic. The reduced losses will translate into reduced capital costs and lower operating costs of superconducting electrical devices for AC applications.
Energy Technology Data Exchange (ETDEWEB)
Crepieux, Adeline [Aix Marseille Univ., Universite de Toulon, CNRS, CPT, Marseille (France)
2017-09-15
The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
DEFF Research Database (Denmark)
Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei
2014-01-01
MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...
Kalaria, Dhaval R; Patel, Pratikkumar; Merino, Virginia; Patravale, Vandana B; Kalia, Yogeshvar N
2013-11-04
The aim of this study was to investigate constant current anodal iontophoresis of Huperzine A (HupA) in vitro and in vivo and hence to evaluate the feasibility of using electrically assisted delivery to administer therapeutic amounts of the drug across the skin for the treatment of Alzheimer's disease. Preliminary experiments were performed using porcine and human skin in vitro. Stability studies demonstrated that HupA was not degraded upon exposure to epidermis or dermis for 12 h and that it was also stable in the presence of an electric current (0.5 mA · cm(-2)). Passive permeation of HupA (2 mM) was minimal (1.1 ± 0.1 μg · cm(-2)); iontophoresis at 0.15, 0.3, and 0.5 mA · cm(-2) produced 106-, 134-, and 184-fold increases in its transport across the skin. Surprisingly, despite the use of a salt bridge to isolate the formulation compartment from the anodal chamber, which contained 133 mM NaCl, iontophoresis of HupA was shown to increase linearly with its concentration (1, 2, and 4 mM in 25 mM MES, pH 5.0) (r(2) = 0.99). This was attributed to the low ratio of drug to Cl¯ (in the skin and in the receiver compartment) which competed strongly to carry current, its depletion, and to possible competition from the zwitterionic MES. Co-iontophoresis of acetaminophen confirmed that electromigration was the dominant electrotransport mechanism. Total delivery across human and porcine skin was found to be statistically equivalent (243.2 ± 33.1 and 235.6 ± 13.7 μg · cm(-2), respectively). Although the transport efficiency was ∼ 1%, the iontophoretic delivery efficiency (i.e., the fraction of the drug load delivered) was extremely high, in the range of 46-81% depending on the current density. Cumulative permeation of HupA from a Carbopol gel formulation after iontophoresis for 6 h at 0.5 mA · cm(-2) was less than that from solution (135.3 ± 25.2 and 202.9 ± 5.2 μg · cm(-2), respectively) but sufficient for therapeutic delivery. Pharmacokinetic parameters were
Pestano, Cecile R; Lindley, Pam; Ding, Li; Danesi, Hassan; Jones, James B
2017-08-01
The aim of this meta-analysis was to compare the ease of care (EOC) of fentanyl iontophoretic transdermal system (ITS) vs the morphine intravenous patient-controlled analgesia (IV PCA) as assessed by the nurse. Meta-analysis of three phase 3B randomized active-comparator trials. This meta-analysis according to Cochrane's approach assessed EOC using a validated nurse questionnaire (22 items grouped into three subscales, which include time efficiency, convenience, and satisfaction) in adult patients treated with fentanyl ITS or morphine IV PCA for postoperative pain management. The weighted mean difference (WMD) between treatments was calculated. EOC analyses were based on responses to questionnaires from 848 (fentanyl ITS) and 761 (morphine IV PCA) nurses. Fentanyl ITS was reported to provide significant advantages compared with morphine IV PCA in terms of nurses' overall EOC (WMD = -0.57, P PCA. Copyright © 2016 American Society of PeriAnesthesia Nurses. Published by Elsevier Inc. All rights reserved.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid
Directory of Open Access Journals (Sweden)
Farhan Beg
2015-01-01
Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.
ACS Postflash Characterization
Smith, Linda
2011-10-01
This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.
Final design of the Korean AC/DC converters for the ITER coil power supply system
Energy Technology Data Exchange (ETDEWEB)
Oh, Jong-Seok, E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, Jungwan; Suh, Jae-Hak; Choi, Jihyun [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Lee, Lacksang; Kim, Changwoo; Park, Hyungjin; Jo, Seongman; Lee, Seungyun; Hwang, Kwangcheol; Liu, Hyoyol [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Hong, Ki-Don; Sim, Dong-Joon; Lee, Jang-Soo [Hyosung Corp., Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); Lee, Eui-Jae; Kwon, Yang-Hae; Lee, Dae-Yeol; Ko, Ki-Won; Kim, Jong-Min [Mobiis Corp., Yangjae-dong, Seoul 137-888 (Korea, Republic of); Song, Inho [ITER Organization, Route de Vinon sur Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); and others
2015-10-15
The final design of the ITER TF, CS, CC and VS AC/DC converters has been completed to implement ITER requirements following the detailed design and refinements of the preliminary design. The number of parallel thyristors and the rating of fuses are coordinated to keep those devices within the explosion limit even under most severe fault conditions. The impedance of the converter transformer has been optimized taking into account the energization inrush current, short circuit current, reactive power consumption and the available DC voltage. To ensure system integrity, AC/DC converters are mechanically divided into transformers, AC busbars, 6-pulse bridges, DC interconnecting busbars and DC reactors, and then all subsystems are decoupled by flexible links. To provide stable real time network communication down to the converters, a one GbE link is deployed between master controllers and local controllers. IEEE 1588 is implemented to the embedded controllers for precision time synchronization. This paper describes the detailed solutions implemented in the final design for the ITER AC/DC converters with R&D results of converter prototypes.
A method for decreasing transport ac losses in multifilamentary and multistrip superconductors
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)
2000-07-01
A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
International Nuclear Information System (INIS)
Tsukamoto, Osami; Li, Z
2007-01-01
The influence of uniaxial tensile stress-strain on the AC loss characteristics of multifilamentary Bi2223/Ag sheathed tape wires was investigated. The uniaxial tensile stress-strain was applied to the sample wire in liquid nitrogen at atmospheric pressure, and the AC losses (transport, magnetization and total losses) were measured by an electric method. Two kinds of wire, oxide-dispersion strengthened Ag-alloy sheathed and Ag-alloy sheathed wires, were tested. The stress-strain curves of the tested wires were divided in three regions, i.e. elastic deformation, continuous plastic deformation and serrated-like plastic deformation regions, though the ranges of those regions were different for different kinds of wire. In the elastic and continuous plastic regions, the stress-strain curve was smooth and continuous, and in the serrated-like plastic region, the curve was rough. In the serrated-like plastic region, the wires kept elongating, while increase of the tensile stress was suspended. Dependences of the critical currents on the stress-strain were generally as follows. While decreases of the wire critical currents were in the range of less than 4% of the original values of the no-stress condition, the critical currents of the wires were reversible, that is, the critical currents recovered the original values at zero stress when the stress were released, regardless of whether the wires were in the elastic or continuous plastic region. In the continuous plastic region, the critical currents decreased up to 10%-15% of the original values and the critical currents were irreversible when the degradations of the critical currents exceeded about 4%. In the serrated-like plastic regions, the critical currents were more severely degraded. The AC loss characteristics of the wires are different in those regions. In the elastic and continuous plastic regions, the absolute values of AC losses were dependent on the stress-strain. However, the dependences of those normalized
Critical current measurement in superconducting rings using an automatic inductive technique
International Nuclear Information System (INIS)
Gonzalez-Jorge, H.; Linares, B.; Quelle, I.; Carballo, E.; Romani, L.; Domarco, G.
2007-01-01
A measurement technique was developed to identify the critical current of superconducting rings. It is based on the detection of the voltage on a secondary coil when the current induced in the superconductor by a primary one go beyond to the critical value. The technique uses a DC power supply to control the AC current circulating by the primary circuit. Such circuit mainly consists on an AC power supply which gives a constant AC voltage, a primary inducting coil and a control coil with iron core. The AC current circulating by this circuit is modified with the change in the impedance of the control coil due to the fact of the DC current supplied by the power supply in parallel with it
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Alternate current interference in pipeline; Interferencia por corrente alternada em dutos
Energy Technology Data Exchange (ETDEWEB)
Oliver, Joao Hipolito de Lima [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil)
2003-07-01
This paper regards to the concerning that the pipeline operators should take in to account to better understand and control the alternate current interference (AC- interference). Pipelines sharing rights-of-way with AC high voltage power lines are subjected to AC interference that can cause risk for personnel, operational safety and environment. The AC-interference shall be evaluated, in such way that mitigating action can be applied in order to assure the pipeline is operated in a safety way. The AC-interference evaluation should take in to account the pipeline and the electrical generation/transmission design data. Three approaches are considered: the coating integrity, the personnel chock hazards and the pipeline integrity. The coating integrity is affected by the possibility of high-voltage be induced on the pipeline during power line current fault. The operation and maintenance personnel can be prone to chock hazards (touch voltage and step voltage), depending upon the level of the induced voltage on the pipeline and the ground current. An induced voltage evaluation is then necessary to identify AC potentials in pipeline higher than the safe criteria. The pipeline integrity is concerning to the possibility of occurring alternate current corrosion (AC-corrosion) on the pipe wall. This kind of corrosion is still been investigated, and although it is less critical than the direct current corrosion, it can happen in specific situation. Parameters that affect AC-corrosion are discussed in this paper. Finely it is presented a brief guide to evaluate the possibility of occurring AC- interference in a pipeline and a mitigation measures summary. (author)
Design study of an AC power supply system in JT-60SA
International Nuclear Information System (INIS)
Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito
2011-01-01
In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.
Novel dielectric reduces corona breakdown in ac capacitors
Loehner, J. L.
1972-01-01
Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.
Wolfe, Elizabeth S; Bryant, Elizabeth A
The American College of Surgeons (ACS) mandates that each verified trauma center must have an injury prevention coordinator (IPC); however, Chapter 18 in the Resources for Optimal Care of the Injured Patient (2014) provides minimal information on how to effectively lead or manage an injury prevention (IP) program. This opinion article addresses 3 fundamental components of an effective IP program: (1) construction of an innovative vision of IP programming using current technology; (2) intentional investment and involvement; and (3) stakeholder leadership, engagement, and sustainability. This article also provides leadership and management methods from other professions both within and outside of the health care field that can be translated into sustainable IP program planning, implementation, and longevity.
Aruna, S. A.; Zhang, P.; Lin, F. Y.; Ding, S. Y.; Yao, X. X.
2000-04-01
Within the framework of the thermally activated process of the flux line or flux line bundles, and by time integration of the 1D equation of motion of the circulating current density icons/Journals/Common/vecJ" ALT="vecJ" ALIGN="TOP"/> (icons/Journals/Common/rho" ALT="rho" ALIGN="TOP"/> ,t ), which is suitable for thin superconducting films (R >>d ,icons/Journals/Common/le" ALT="le" ALIGN="TOP"/> icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/> ), we present numerical calculations of the current profiles, magnetization hysteresis loops and ac susceptibility icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> n = icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´n +iicons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´´n for n = 1, 3 and 5 of a thin disc immersed in an axial time-dependent external magnetic field Ba (t ) = Bdc +Bac cos(2icons/Journals/Common/pi" ALT="pi" ALIGN="TOP"/> icons/Journals/Common/nu" ALT="nu" ALIGN="TOP"/> t ). Our calculated results are compared with those of the critical state model (CSM) and found to prove the approximate validity of the CSM below the irreversibility field. The differences between our computed results and those of the CSM are also discussed.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk
2008-02-15
In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.
International Nuclear Information System (INIS)
Chen, A P; Zhukova, V; Zhukov, A; Dominguez, L; Chizhik, A; Blanco, J M; Gonzalez, J
2004-01-01
The influence of an ac magnetic field and the induced magnetic anisotropy (by field annealing and torsion annealing) on the magnetoimpedance (MI) tensor in an amorphous wire has been analysed. The experimental measurements were carried out in an amorphous wire of composition (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 , with a negative, nearly zero magnetostriction constant, excited either by an ac circular, h φ , or an axial, h z , magnetic field created by an ac electric current passing along the wire or through an exciting coil mounted on the wire, respectively. The ac current amplitude was changed from 7.5 to 40 mA and the current frequency f was varied from 1.5 to 20 MHz. The induced magnetic anisotropies modify the MI response drastically. The field annealed sample shows a unique peak of the MI effect, while the torsion annealed sample presents an asymmetric giant magnetoimpedance ratio associated with the induced magnetic anisotropy which provokes such thermal treatments
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Stability analysis of direct current control in current source rectifier
DEFF Research Database (Denmark)
Lu, Dapeng; Wang, Xiongfei; Blaabjerg, Frede
2017-01-01
Current source rectifier with high switching frequency has a great potential for improving the power efficiency and power density in ac-dc power conversion. This paper analyzes the stability of direct current control based on the time delay effect. Small signal model including dynamic behaviors...
Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI
2011-12-27
A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Protection of AC and DC Microgrids
DEFF Research Database (Denmark)
Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez
2015-01-01
and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...
Induced AC voltages on pipelines may present a serious hazard
International Nuclear Information System (INIS)
Kirkpatrick, E.L.
1997-01-01
The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Ac loss measurement of SSC dipole magnets
International Nuclear Information System (INIS)
Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.
1992-09-01
AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors
International Nuclear Information System (INIS)
Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen
2006-01-01
The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined
Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source
Energy Technology Data Exchange (ETDEWEB)
Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.
2015-04-08
A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.
Energy Technology Data Exchange (ETDEWEB)
Buechler, Markus; Voute, Carl-Heinz; Joos, David [SGK Schweizerische Gesellschaft fuer Korrosionsschutz, Zuerich (Switzerland)
2011-07-01
The current limiting values for corrosion of pipelines under a.c. current stress may be difficult to apply to pipelines, owing to the very heterogeneous bedding of the pipeline, poor jacket quality, or high short-term a.c. voltages. In principle, periodic alternation between very high and very low protective currents may optimize cathodic corrosion protection. This pulsed current strategy was found to be effective in laboratory tests if the operating parameters are set accurately.
Measurement of AC electrical characteristics of SSC superconducting dipole magnets
International Nuclear Information System (INIS)
Smedley, K.M.; Shafer, R.E.
1992-01-01
Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop
Calorimetric method of ac loss measurement in a rotating magnetic field
Energy Technology Data Exchange (ETDEWEB)
Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-07-15
A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
International Nuclear Information System (INIS)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-10-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.
Vosskuhl, J; Strüber, D; Herrmann, C S
2015-12-01
Transcranial alternating current stimulation (tACS) is a new technique for the modulation of oscillatory brain activity as measured in the electroencephalogram (EEG). In contrast to well-established stimulation techniques, such as transcranial direct current stimulation and transcranial magnetic stimulation, tACS applies a sinusoidal alternating current at a specific frequency. This enables the modulation of the amplitude and frequency of endogenous brain oscillations as well as related cognitive processes. Therefore, the use of tACS has the possibility to evaluate well-known correlations between brain oscillations and cognitive processes in terms of causality. Such causal relationships have been documented in numerous neurocognitive studies on sensory, motor and perceptual processes; however, the clinical application of tACS is still in its infancy. In principle, any pathology that can reliably be connected with brain oscillations of a defined frequency is treatable. A current main focus of clinical research is on symptoms of Parkinson's disease and to a lesser degree, tinnitus. For an effective application of tACS it is important to choose the electrode positions as well as the frequency, intensity and duration of the stimulation in a theory-based and symptom-related manner. A successful therapeutic intervention requires the persistence of the tACS effect after stimulation has ceased. A mechanism that offers not only an explanation to the origin of persistent tACS effects but is also of high therapeutic benefit is neural plasticity. Therefore, one current focus of research aims at a better understanding of tACS after effects.
Resonance reduction for AC drives with small capacitance in the DC link
DEFF Research Database (Denmark)
Máthé, Lászlo; Török, Lajos; Wang, Dong
2016-01-01
Pulse Width Modulated AC drives equipped with small DC-link capacitor are becoming an attractive solution for electric drive applications with moderate requirements for shaft dynamic performance. However, when these drives are fed from a weak grid a resonance between the line side impedance...... and the DC-link capacitor appears. Due to this resonance, the THD and the partially weighted harmonic distortion of the line currents are increased, which may rise compatibility problems with the AC line harmonic standards. By using vector control the motor drive is transformed into a constant power load...
Electrodeformation of multi-bilayer spherical concentric membranes by AC electric fields
Lira-Escobedo, J.; Arauz-Lara, J.; Aranda-Espinoza, H.; Adlerz, K.; Viveros-Mendez, P. X.; Aranda-Espinoza, S.
2017-09-01
It is now well established that external stresses alter the behaviour of cells, where such alterations can be as profound as changes in gene expression. A type of stresses of particular interest are those due to alternating-current (AC) electric fields. The effect of AC fields on cells is still not well understood, in particular it is not clear how these fields affect the cell nucleus and other organelles. Here, we propose that one possible mechanism is through the deformation of the membranes. In order to investigate the effect of AC fields on the morphological changes of the cell organelles, we modelled the cell as two concentric bilayer membranes. This model allows us to obtain the deformations induced by the AC field by balancing the elastic energy and the work done by the Maxwell stresses. Morphological phase diagrams are obtained as a function of the frequency and the electrical properties of the media and membranes. We demonstrate that the organelle shapes can be changed without modifying the shape of the external cell membrane and that the organelle deformation transitions can be used to measure, for example, the conductivity of the nucleus.
Surge Protection in Low-Voltage AC Power Circuits: An Anthology
Martzloff, F. D.
2002-10-01
The papers included in this part of the Anthology provide basic information on the propagation of surges in low-voltage AC power circuits. The subject was approached by a combination of experiments and theoretical considerations. One important distinction is made between voltage surges and current surges. Historically, voltage surges were the initial concern. After the introduction and widespread use of current-diverting surge-protective devices at the point-of-use, the propagation of current surges became a significant factor. The papers included in this part reflect this dual dichotomy of voltage versus current and impedance mismatch effects versus simple circuit theory.
DEFF Research Database (Denmark)
Heise, Kirstin Friederike; Kortzorg, Nick; Saturnino, Guilherme Bicalho
2016-01-01
Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage for ....... Conclusions: In comparison to the classic montage, the M1 centre-ring montage enables a more focal stimulation of the target area and, at the same time, significantly reduces neurosensory side effects, essential for placebo-controlled study designs.......Objective: To evaluate a modified electrode montage with respect to its effect on tACS-dependent modulation of corticospinal excitability and discomfort caused by neurosensory side effects accompanying stimulation. Methods: In a double-blind cross-over design, the classical electrode montage...... for primary motor cortex (M1) stimulation (two patch electrodes over M1 and contralateral supraorbital area) was compared with an M1 centre-ring montage. Corticospinal excitability was evaluated before, during, immediately after and 15 minutes after tACS (10 min., 20 Hz vs. 30 s low-frequency transcranial...
Lan, Chunbo; Tang, Lihua; Harne, Ryan L.
2018-05-01
Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.
Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations
International Nuclear Information System (INIS)
Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei
2016-01-01
Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
International Nuclear Information System (INIS)
Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P
2010-01-01
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
Energy Technology Data Exchange (ETDEWEB)
Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)
2010-02-21
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Dynamic voltage-current characteristics for a water jet plasma arc
International Nuclear Information System (INIS)
Yang Jiaxiang; Lan Sheng; Xu Zuoming
2008-01-01
A virtual instrument technology is used to measure arc current, arc voltage, dynamic V-I characteristics, and nonlinear conductance for a cone-shaped water jet plasma arc under ac voltage. Experimental results show that ac arc discharge mainly happens in water vapor evaporated from water when heated. However, due to water's cooling effect and its conductance, arc conductance, reignition voltage, extinguish voltage, and current zero time are very different from those for ac arc discharge in gas work fluid. These can be valuable to further studies on mechanism and characteristics of plasma ac discharge in water, and even in gas work fluid
International Nuclear Information System (INIS)
Bell, Christopher G.; Anastassiou, Costas A.; O’Hare, Danny; Parker, Kim H.; Siggers, Jennifer H.
2012-01-01
Highlights: ► Theory of ac voltammetry on ideal surface-confined redox systems. ► Analytical description of the harmonics and transient of the current response. ► Solution valid for high frequency, large-amplitude sinusoidal input voltage. ► Protocol for determining system parameters from experimental current responses. - Abstract: Large-amplitude ac voltammetry, where the applied voltage is a large-amplitude sinusoidal waveform superimposed onto a dc ramp, is a powerful method for investigating the reaction kinetics of surface-confined redox species. Here we consider the large-amplitude ac voltammetric current response of a quasi-reversible, ideal, surface-confined redox system, for which the redox reaction is described by Butler–Volmer theory. We derive an approximate analytical solution, which is valid whenever the angular frequency of the sine-wave is much larger than the rate of the dc ramp and the standard kinetic rate constant of the redox reaction. We demonstrate how the third harmonic and the initial transient of the current response can be used to estimate parameters of the electrochemical system, namely the kinetic rate constant, the electron transfer coefficient, the adsorption formal potential, the initial proportion of oxidised molecules and the linear double-layer capacitance.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Energy Technology Data Exchange (ETDEWEB)
Che' Rose, Simon
2007-01-15
In this work magneto-optical measurements on YBa{sub 2}Cu{sub 3}O{sub 7-x} and MgB{sub 2} thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB{sub 2} the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)
AC losses in high Tc superconductors
International Nuclear Information System (INIS)
Campbell, A.M.
1998-01-01
Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments
Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.
Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J
2007-09-01
The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.
ACS experiment for atmospheric studies on "ExoMars-2016" Orbiter
Korablev, O. I.; Montmessin, F.; Fedorova, A. A.; Ignatiev, N. I.; Shakun, A. V.; Trokhimovskiy, A. V.; Grigoriev, A. V.; Anufreichik, K. A.; Kozlova, T. O.
2015-12-01
ACS is a set of spectrometers for atmospheric studies (Atmospheric Chemistry Suite). It is one of the Russian instruments for the Trace Gas Orbiter (TGO) of the Russian-European "ExoMars" program. The purpose of the experiment is to study the Martian atmosphere by means of two observations regimes: sensitive trace gases measurements in solar occultations and by monitoring the atmospheric state during nadir observations. The experiment will allow us to approach global problems of Mars research such as current volcanism, and the modern climate status and its evolution. Also, the experiment is intended to solve the mystery of methane presence in the Martian atmosphere. Spectrometers of the ACS set cover the spectral range from the near IR-range (0.7 μm) to the thermal IR-range (17 μm) with spectral resolution λ/Δλ reaching 50000. The ACS instrument consists of three independent IR spectrometers and an electronics module, all integrated in a single unit with common mechanical, electrical and thermal interfaces. The article gives an overview of scientific tasks and presents the concept of the experiment.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
AC losses in multilayer power transmission cables comprised of YBCO tapes
International Nuclear Information System (INIS)
Noji, H.
2011-01-01
I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.
A new DC/AC boost transformerless converter in application of photovoltaic power generation
DEFF Research Database (Denmark)
Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....
Magnetic Particle inspection by DC and AC magnetization current
International Nuclear Information System (INIS)
Lim, Zhong Soo; Kim, Goo Hwa
1996-01-01
Dry magnetic particle inspection was performed to detect the surface defects of the steel billets. The detectability was evaluated according to magnetizing current, temperature, and amount of the magnetic particles on material. We selected a certain set of steel compositions for target materials. Their magnetic properties are measured with B-H hysteresis graph. Results of the magnetic particle inspection(MPI) by direct magnetizing current was compared with results of the finite element method calculations, which were verified by measurement of the magnetic leakage flux above the surface of material. For square rod materials, the magnetic flux density at the corner was about 30% of that at the face center with sufficiently large direct magnetizing current, while it is about 70% with alternating magnetizing current. Alternating magnetizing current generates rather uniform magnetic flux density running from the center to the corner except for the region of about 10 mm extending from the corner.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
The complex ac susceptibility of superconducting Y-Ba-CuO thin film and bulk samples
International Nuclear Information System (INIS)
Lobotka, P.; Goemoery, F.
1988-01-01
Complex ac susceptibility measurements as function of temperature on Y-Ba-CuO superconductors are reported. A strong dependence of the susceptibility curves on the ac field magnitude and little influence of the superimposed dc field are observed on both, thin film and bulk samples. The susceptibilities of these materials are frequency independent in the range 30 to 7200 Hz what demonstrates the negligible role of eddy currents. A second peak in the imaginary part of susceptibility is observed in the bulk sample at higher levels of ac field. This implies the existence of another component in the sample with higher T c and lower losses. (author)
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
DEFF Research Database (Denmark)
Yang, Ling; Chen, Yandong; Luo, An
2017-01-01
With the increasing of AC loads injected into DC microgird (MG) through the inverters, the second ripple current (SRC) in the front-end energy storage converter (ESC) and circulating current among the ESCs in DC MG become more and more serious. In this paper, the SRC suppression method by introdu......With the increasing of AC loads injected into DC microgird (MG) through the inverters, the second ripple current (SRC) in the front-end energy storage converter (ESC) and circulating current among the ESCs in DC MG become more and more serious. In this paper, the SRC suppression method...
Development of Nb3Sn AC superconducting wire. Pt. 2
International Nuclear Information System (INIS)
Kasahara, Hobun; Torii, Shinji; Akita, Shirabe; Ueda, Kiyotaka; Kubota, Yoji; Yasohama, Kazuhiko; Kobayashi, Hisayasu; Ogasawara, Takeshi.
1993-01-01
For the realization of superconducting power apparatus, it is important that the development of highly stable superconducting cables. Nb 3 Sn wire has higher critical temperature than NbTi wire. Therefore, it is possible to make highly stable superconducting wires. In this report, we examine a manufacturing process of Ac Nb 3 Sn wire. This manufacturing process has four times higher critical current density than conventional processes. We have made a 400 kVA class AC coil with React and Wind method. The loss density of this coil was 20MW/m 3 at just before the quench. In this case, the temperature of cable increased about 3.8 K. This means that the Nb 3 Sn coil has a very high stability. (author)
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
DEFF Research Database (Denmark)
Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin
2008-01-01
The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and....../or various distributed generation systems. Effective and accurate power flow control is demonstrated through simulation in Matlab- Simulink environment on a model based on a two-port structure and using a Predictive Control technique. Control of different Power flow profiles has been successfully tested...
Equivalence of Primary Control Strategies for AC and DC Microgrids
Directory of Open Access Journals (Sweden)
Eneko Unamuno
2017-01-01
Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.
Ac hopping conduction at extreme disorder takes place on the percolating cluster
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, J. C.
2008-01-01
Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.
2017-07-21
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.
ACS sampling system: design, implementation, and performance evaluation
Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca
2004-09-01
By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.
DEFF Research Database (Denmark)
Denisov, S.; Flach, S.; Ovchinnikov, A. A.
2002-01-01
We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response is em...... is employed to explain the effect. We consider a case of a particle in a periodic potential as an example and discuss the relevant symmetry breakings and the mechanisms of rectification of the current in such a system.......We consider low-dimensional dynamical systems exposed to a heat bath and to additional ac fields. The presence of these ac fields may lead to a breaking of certain spatial or temporal symmetries, which in turn cause nonzero averages of relevant observables. Nonlinear (non)adiabatic response...
AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor
International Nuclear Information System (INIS)
Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.
2011-01-01
Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.
Method to predetermine current/power flow change in a dc grid
DEFF Research Database (Denmark)
2017-01-01
occurs at one of the AC/DC converters; establishing a generalized droop feedback gain matrix G; controlling current/power flow within DC grid towards predefined setpoints, by use of control law. The invention presents an analytical approach to derive the generalized feedback gain allowing......The invention relates to a method for controlling current/power flow within a power transmission system, comprising two or more interconnected converter stations. The method comprises the steps of: providing a DC admittance matrix given from the DC grid; providing a current distribution matrix...... for a number of, such as for all possible AC/DC converter outages; providing a DC bus voltage vector for the DC grid; the DC bus voltage vector being a vector containing the values of the voltage change at the AC/DC converters, measured at the AC/DC converters, before, during and after a forced current change...
AC magnetic transport on heterogeneous ferromagnetic wires and tubes
International Nuclear Information System (INIS)
Sinnecker, J.P.; Pirota, K.R.; Knobel, M.; Kraus, L.
2002-01-01
The AC current density radial distribution is calculated on heterogeneous composite materials with cylindrical geometry. The composites have an inner core and thin outer shell that can be either from the same material (homogenous material like simple wires) or from different materials with different physical properties. The case in which a non-magnetic inner core is surrounded by a magnetic layer, like electrodeposited wires, is mainly studied. The effect of frequency and applied magnetic field is simulated. The current density distribution as a function of frequency and applied field, as well as the total current over the inner core and outer shells are calculated. The results agree substantially well with the experimentally observed data for simple electrodeposited wires
Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding
DEFF Research Database (Denmark)
Liu, Dong; Polinder, Henk; Magnusson, Niklas
2016-01-01
Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...
Current status of quantum electrical metrology
International Nuclear Information System (INIS)
Urano, Chiharu; Kaneko, Nobuhisa; Kiryu, Shogo
2005-01-01
Physical background, current status of proof systems and researches of the next generation standards of Josephson voltage and Quantized Hall Resistance (QHR) standard system are described. Josephson effect, the principle and theory of quantized hall effect, usual voltage standard system, standard feed of direct current resistance, and researches of voltage standard and direct current resistance standard are explained. The current-voltage of Josephson element in the usual voltage standard proof system and bias method, outline of typical Josephson voltage standard proof system and GaAs/AlGaAs heterostructure used as resistance standard are stated. Cryogenic Current Comparator (CCC) and Direct Current Comparator (DCC) proofread usual resistor. New Quantum Hall Array Resistance Standard (QHARS) is studied by BNM-LNE group in French, and the other new AC Quantized Hall Resistance (AC-QHR) by the European ACQHE Project. (S.Y.)
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Development of magneto-rheologial fluid (MRF) based clutch for output torque control of AC motors
Nguyen, Q. Hung; Do, H. M. Hieu; Nguyen, V. Quoc; Nguyen, N. Diep; Le, D. Thang
2018-03-01
In industry, the AC motor is widely used because of low price, power availability, low cost maintenance. The main disadvantages of AC motors compared to DC motors are difficulty in speed and torque control, requiring expensive controllers with complex control algorithms. This is the basic limitations in the widespread adoption of AC motor systems for industrial automation. One feasible solution for AC motor control is using MRF (magneto-rheological fluid) based clutches (shortly called MR clutches) Although there have been many studies on MR clutches, most of these clutches used traditional configuration with coils wound on the middle cylindrical part and a compotator is used to supply power to the coils. Therefore, this type of MR clutches possesses many disadvantages such as high friction and unstable applied current due to commutator, complex structure which causes difficulty in manufacture, assembly, and maintenance. In addition, the bottleneck problem of magnetic field is also a challenging issue. In this research, we will develop a new type of MR clutches that overcomes the abovementioned disadvantages of traditional MR clutches and more suitable for application in controlling of AC motor. Besides, in this study, speed and torque control system for AC motors using developed MR clutches is designed and experimental validated.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan
2014-09-22
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan; Cha, Min; Chung, Suk-Ho
2014-01-01
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
Analytical solution of the PNP equations at AC applied voltage
International Nuclear Information System (INIS)
Golovnev, Anatoly; Trimper, Steffen
2012-01-01
A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.
Design and implementation of co-operative control strategy for hybrid AC/DC microgrids
Mahmud, Rasel
This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper
Apparatuses and method for converting electromagnetic radiation to direct current
Kotter, Dale K; Novack, Steven D
2014-09-30
An energy conversion device may include a first antenna and a second antenna configured to generate an AC current responsive to incident radiation, at least one stripline, and a rectifier coupled with the at least one stripline along a length of the at least one stripline. An energy conversion device may also include an array of nanoantennas configured to generate an AC current in response to receiving incident radiation. Each nanoantenna of the array includes a pair of resonant elements, and a shared rectifier operably coupled to the pair of resonant elements, the shared rectifier configured to convert the AC current to a DC current. The energy conversion device may further include a bus structure operably coupled with the array of nanoantennas and configured to receive the DC current from the array of nanoantennas and transmit the DC current away from the array of nanoantennas.
Alizadeh Sahraei, Abolfazl; Ayati, Moosa; Baniassadi, Majid; Rodrigue, Denis; Baghani, Mostafa; Abdi, Yaser
2018-03-01
This study attempts to comprehensively investigate the effects of multi-walled carbon nanotubes (MWCNTs) on the AC and DC electrical conductivity of epoxy nanocomposites. The samples (0.2, 0.3, and 0.5 wt. % MWCNT) were produced using a combination of ultrason and shear mixing methods. DC measurements were performed by continuous measurement of the current-voltage response and the results were analyzed via a numerical percolation approach, while for the AC behavior, the frequency response was studied by analyzing phase difference and impedance in the 10 Hz to 0.2 MHz frequency range. The results showed that the dielectric parameters, including relative permittivity, impedance phase, and magnitude, present completely different behaviors for the frequency range and MWCNT weight fractions studied. To better understand the nanocomposites electrical behavior, equivalent electric circuits were also built for both DC and AC modes. The DC equivalent networks were developed based on the current-voltage curves, while the AC equivalent circuits were proposed by using an optimization problem according to the impedance magnitude and phase at different frequencies. The obtained equivalent electrical circuits were found to be highly useful tools to understand the physical mechanisms involved in MWCNT filled polymer nanocomposites.
Calculation of AC losses in large HTS stacks and coils
DEFF Research Database (Denmark)
Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad
2012-01-01
In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
AC loss in superconducting wires operating in a wind turbine like generator
DEFF Research Database (Denmark)
Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad
2010-01-01
We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...
Fluid Flow and Mixing Induced by AC Continuous Electrowetting of Liquid Metal Droplet
Directory of Open Access Journals (Sweden)
Qingming Hu
2017-04-01
Full Text Available In this work, we proposed a novel design of a microfluidic mixer utilizing the amplified Marangoni chaotic advection induced by alternating current (AC continuous electrowetting of a metal droplet situated in electrolyte solution, due to the linear and quadratic voltage-dependence of flow velocity at small or large voltages, respectively. Unlike previous researchers exploiting the unidirectional surface stress with direct current (DC bias at droplet/medium interface for pumping of electrolytes where the resulting flow rate is linearly proportional to the field intensity, dominance of another kind of dipolar flow pattern caused by local Marangoni stress at the drop surface in a sufficiently intense AC electric field is demonstrated by both theoretical analysis and experimental observation, which exhibits a quadratic growth trend as a function of the applied voltage. The dipolar shear stress merely appears at larger voltages and greatly enhances the mixing performance by inducing chaotic advection between the neighboring laminar flow. The mixer design developed herein, on the basis of amplified Marangoni chaotic advection around a liquid metal droplet at larger AC voltages, has great potential for chemical reaction and microelectromechanical systems (MEMS actuator applications because of generating high-throughput and excellent mixing performance at the same time.
Auditory Cortex tACS and tRNS for Tinnitus: Single versus Multiple Sessions
Directory of Open Access Journals (Sweden)
Laura Claes
2014-01-01
Full Text Available Tinnitus is the perception of a sound in the absence of an external acoustic source, which often exerts a significant impact on the quality of life. Currently there is evidence that neuroplastic changes in both neural pathways are involved in the generation and maintaining of tinnitus. Neuromodulation has been suggested to interfere with these neuroplastic alterations. In this study we aimed to compare the effect of two upcoming forms of transcranial electrical neuromodulation: alternating current stimulation (tACS and random noise stimulation (tRNS, both applied on the auditory cortex. A database with 228 patients with chronic tinnitus who underwent noninvasive neuromodulation was retrospectively analyzed. The results of this study show that a single session of tRNS induces a significant suppressive effect on tinnitus loudness and distress, in contrast to tACS. Multiple sessions of tRNS augment the suppressive effect on tinnitus loudness but have no effect on tinnitus distress. In conclusion this preliminary study shows a possibly beneficial effect of tRNS on tinnitus and can be a motivation for future randomized placebo-controlled clinical studies with auditory tRNS for tinnitus. Auditory alpha-modulated tACS does not seem to be contributing to the treatment of tinnitus.
Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC
Directory of Open Access Journals (Sweden)
Haifeng Liang
2015-08-01
Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.
A novel wireless power and data transmission AC to DC converter for an implantable device.
Liu, Jhao-Yan; Tang, Kea-Tiong
2013-01-01
This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.
Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape
Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin
2017-12-01
Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.
Nguyen, Doan Ngoc
Alternating current (AC) loss and current carrying capacity are two of the most crucial considerations in large-scale power applications of high temperature superconducting (HTS) conductors. AC losses result in an increased thermal load for cooling machines, and thus increased operating costs. Furthermore, AC losses can stimulate quenching phenomena or at least decrease the stability margin for superconducting devices. Thus, understanding AC losses is essential for the development of HTS AC applications. The main focus of this dissertation is to make reliable total AC loss measurements and interpret the experimental results in a theoretical framework. With a specially designed magnet, advanced total AC loss measurement system in liquid nitrogen (77 K) has been successfully built. Both calorimetric and electromagnetic methods were employed to confirm the validity of the measured results and to have a more thorough understanding of AC loss in HTS conductors. The measurement is capable of measuring total AC loss in HTS tapes over a wide range of frequency and amplitude of transport current and magnetic field. An accurate phase control technique allows measurement of total AC loss with any phase difference between the transport current and magnetic field by calorimetric method. In addition, a novel total AC loss measurement system with variable temperatures from 30 K to 100 K was successfully built and tested. Understanding the dependence of AC losses on temperature will enable optimization of the operating temperature and design of HTS devices. As a part of the dissertation, numerical calculations using Brandt's model were developed to study electrodynamics and total AC loss in HTS conductors. In the calculations, the superconducting electrical behavior is assumed to follow a power-law model. In general, the practical properties of conductors, including field-dependence of critical current density Jc, n-value and non-uniform distribution of Jc, can be accounted for in
Hopfinger, Joseph B; Parsons, Jonathan; Fröhlich, Flavio
2017-04-01
Previous electrophysiological studies implicate both alpha (8-12 Hz) and gamma (>30 Hz) neural oscillations in the mechanisms of selective attention. Here, participants preformed two separate visual attention tasks, one endogenous and one exogenous, while transcranial alternating current stimulation (tACS), at 10 Hz, 40 Hz, or sham, was applied to the right parietal lobe. Our results provide new evidence for the roles of gamma and alpha oscillations in voluntary versus involuntary shifts of attention. Gamma (40 Hz) stimulation resulted in improved disengagement from invalidly cued targets in the endogenous attention task, whereas alpha stimulation (10 Hz) had no effect on endogenous attention, but increased the exogenous cuing effect. These findings agree with previous studies suggesting that right inferior parietal regions may be especially important for the disengagement of attention, and go further to provide details about the specific type of oscillatory neural activity within that brain region that is differentially involved in endogenous versus exogenous attention. Our results also have potential implications for the plasticity and training of attention systems.
Implementation and Evaluation of WLAN 802.11ac for Residential Networks in NS-3
Directory of Open Access Journals (Sweden)
Andy Bubune Amewuda
2018-01-01
Full Text Available Wi-Fi has been an amazingly successful technology. Its success may be attributed to the fact that, despite the significant advances made in technology over the last decade, it has remained backward compatible. 802.11ac is the latest version of the wireless LAN (WLAN standard that is currently being adopted, and it promises to deliver very high throughput (VHT, operating at the 5 GHz band. In this paper, we report on an implementation of 802.11ac wireless LAN for residential scenario based on the 802.11ax task group scenario document. We evaluate the 802.11ac protocol performance under different operating conditions. Key features such as modulation coding set (MCS, frame aggregation, and multiple-input multiple-output (MIMO were investigated. We also evaluate the average throughput, delay, jitter, optimum range for goodput, and effect of station (STA density per access point (AP in a network. ns-3, an open source network simulator with features supporting 802.11ac, was used to perform the simulation. Results obtained indicate that very high data rates are achievable. The highest data rate, the best mean delay, and mean jitter are possible under combined features of 802.11ac (MIMO and A-MPDU.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Williamson, James M.; Trump, Darryl D.; Bletzinger, Peter; Ganguly, Biswa N.
2006-10-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s-1. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ~3 × 1015 cm-3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ~8.5 × 1015 cm-3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer
Directory of Open Access Journals (Sweden)
Phuc Thinh Doan
2013-06-01
Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Stability of alternating current gliding arcs
DEFF Research Database (Denmark)
Kusano, Yukihiro; Salewski, Mirko; Leipold, Frank
2014-01-01
on Ohm’s law indicates that the critical length of alternating current (AC) gliding arc discharge columns can be larger than that of a corresponding direct current (DC) gliding arc. This finding is supported by previously published images of AC and DC gliding arcs. Furthermore, the analysis shows......A gliding arc is a quenched plasma that can be operated as a non-thermal plasma at atmospheric pressure and that is thus suitable for large-scale plasma surface treatment. For its practical industrial use the discharge should be extended stably in ambient air. A simple analytical calculation based...... that the critical length can be increased by increasing the AC frequency, decreasing the serial resistance and lowering the gas flow rate. The predicted dependence of gas flow rate on the arc length is experimentally demonstrated. The gap width is varied to study an optimal electrode design, since the extended non...
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
International Nuclear Information System (INIS)
Moore, Martina; Roth, Stefan; Gebert, Annett; Schultz, Ludwig; Gutfleisch, Oliver
2015-01-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
Energy Technology Data Exchange (ETDEWEB)
Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)
2015-02-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Effect of Alternating Current on the Cathodic Protection and Interface Structure of X80 Steel
Directory of Open Access Journals (Sweden)
Huiru Wang
2017-07-01
Full Text Available This study employs potential-monitoring techniques, cyclic voltammetry tests, alternating current (AC voltammetry methods, and surface characterization to investigate the AC corrosion of cathodically protected X80 pipeline steel. In a non-passive neutral solution at pH 7.2, a sufficiently negative potential completely protects steel at an AC current density of 100 A/m2. In an alkaline solution at pH 9.6, more serious AC corrosion occurs at more negative cathodic protection (CP potential, whereas without CP the steel suffers negligible corrosion. In addition, the interface capacitance increases with AC amplitude. Based on these results, the AC corrosion mechanisms that function under various conditions are analyzed and described.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Technical feasibility and reliability of passive safety systems of AC600
International Nuclear Information System (INIS)
Niu, W.; Zeng, X.
1996-01-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished by the Nuclear Power Institute of China. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also
Technical feasibility and reliability of passive safety systems of AC600
Energy Technology Data Exchange (ETDEWEB)
Niu, W; Zeng, X [Nuclear Power Inst. of China, Chendu (China)
1996-12-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also involved. (author). 3 figs, 1 tab.
The Effects of 10 Hz Transcranial Alternating Current Stimulation on Audiovisual Task Switching
Directory of Open Access Journals (Sweden)
Michael S. Clayton
2018-02-01
Full Text Available Neural oscillations in the alpha band (7–13 Hz are commonly associated with disengagement of visual attention. However, recent studies have also associated alpha with processes of attentional control and stability. We addressed this issue in previous experiments by delivering transcranial alternating current stimulation at 10 Hz over posterior cortex during visual tasks (alpha tACS. As this stimulation can induce reliable increases in EEG alpha power, and given that performance on each of our visual tasks was negatively associated with alpha power, we assumed that alpha tACS would reliably impair visual performance. However, alpha tACS was instead found to prevent both deteriorations and improvements in visual performance that otherwise occurred during sham & 50 Hz tACS. Alpha tACS therefore appeared to exert a stabilizing effect on visual attention. This hypothesis was tested in the current, pre-registered experiment by delivering alpha tACS during a task that required rapid switching of attention between motion, color, and auditory subtasks. We assumed that, if alpha tACS stabilizes visual attention, this stimulation should make it harder for people to switch between visual tasks, but should have little influence on transitions between auditory and visual subtasks. However, in contrast to this prediction, we observed no evidence of impairments in visuovisual vs. audiovisual switching during alpha vs. control tACS. Instead, we observed a trend-level reduction in visuoauditory switching accuracy during alpha tACS. Post-hoc analyses showed no effects of alpha tACS in response time variability, diffusion model parameters, or on performance of repeat trials. EEG analyses also showed no effects of alpha tACS on endogenous or stimulus-evoked alpha power. We discuss possible explanations for these results, as well as their broader implications for current efforts to study the roles of neural oscillations in cognition using tACS.
Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire
International Nuclear Information System (INIS)
Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J
2006-01-01
Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Characterization and snubbing of a bidirectional MCT in a resonant ac link converter
Lee, Tony; Elbuluk, Malik E.; Zinger, Donald S.
1993-01-01
The MOS-Controlled Thyristor (MCT) is emerging as a powerful switch that combines the better characteristics of existing power devices. A study of switching stresses on an MCT switch under zero voltage resonant switching is presented. The MCT is used as a bidirectional switch in an ac/ac pulse density modulated inverter for induction motor drive. Current and voltage spikes are observed and analyzed with variations in the timing of the switching. Different snubber circuit configurations are under investigation to minimize the effect of these transients. The results will be extended to study and test the MCT switching in a medium power (5 hp) induction motor drive.
International Nuclear Information System (INIS)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A; Rodriguez-Zermeno, Victor M; Hong Zhiyong
2011-01-01
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
Energy Technology Data Exchange (ETDEWEB)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)
2011-04-15
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles
International Nuclear Information System (INIS)
Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.
2015-01-01
This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI
Efficiency estimation method of three-wired AC to DC line transfer
Solovev, S. V.; Bardanov, A. I.
2018-05-01
The development of power semiconductor converters technology expands the scope of their application to medium voltage distribution networks (6-35 kV). Particularly rectifiers and inverters of appropriate power capacity complement the topology of such voltage level networks with the DC links and lines. The article presents a coefficient that allows taking into account the increase of transmission line capacity depending on the parameters of it. The application of the coefficient is presented by the example of transfer three-wired AC line to DC in various methods. Dependences of the change in the capacity from the load power factor of the line and the reactive component of the resistance of the transmission line are obtained. Conclusions are drawn about the most efficient ways of converting a three-wired AC line to direct current.
Data for spatial characterization of AC signal propagation over primary neuron dendrites
Directory of Open Access Journals (Sweden)
Hojeong Kim
2016-03-01
Full Text Available Action potentials generated near the soma propagate not only into the axonal nerve connecting to the adjacent neurons but also into the dendrites interacting with a diversity of synaptic inputs as well as voltage gated ion channels. Measuring voltage attenuation factors between the soma and all single points of the dendrites in the anatomically reconstructed primary neurons with the same cable properties, we report the signal propagation data showing how the alternating current (AC signal such as action potentials back-propagates over the dendrites among different types of primary neurons. Fitting equations and their parameter values for the data are also presented to quantitatively capture the spatial profile of AC signal propagation from the soma to the dendrites in primary neurons. Our data is supplemental to our original study for the dependency of dendritic signal propagation and excitability, and their relationship on the cell type-specific structure in primary neurons (DOI: 10.1016/j.neulet.2015.10.017 [1]. Keywords: Primary neurons, Dendritic signal processing, AC signal propagation, Voltage attenuation analysis
Directory of Open Access Journals (Sweden)
Fuangpian Phanupong
2016-01-01
Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
International Nuclear Information System (INIS)
Thamilselvan, M.; PremNazeer, K.; Mangalaraj, D.; Narayandass, Sa.K.; Yi, Junsin
2004-01-01
X-ray diffraction analysis of GaSe thin films used in the present investigation showed that the as-deposited and the one deposited at higher substrate temperature are in amorphous and polycrystalline state, respectively. The alternating current (ac) conduction properties of thermally evaporated films of GaSe were studied ex situ employing symmetric aluminium ohmic electrodes in the frequency range of 120-10 5 Hz at various temperature regimes. For the film deposited at elevated substrate temperature (573 K) the ac conductivity was found to increase with improvement of its crystalline structure. The ac conductivity (σ ac ) is found to be proportional to (ω s ) where s m calculated from ac conductivity measurements are compared with optical studies of our previous reported work for a-GaSe and poly-GaSe thin films. The distance between the localized centres (R), activation energy (ΔE σ ) and the number of sites per unit energy per unit volume N(E F ) at the Fermi level were evaluated for both a-GaSe and poly-GaSe thin films. Goswami and Goswami model has been invoked to explain the dependence of capacitance on frequency and temperature
Sheng, Kaixuan; Sun, Yiqing; Li, Chun; Yuan, Wenjing; Shi, Gaoquan
2012-02-01
The recent boom in multifunction portable electronic equipments requires the development of compact and miniaturized electronic circuits with high efficiencies, low costs and long lasting time. For the operation of most line-powered electronics, alternating current (ac) line-filters are used to attenuate the leftover ac ripples on direct current (dc) voltage busses. Today, aluminum electrolytic capacitors (AECs) are widely applied for this purpose. However, they are usually the largest components in electronic circuits. Replacing AECs by more compact capacitors will have an immense impact on future electronic devices. Here, we report a double-layer capacitor based on three-dimensional (3D) interpenetrating graphene electrodes fabricated by electrochemical reduction of graphene oxide (ErGO-DLC). At 120-hertz, the ErGO-DLC exhibited a phase angle of -84 degrees, a specific capacitance of 283 microfaradays per centimeter square and a resistor-capacitor (RC) time constant of 1.35 milliseconds, making it capable of replacing AECs for the application of 120-hertz filtering.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
Energy Technology Data Exchange (ETDEWEB)
Williamson, James M [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Trump, Darryl D [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Bletzinger, Peter [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Ganguly, Biswa N [Air Force Research Laboratory, Wright-Patterson Air Force Base, Ohio 45433-7919 (United States)
2006-10-21
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s{sup -1}. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of {approx}3 x 10{sup 15} cm{sup -3} at 25 W. The maximum ozone production achieved by short-pulse excitation was {approx}8.5 x 10{sup 15} cm{sup -3} at 20 W, which was four times greater than that achieved by ac excitation at the same power level.
Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge
International Nuclear Information System (INIS)
Williamson, James M; Trump, Darryl D; Bletzinger, Peter; Ganguly, Biswa N
2006-01-01
A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s -1 . The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ∼3 x 10 15 cm -3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ∼8.5 x 10 15 cm -3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level
Transport ac loss in a rectangular thin strip with power-law E(J) relation
International Nuclear Information System (INIS)
Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin
2015-01-01
Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case
Energy Technology Data Exchange (ETDEWEB)
He, X.; Jiang, G.; Qiu, Y.; Tang, H. [College of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan (China); Zhang, G.; Jin, X.; Xiang, Z. [Huazhong Natural Gas Subsidiary of PetroChina Pipeline Company, Wuhan (China); Zhang, Z. [Dwell Company Limited, PetroChina Engineering Company, Ltd, Beijing (China)
2012-06-15
Interference of alternative current (AC) on corrosion of X65 steel was investigated in soil. It was observed that the unfavorable effect of interfering AC was able to be effectively inhibited by increasing the direct current density of the cathodic protection (CP) system. A clear correlation was established between the CP current density and the tolerable AC current density. This led to a new criterion for assuring the effectiveness of CP of buried pipelines being interfered with AC. Field experimental results on a buried pipeline running below a 500 kV transmission line showed that the criterion could satisfactorily predict the risk of AC interfering on the CP system. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Comparison of the converter systems for a high-voltage variable-frequency AC drive
Directory of Open Access Journals (Sweden)
G.G. Zhemerov
2013-12-01
Full Text Available Matlab-models of two converter systems of an 8 MW AC drive are developed, one based on a self-contained current inverter with cut-off diodes, the other based on a multilevel cascade voltage inverter. By applying virtual simulation, qualitative characteristics of these systems are compared.
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)
2003-02-01
We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)
2007-04-15
A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
DC-Compensated Current Transformer.
Ripka, Pavel; Draxler, Karel; Styblíková, Renata
2016-01-20
Instrument current transformers (CTs) measure AC currents. The DC component in the measured current can saturate the transformer and cause gross error. We use fluxgate detection and digital feedback compensation of the DC flux to suppress the overall error to 0.15%. This concept can be used not only for high-end CTs with a nanocrystalline core, but it also works for low-cost CTs with FeSi cores. The method described here allows simultaneous measurements of the DC current component.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Individual magnetization reversal of a square dot matrix by common current excitation
International Nuclear Information System (INIS)
Elyasi, Mehrdad; Bhatia, Charanjit S; Yang, Hyunsoo
2015-01-01
We have proposed a method for magnetization reversal of individual sites of a 2 by 2 matrix of perpendicularly magnetized dots by common current excitation. The spin-polarized current signal consists of a dc-biased ac part followed by a pure dc one. The amplitude of the dc and ac parts of the current, as well as the phase and duration of the ac current, determine the reversal sites through the magnetostatic interaction among the dots. We show that the individual selectivity in magnetization reversal occurs through two consecutive steps, dephasing of the matrix dyadic pairs dynamics followed by nonlinear dephasing of the individual elements. This method can be utilized to increase the storage density of magnetic random access memory by enabling common access for four or more bits. (paper)
Directory of Open Access Journals (Sweden)
Sungyoon Song
2017-08-01
Full Text Available In the Korean power system, growing power loads have recently created the problems of voltage instability and fault current in the Seoul Capital Area (SCA. Accordingly, the back-to-back (BTB voltage source converter (VSC high-voltage direct-current (HVDC system is emerging to resolve such problems with grid segmentation. However, non-convergence problems occur in this metropolitan area, due to the large change of power flow in some contingencies. Therefore, this paper proposes two kinds of AC transmission emulation control (ATEC strategies to improve the metropolitan transient stability, and to resolve the non-convergence problem. The proposed ATEC strategies are able to mitigate possible overloading of adjacent AC transmission, and maintain power balance between metropolitan regions. The first ATEC strategy uses a monitoring system that permits the reverse power flow of AC transmission, and thus effectively improves the grid stability based on the power transfer equation. The second ATEC strategy emulates AC transmission with DC link capacitors in a permissible DC-link voltage range according to angle difference, and securely improves the gird stability, without requiring grid operator schedule decisions. This paper compares two kinds of ATEC schemes: it demonstrates the first ATEC strategy with specific fault scenario with PSS/E (Power Transmission System Planning Software, and evaluates the second ATEC strategy with internal controller performance with PSCAD/EMTDC (Power System Electromagnetic Transients Simulation Software.
Development of software to improve AC power quality on large spacecraft
Kraft, L. Alan
1991-01-01
To insure the reliability of a 20 kHz, alternating current (AC) power system on spacecraft, it is essential to analyze its behavior under many adverse operating conditions. Some of these conditions include overloads, short circuits, switching surges, and harmonic distortions. Harmonic distortions can become a serious problem. It can cause malfunctions in equipment that the power system is supplying, and, during distortions such as voltage resonance, it can cause equipment and insulation failures due to the extreme peak voltages. To address the harmonic distortion issue, work was begun under the 1990 NASA-ASEE Summer Faculty Fellowship Program. Software, originally developed by EPRI, called HARMFLO, a power flow program capable of analyzing harmonic conditions on three phase, balanced, 60 Hz AC power systems, was modified to analyze single phase, 20 kHz, AC power systems. Since almost all of the equipment used on spacecraft power systems is electrically different from equipment used on terrestrial power systems, it was also necessary to develop mathematical models for the equipment to be used on the spacecraft. The modelling was also started under the same fellowship work period. Details of the modifications and models completed during the 1990 NASA-ASEE Summer Faculty Fellowship Program can be found in a project report. As a continuation of the work to develop a complete package necessary for the full analysis of spacecraft AC power system behavior, deployment work has continued through NASA Grant NAG3-1254. This report details the work covered by the above mentioned grant.
Real-time control for long ohmic alternate current discharges
International Nuclear Information System (INIS)
Carvalho, Ivo S.; Duarte, Paulo; Fernandes, Horácio; Valcárcel, Daniel F.; Carvalho, Pedro J.; Silva, Carlos; Duarte, André S.; Neto, André; Sousa, Jorge; Batista, António J.N.; Hekkert, Tiago; Carvalho, Bernardo B.; Gomes, Rui B.
2014-01-01
Highlights: • 40 Alternate plasma current (AC) semi-cycles without loss of ionization, more than 1 s of operation. • AC discharges automatic control: feedback loops, time-windows control strategy, goal oriented time-windows and exception handling. • Energy deposition and Carbon radiation evolution during the AC discharges. - Abstract: The ISTTOK tokamak has a long tradition on alternate plasma current (AC) discharges, but the old control system was limiting and lacked full system integration. In order to improve the AC discharges performance the ISTTOK fast control system was updated. This control system developed on site based on the Advanced Telecommunications Computing Architecture (ATCA) standard now integrates the information gathered by all the tokamak real-time diagnostics to produce an accurate observation of the plasma parameters. The real-time actuators were also integrated, allowing a Multiple Input Multiple Output (MIMO) control environment with several synchronization strategies available. The control system software was developed in C++ on top of a Linux system with the Multi-threaded Application Real-Time executor (MARTe) Framework to synchronize the real-time code execution under a 100μs control cycle. In addition, to simplify the discharge programming, a visual Human–Machine Interface (HMI) was also developed using the BaseLib2 libraries included in the MARTe Framework. This paper presents the ISTTOK control system and the optimizations that extended the AC current discharges duration to more than 1 s, corresponding to 40 semi-cycles without apparent degradation of the plasma parameters. This upgrade allows ISTTOK to be used as a low-cost material testing facility with long time exposures to nuclear fusion relevant plasmas, comparable (in duration) with medium size tokamaks
Real-time control for long ohmic alternate current discharges
Energy Technology Data Exchange (ETDEWEB)
Carvalho, Ivo S., E-mail: ivoc@ipfn.ist.utl.pt; Duarte, Paulo; Fernandes, Horácio; Valcárcel, Daniel F.; Carvalho, Pedro J.; Silva, Carlos; Duarte, André S.; Neto, André; Sousa, Jorge; Batista, António J.N.; Hekkert, Tiago; Carvalho, Bernardo B.; Gomes, Rui B.
2014-05-15
Highlights: • 40 Alternate plasma current (AC) semi-cycles without loss of ionization, more than 1 s of operation. • AC discharges automatic control: feedback loops, time-windows control strategy, goal oriented time-windows and exception handling. • Energy deposition and Carbon radiation evolution during the AC discharges. - Abstract: The ISTTOK tokamak has a long tradition on alternate plasma current (AC) discharges, but the old control system was limiting and lacked full system integration. In order to improve the AC discharges performance the ISTTOK fast control system was updated. This control system developed on site based on the Advanced Telecommunications Computing Architecture (ATCA) standard now integrates the information gathered by all the tokamak real-time diagnostics to produce an accurate observation of the plasma parameters. The real-time actuators were also integrated, allowing a Multiple Input Multiple Output (MIMO) control environment with several synchronization strategies available. The control system software was developed in C++ on top of a Linux system with the Multi-threaded Application Real-Time executor (MARTe) Framework to synchronize the real-time code execution under a 100μs control cycle. In addition, to simplify the discharge programming, a visual Human–Machine Interface (HMI) was also developed using the BaseLib2 libraries included in the MARTe Framework. This paper presents the ISTTOK control system and the optimizations that extended the AC current discharges duration to more than 1 s, corresponding to 40 semi-cycles without apparent degradation of the plasma parameters. This upgrade allows ISTTOK to be used as a low-cost material testing facility with long time exposures to nuclear fusion relevant plasmas, comparable (in duration) with medium size tokamaks.
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Directory of Open Access Journals (Sweden)
Domenica Veniero
2017-06-01
Full Text Available Transcranial electrical stimulation (tES is being investigated as an experimental and clinical interventional technique in human participants. While promising, important limitations have been identified, including weak effect sizes and high inter- and intra-individual variability of outcomes. Here, we compared two “inhibitory” tES-techniques with supposedly different mechanisms of action as to their effects on performance in a visuospatial attention task, and report on a direct replication attempt. In two experiments, 2 × 20 healthy participants underwent tES in three separate sessions testing different protocols (10 min stimulation each with a montage targeting right parietal cortex (right parietal–left frontal, electrode-sizes: 3cm × 3cm–7 cm × 5 cm, while performing a perceptual line bisection (landmark task. The tES-protocols were compared as to their ability to modulate pseudoneglect (thought to be under right hemispheric control. In experiment 1, sham-tES was compared to transcranial alternating current stimulation at alpha frequency (10 Hz; α-tACS (expected to entrain “inhibitory” alpha oscillations and to cathodal transcranial direct current stimulation (c-tDCS (shown to suppress neuronal spiking activity. In experiment 2, we attempted to replicate the findings of experiment 1, and establish frequency-specificity by adding a 45 Hz-tACS condition to α-tACS and sham. In experiment 1, right parietal α-tACS led to the expected changes in spatial attention bias, namely a rightward shift in subjective midpoint estimation (relative to sham. However, this was not confirmed in experiment 2 and in the complete sample. Right parietal c-tDCS and 45 Hz-tACS had no effect. These results highlight the importance of replication studies, adequate statistical power and optimizing tES-interventions for establishing the robustness and reliability of electrical stimulation effects, and best practice.
Electrical properties of a piezoelectric transformer for an AC-DC converter
International Nuclear Information System (INIS)
Park, Yong-Wook
2010-01-01
The electrical properties of a ring/dot piezoelectric transformer were analyzed for applications as an AC-DC converter using the step-down behavior of a piezoelectric transformer. The ring/dot piezoelectric transformer was prepared using Pb(Mn 1/3 Nb 2/3 )O 3 and Pb(Zn 1/3 Nb 2/3 )O 3 modified Pb(Zr,Ti)O 3 ceramics sintered at a relatively low temperature of 930 .deg. C for 90 min. When the transformer was matched with a load resistance of 1000 Ω, it transferred a maximum power of 27 W. The maximum power was produced at a dc output voltage of 30 V and a matching load resistance of 1000 Ω. While the manufactured ring/dot piezoelectric transformer released the maximum power at a resonance frequency of 71 kHz, the available frequency bandwidth was about 1 kHz at most due to strong frequency dependence of the piezoelectric transformer. The output dc current was highly improved up to 905 mA because no anisotropy of poling direction existed in the ring/dot piezoelectric transformer. Under a commercial input of 220 V ac , AC-DC converter successfully produced 27 W at 30 V dc and 905 mA.
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
LOW-POWER AC LOADS AND ELECTRICAL POWER QUALITY
Directory of Open Access Journals (Sweden)
EPURE S.
2016-12-01
Full Text Available This paper deals with experimental study and numerical simulation of single phase AC low power loads: artificial light sources, personal computers, refrigeration units, air conditioning units and TV receivers. These loads are in such large numbers that represents the main source of disturbances (harmonic current, reactive power and unbalanced three-phase network. The obtained simulation models, verified by comparison with experimental results may be used in larger simulation models for testing and sizing the optimum parameters of active power filters. Models can also be used to study the interactions between grid elements and various loads or situations.
International Nuclear Information System (INIS)
Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.
2011-01-01
The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Flow instability in laminar jet flames driven by alternating current electric fields
Kim, Gyeong Taek
2016-10-13
The effect of electric fields on the instability of laminar nonpremixed jet flames was investigated experimentally by applying the alternating current (AC) to a jet nozzle. We aimed to elucidate the origin of the occurrence of twin-lifted jet flames in laminar jet flow configurations, which occurred when AC electric fields were applied. The results indicated that a twin-lifted jet flame originated from cold jet instability, caused by interactions between negative ions in the jet flow via electron attachment as O +e→O when AC electric fields were applied. This was confirmed by conducting systematic, parametric experiment, which included changing gaseous component in jets and applying different polarity of direct current (DC) to the nozzle. Using two deflection plates installed in parallel with the jet stream, we found that only negative DC on the nozzle could charge oxygen molecules negatively. Meanwhile, the cold jet instability occurred only for oxygen-containing jets. A shedding frequency of jet stream due to AC driven instability showed a good correlation with applied AC frequency exhibiting a frequency doubling. However, for the applied AC frequencies over 80Hz, the jet did not respond to the AC, indicating an existence of a minimum flow induction time in a dynamic response of negative ions to external AC fields. Detailed regime of the instability in terms of jet velocity, AC voltage and frequency was presented and discussed. Hypothesized mechanism to explain the instability was also proposed.
International Nuclear Information System (INIS)
Gibson, G.P.
1989-01-01
An evaluation has been carried out of the a.c. potential drop technique for determining J-crack growth resistance curves for a pressure vessel steel. The technique involves passing an alternating current through the specimen and relating the changes in the potential drop across the crack mouth to changes in crack length occuring during the test. The factors investigated were the current and voltage probe positions, the a.c. frequency and the test temperature. In addition, by altering the heat treatment of the material, J-crack resistance curves were obtained under both contained and non-contained yielding conditions. In all situations, accurate J-R curves could be determined. (author)
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Curtin, Francois; Bernard, Corinne; Levet, Sandrine; Perron, Hervé; Porchet, Hervé; Médina, Julie; Malpass, Sam; Lloyd, David; Simpson, Richard
2018-05-10
We describe a newly identified therapeutic target for type 1 diabetes: an envelope protein of endogenous retroviral origin called Human Endogenous Retrovirus W Envelope (HERV-W-Env). HERV-W-Env was found to be detected in the blood of around 60% of type 1 diabetes (T1D) patients and is expressed in acinar pancreatic cells of 75% of T1D patients at post-mortem examination. Preclinical experiments showed that this protein displays direct cytotoxicity on human β-islet cells. In vivo HERV-W-Env impairs the insulin and glucose metabolism in transgenic mice expressing HERV-W-Env. GNbAC1, an IgG4 monoclonal antibody has been developed to specifically target HERV-W-Env and to neutralize the effect of HERV-W-Env in vitro and in vivo. GNbAC1 is currently in clinical development for multiple sclerosis and more than 300 subjects have been administered with GNbAC1 so far. GNbAC1 is now tested in T1D in the RAINBOW-T1D study: a randomized placebo controlled study with the objective of showing the safety and pharmacodynamics response of GNbAC1 in patients suffering from T1D with a maximum duration of 4 years. GNbAC1 is tested versus placebo at the dose of 6 mg/kg in 60 patients during 6 repeated administrations during 6 months, a 6-month open-label extension will follow. The primary endpoint will assess safety and secondary endpoints the pharmacodynamic responses to GNbAC1. GNbAC1 targeting HERV-W-Env is currently in clinical development in T1D with the first safety and pharmacodynamic study. If the study results are positive, this may open the door to the development of an innovative non-immunomodulatory disease modifying treatment for T1D. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Lee, F. C.; Chen, D. Y.; Jovanovic, M.; Hopkins, D. C.
1985-01-01
The results of evaluation of power semiconductor devices for electric hybrid vehicle ac drive applications are summarized. Three types of power devices are evaluated in the effort: high power bipolar or Darlington transistors, power MOSFETs, and asymmetric silicon control rectifiers (ASCR). The Bipolar transistors, including discrete device and Darlington devices, range from 100 A to 400 A and from 400 V to 900 V. These devices are currently used as key switching elements inverters for ac motor drive applications. Power MOSFETs, on the other hand, are much smaller in current rating. For the 400 V device, the current rating is limited to 25 A. For the main drive of an electric vehicle, device paralleling is normally needed to achieve practical power level. For other electric vehicle (EV) related applications such as battery charger circuit, however, MOSFET is advantageous to other devices because of drive circuit simplicity and high frequency capability. Asymmetrical SCR is basically a SCR device and needs commutation circuit for turn off. However, the device poses several advantages, i.e., low conduction drop and low cost.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Preparation of scanning tunneling microscopy tips using pulsed alternating current etching
International Nuclear Information System (INIS)
Valencia, Victor A.; Thaker, Avesh A.; Derouin, Jonathan; Valencia, Damian N.; Farber, Rachael G.; Gebel, Dana A.; Killelea, Daniel R.
2015-01-01
An electrochemical method using pulsed alternating current etching (PACE) to produce atomically sharp scanning tunneling microscopy (STM) tips is presented. An Arduino Uno microcontroller was used to control the number and duration of the alternating current (AC) pulses, allowing for ready optimization of the procedures for both Pt:Ir and W tips using a single apparatus. W tips prepared using constant and pulsed AC power were compared. Tips fashioned using PACE were sharper than those etched with continuous AC power alone. Pt:Ir tips were prepared with an initial coarse etching stage using continuous AC power followed by fine etching using PACE. The number and potential of the finishing AC pulses was varied and scanning electron microscope imaging was used to compare the results. Finally, tip quality using the optimized procedures was verified by UHV-STM imaging. With PACE, at least 70% of the W tips and 80% of the Pt:Ir tips were of sufficiently high quality to obtain atomically resolved images of HOPG or Ni(111)
Preparation of scanning tunneling microscopy tips using pulsed alternating current etching
Energy Technology Data Exchange (ETDEWEB)
Valencia, Victor A.; Thaker, Avesh A.; Derouin, Jonathan; Valencia, Damian N.; Farber, Rachael G.; Gebel, Dana A.; Killelea, Daniel R., E-mail: dkillelea@luc.edu [Department of Chemistry and Biochemistry, Loyola University Chicago, 1068 W. Sheridan Rd., Chicago, Illinois 60660 (United States)
2015-03-15
An electrochemical method using pulsed alternating current etching (PACE) to produce atomically sharp scanning tunneling microscopy (STM) tips is presented. An Arduino Uno microcontroller was used to control the number and duration of the alternating current (AC) pulses, allowing for ready optimization of the procedures for both Pt:Ir and W tips using a single apparatus. W tips prepared using constant and pulsed AC power were compared. Tips fashioned using PACE were sharper than those etched with continuous AC power alone. Pt:Ir tips were prepared with an initial coarse etching stage using continuous AC power followed by fine etching using PACE. The number and potential of the finishing AC pulses was varied and scanning electron microscope imaging was used to compare the results. Finally, tip quality using the optimized procedures was verified by UHV-STM imaging. With PACE, at least 70% of the W tips and 80% of the Pt:Ir tips were of sufficiently high quality to obtain atomically resolved images of HOPG or Ni(111)
Directory of Open Access Journals (Sweden)
Yuan-Tsung Chen
2014-01-01
Full Text Available In this investigation, the low-frequency alternate-current (AC magnetic susceptibility (χac and hysteresis loop of various MgO thickness in CoFeB/MgO/CoFeB magnetic tunneling junction (MTJ determined coercivity (Hc and magnetization (Ms and correlated that with χac maxima. The multilayer films were sputtered onto glass substrates and the thickness of intermediate barrier MgO layer was varied from 6 to 15 Å. An experiment was also performed to examine the variation of the highest χac and maximum phase angle (θmax at the optimal resonance frequency (fres, at which the spin sensitivity is maximal. The results reveal that χac falls as the frequency increases due to the relationship between magnetization and thickness of the barrier layer. The maximum χac is at 10 Hz that is related to the maximal spin sensitivity and that this corresponds to a MgO layer of 11 Å. This result also suggests that the spin sensitivity is related to both highest χac and maximum phase angle. The corresponding maximum of χac is related to high exchange coupling. High coercivity and saturation magnetization contribute to high exchange-coupling χac strength.
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
International Nuclear Information System (INIS)
Qin Ying-Mei; Wang Jiang; Men Cong; Zhao Jia; Wei Xi-Le; Deng Bin
2012-01-01
Both external and endogenous electrical fields widely exist in the environment of cortical neurons. The effects of a weak alternating current (AC) field on a neural network model with synaptic plasticity are studied. It is found that self-sustained rhythmic firing patterns, which are closely correlated with the cognitive functions, are significantly modified due to the self-organizing of the network in the weak AC field. The activities of the neural networks are affected by the synaptic connection strength, the external stimuli, and so on. In the presence of learning rules, the synaptic connections can be modulated by the external stimuli, which will further enhance the sensitivity of the network to the external signal. The properties of the external AC stimuli can serve as control parameters in modulating the evolution of the neural network. (interdisciplinary physics and related areas of science and technology)
Passive AC network supplying the integration of CCC-HVDC and VSC-HVDC systems
BIDADFAR, Ali; ABEDI, Mehrdad; KARRARI, Mehdi
2014-01-01
The integration of a capacitor-commutated converter (CCC) high-voltage direct current (HVDC) (CCC-HVDC) and voltage source converter (VSC) HVDC (VSC-HVDC) is proposed in this paper to supply entirely passive AC networks. The key point of this integration is the flat characteristic of the DC voltage of the CCC-HVDC, which provides the condition for the VSC to connect to the CCC DC link via a current regulator. The advantages of the proposed combined infeeding system are the requirement o...
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Human Engineering Inst., Cleveland, OH.
THIS MODULE OF A 25-MODULE COURSE IS DESIGNED TO DEVELOP AN UNDERSTANDING OF THE OPERATING PRINCIPLES OF ALTERNATING CURRENT GENERATORS USED ON DIESEL POWERED EQUIPMENT. TOPICS ARE REVIEWING ELECTRICAL FUNDAMENTALS, AND OPERATING PRINCIPLES OF ALTERNATORS. THE MODULE CONSISTS OF A SELF-INSTRUCTIONAL PROGRAMED TRAINING FILM "AC GENERATORS…
MgB2-based superconductors for fault current limiters
Sokolovsky, V.; Prikhna, T.; Meerovich, V.; Eisterer, M.; Goldacker, W.; Kozyrev, A.; Weber, H. W.; Shapovalov, A.; Sverdun, V.; Moshchil, V.
2017-02-01
A promising solution of the fault current problem in power systems is the application of fast-operating nonlinear superconducting fault current limiters (SFCLs) with the capability of rapidly increasing their impedance, and thus limiting high fault currents. We report the results of experiments with models of inductive (transformer type) SFCLs based on the ring-shaped bulk MgB2 prepared under high quasihydrostatic pressure (2 GPa) and by hot pressing technique (30 MPa). It was shown that the SFCLs meet the main requirements to fault current limiters: they possess low impedance in the nominal regime of the protected circuit and can fast increase their impedance limiting both the transient and the steady-state fault currents. The study of quenching currents of MgB2 rings (SFCL activation current) and AC losses in the rings shows that the quenching current density and critical current density determined from AC losses can be 10-20 times less than the critical current determined from the magnetization experiments.
Offline detection of broken rotor bars in AC induction motors
Powers, Craig Stephen
ABSTRACT. OFFLINE DETECTION OF BROKEN ROTOR BARS IN AC INDUCTION MOTORS. The detection of the broken rotor bar defect in medium- and large-sized AC induction machines is currently one of the most difficult tasks for the motor condition and monitoring industry. If a broken rotor bar defect goes undetected, it can cause a catastrophic failure of an expensive machine. If a broken rotor bar defect is falsely determined, it wastes time and money to physically tear down and inspect the machine only to find an incorrect diagnosis. Previous work in 2009 at Baker/SKF-USA in collaboration with the Korea University has developed a prototype instrument that has been highly successful in correctly detecting the broken rotor bar defect in ACIMs where other methods have failed. Dr. Sang Bin and his students at the Korea University have been using this prototype instrument to help the industry save money in the successful detection of the BRB defect. A review of the current state of motor conditioning and monitoring technology for detecting the broken rotor bar defect in ACIMs shows improved detection of this fault is still relevant. An analysis of previous work in the creation of this prototype instrument leads into the refactoring of the software and hardware into something more deployable, cost effective and commercially viable.
Design of a low temperature superconducting coil to be applied to current regulators
International Nuclear Information System (INIS)
Garcia-Tabares, L.; Grau Carles, A
1998-05-01
We study the magnetic design and the cryogenic stability of a superconducting coil cooled with liquid helium, which works both in DC and AC modes. In DC mode, we obtain the maximum quench current; while in AC mode, we analyze Joule losses produced by the superconductor magnetization and the generation of eddy currents inside the copper matrix. (Author)
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Chang Hungwen; Hsu Chengche
2012-01-01
In this work, three major problems, namely severe electrode damage, poor plasma stability and excess power consumption, arising in ac-driven plasmas in saline solutions are solved using a rectified power source. Diagnostic studies on the effects of power source polarity and frequency on the plasma behaviour are performed. Examination of I-V characteristics and temporally resolved light emission shows that the polarity significantly influences the current amplitude when the plasma exists, while the frequency alters the bubble dynamics, which in turn affects the plasma ignition voltage. When the plasma is driven by a rectified ac power source, the electrode erosion is reduced substantially. With a low frequency, moderate applied voltage and positively rectified ac power source (e.g. 100 Hz and 350 V), a stable plasma is ignited in nearly every power cycle. (paper)
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
A Three-Phase Dual-Input Matrix Converter for Grid Integration of Two AC Type Energy Resources
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Chiang Loh, Poh
2013-01-01
This paper proposes a novel dual-input matrix converter (DIMC) to integrate two three-phase ac type energy resources to a power grid. The proposed matrix converter is developed based on the traditional indirect matrix converter under reverse power flow operation mode, but with its six......-to-output voltage boost capability since power flows from the converter’s voltage source side to its current source side. Commanded currents can be extracted from the two input sources to the grid. The proposed control and modulation schemes guarantee sinusoidal input and output waveforms as well as unity input......-switch voltage source converter replaced by a nine-switch configuration. With the additional three switches, the proposed DIMC can provide six in put terminals, which make it possible to integrate two independent ac sources into a single grid-tied power electronics interface. The proposed converter has input...
DEFF Research Database (Denmark)
Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten
1999-01-01
The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current......-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce-the inductive...... voltage. The 1 mu V cm(-1) critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6 +/- 0.15 W m(-1). This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
DC-Compensated Current Transformer †
Ripka, Pavel; Draxler, Karel; Styblíková, Renata
2016-01-01
Instrument current transformers (CTs) measure AC currents. The DC component in the measured current can saturate the transformer and cause gross error. We use fluxgate detection and digital feedback compensation of the DC flux to suppress the overall error to 0.15%. This concept can be used not only for high-end CTs with a nanocrystalline core, but it also works for low-cost CTs with FeSi cores. The method described here allows simultaneous measurements of the DC current component. PMID:26805830
Qian, WANG; Feng, LIU; Chuanrun, MIAO; Bing, YAN; Zhi, FANG
2018-03-01
A coaxial dielectric barrier discharge (DBD) reactor with double layer dielectric barriers has been developed for exhaust gas treatment and excited either by AC power or nanosecond (ns) pulse to generate atmospheric pressure plasma. The comparative study on the discharge characteristics of the discharge uniformity, power deposition, energy efficiency, and operation temperature between AC and ns pulsed coaxial DBD is carried out in terms of optical and electrical characteristics and operation temperature for optimizing the coaxial DBD reactor performance. The voltages across the air gap and dielectric layer and the conduction and displacement currents are extracted from the applied voltages and measured currents of AC and ns pulsed coaxial DBDs for the calculation of the power depositions and energy efficiencies through an equivalent electrical model. The discharge uniformity and operating temperature of the coaxial DBD reactor are monitored and analyzed by optical images and infrared camera. A heat conduction model is used to calculate the temperature of the internal quartz tube. It is found that the ns pulsed coaxial DBD has a much higher instantaneous power deposition in plasma, a lower total power consumption, and a higher energy efficiency compared with that excited by AC power and is more homogeneous and stable. The temperature of the outside wall of the AC and ns pulse excited coaxial DBD reaches 158 °C and 64.3 °C after 900 s operation, respectively. The experimental results on the comparison of the discharge characteristics of coaxial DBDs excited by different powers are significant for understanding of the mechanism of DBDs, reducing energy loss, and optimizing the performance of coaxial DBD in industrial applications.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Directory of Open Access Journals (Sweden)
Jikai Chen
2016-12-01
Full Text Available At present, the research is still in the primary stage in the process of fault disturbance energy transfer in the multilevel modular converter based high voltage direct current (HVDC-MMC. An urgent problem is how to extract and analyze the fault features hidden in MMC electrical information in further studies on the HVDC system. Aiming at the above, this article analyzes the influence of AC transient disturbance on electrical signals of MMC. At the same time, it is found that the energy distribution of electrical signals in MMC is different for different arms in the same frequency bands after the discrete wavelet packet transformation (DWPT. Renyi wavelet packet energy entropy (RWPEE and Renyi wavelet packet time entropy (RWPTE are proposed and applied to AC transient fault feature extraction from electrical signals in MMC. Using the feature extraction results of Renyi wavelet packet entropy (RWPE, a novel recognition method is put forward to recognize AC transient faults using the information fusion technology. Theoretical analysis and experimental results show that the proposed method is available to recognize transient AC faults.
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing
International Nuclear Information System (INIS)
Gottardi, L.; Kuur, J. van der; Korte, P. A. J. de; Den Hartog, R.; Dirks, B.; Popescu, M.; Hoevers, H. F. C.; Bruijn, M.; Borderias, M. Parra; Takei, Y.
2009-01-01
We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/R N <0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.
2004-03-15
In this report an isolated PWM DC-AC SICAM with an active capacitive voltage clamp is presented. AC-DC power supply is implemented in its simplest form: diode rectifier followed by a medium-size charge-storage capacitors and possibly with an EMC filter on the mains entrance. Isolation from the AC mains is achieved using a high frequency (HF) transformer, whose voltages are not audio-modulated. The latter simplifies the design and is expected to have many advantages over the approach where the transformer voltages are modulated in regards to the audio signal reference. Input stage is built as a DC-AC inverter (push-pull, half-bridge or a full-bridge) and operated with 50% duty cycle, with all the challenges to avoid transformer saturation and obtain symmetrical operation. On the secondary side the output section is implemented as rectifier+inverter AC-AC stage, i.e. a true bidirectional bridge, which operation is aimed towards amplification of the audio signal. In order to solve the problem with the commutation of the load current, a dead time between the incoming and outgoing bidirectional switch is implemented, while a capacitive voltage clamp is used to keep the induced overvoltage to reasonable levels. The energy stored in the clamping capacitor is not wasted as in the dissipative clamps, but is rather transferred back to the primary side for further processing using an auxiliary isolated single-switch converter, i.e. an active clamping technique is used. (au)
Active superconducting DC fault current limiter based on flux compensation
International Nuclear Information System (INIS)
Shi Jing; Tang Yuejin; Wang, Chen; Zhou Yusheng; Li Jingdong; Ren Li; Chen Shijie
2006-01-01
With the extensive application of DC power systems, suppression of DC fault current is an important subject that guarantees system security. This paper presents an active superconducting DC fault current limiter (DC-SFCL) based on flux compensation. The DC-SFCL is composed of two superconducting windings wound on a single iron core, the primary winding is in series with DC power system, and the second winding is connected with AC power system through a PWM converter. In normal operating state, the flux in the iron core is compensated to zero, and the SFCL has no influence on DC power system. In the case of DC system accident, through regulating the active power exchange between the SFCL's second winding and the AC power system, the current on the DC side can be limited to different level complying with the system demand. Moreover, the PWM converter that interface the DC system and AC system can be controlled as a reactive power source to supply voltage support for the AC side, which has little influence on the performance of SFCL. Using MATLAB SIMULINK, the mathematic model of the DC-SFCL is created, simulation results validate the dynamics of system, and the performance of DC-SFCL is confirmed
Low AC Loss in a 3 kA HTS Cable of the Dutch Project
Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex
Requirements for a 6 km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1 W/m per phase at rated current of 3 kArms, frequency of 50 Hz and temperature of 77 K. In this paper we discuss a strategy towards this ambitious goal, a concept design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate pitch angles for two-layer cable conductor of relatively large diameter, by minimizing the gaps between the HTS tapes, and by using narrow HTS tapes that conform well to the roundness of the underlying former. AC loss of 0.12 W/m at 3 kArms was measured at a frequency of 60 Hz and at a temperature of 77 K.
Santarnecchi, E; Muller, T; Rossi, S; Sarkar, A; Polizzotto, N R; Rossi, A; Cohen Kadosh, R
2016-02-01
Emerging evidence suggests that transcranial alternating current stimulation (tACS) is an effective, frequency-specific modulator of endogenous brain oscillations, with the potential to alter cognitive performance. Here, we show that reduction in response latencies to solve complex logic problem indexing fluid intelligence is obtained through 40 Hz-tACS (gamma band) applied to the prefrontal cortex. This improvement in human performance depends on individual ability, with slower performers at baseline receiving greater benefits. The effect could have not being explained by regression to the mean, and showed task and frequency specificity: it was not observed for trials not involving logical reasoning, as well as with the application of low frequency 5 Hz-tACS (theta band) or non-periodic high frequency random noise stimulation (101-640 Hz). Moreover, performance in a spatial working memory task was not affected by brain stimulation, excluding possible effects on fluid intelligence enhancement through an increase in memory performance. We suggest that such high-level cognitive functions are dissociable by frequency-specific neuromodulatory effects, possibly related to entrainment of specific brain rhythms. We conclude that individual differences in cognitive abilities, due to acquired or developmental origins, could be reduced during frequency-specific tACS, a finding that should be taken into account for future individual cognitive rehabilitation studies. Copyright © 2015 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Han, Yang; Shen, Pan; Zhao, Xin
2016-01-01
In this paper, an enhanced hierarchical control structure with multiple current loop damping schemes for voltage unbalance and harmonics compensation in ac islanded microgrid is proposed to address unequal power sharing problems. The distributed generation (DG) is properly controlled to autonomou......In this paper, an enhanced hierarchical control structure with multiple current loop damping schemes for voltage unbalance and harmonics compensation in ac islanded microgrid is proposed to address unequal power sharing problems. The distributed generation (DG) is properly controlled...... to autonomously compensate voltage unbalance and harmonics while sharing the compensation effort for the real power, reactive power, unbalance and harmonic powers. The proposed control system of the microgrid mainly consists of the positive sequence real and reactive power droop controllers, voltage and current......) technique is adopted to send the compensation command of the secondary control and auxiliary control from the microgrid control center (MGCC) to the local controllers of DG unit. Finally, the hardware-in-the-loop (HIL) results using dSPACE 1006 platform are presented to demonstrate the effectiveness...
Characteristics of alternating current hopping conductivity in DNA sequences
Institute of Scientific and Technical Information of China (English)
Ma Song-Shan; Xu Hui; Wang Huan-You; Guo Rui
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences,in which DNA is considered as a one-dimensional (1D) disordered system,and electrons transport via hopping between localized states.It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises,and it takes the form of σac(ω)~ω2 ln2(1/ω).Also AC conductivity of DNA sequences increases with the increase of temperature,this phenomenon presents characteristics of weak temperature-dependence.Meanwhile,the AC conductivity in an off diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures,which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity,while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition,the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences.For p<0.5,the conductivity of DNA sequence decreases with the increase of p,while for p > 0.5,the conductivity increases with the increase of p.
Fault current limiter with shield and adjacent cores
Darmann, Francis Anthony; Moriconi, Franco; Hodge, Eoin Patrick
2013-10-22
In a fault current limiter (FCL) of a saturated core type having at least one coil wound around a high permeability material, a method of suppressing the time derivative of the fault current at the zero current point includes the following step: utilizing an electromagnetic screen or shield around the AC coil to suppress the time derivative current levels during zero current conditions.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Yao Liu
2016-08-01
Full Text Available The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based on photovoltaic (PV generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed for alternating current (AC-side ES. Thus, the ES lifetime is prolonged. Moreover, interlinking converters (ICs provide a bridge between AC/DC buses in a hybrid microgrid. The power control of IC is enabled when the AC- or DC-side suffer from active power demand shortage. In particular, if the AC microgrid does not satisfy the reactive power demand, IC then acts as a static synchronous compensator (STATCOM. The effectiveness of the proposed strategies is verified by simulations.
Ac-loss measurement of coated conductors: The influence of the pick-up coil position
International Nuclear Information System (INIS)
Schmidt, Curt
2008-01-01
The ac-loss measurement by the magnetization method requires calibration for obtaining absolute values. A convenient way of calibration is the calorimetric measurement which yields, within the measuring accuracy, absolute loss values. In the magnetization measurement the hysteresis loop of sample magnetization which determines the losses is measured via the integration of magnetic flux penetrating a pick-up coil. The ratio of flux integral to magnetization integral and hence the calibration factor is however, for a given pick-up coil geometry, not exactly a constant, but depends on the magnetization current pattern within the sample. Especially for thin tapes in perpendicular external field this effect has to be taken into consideration in order to avoid miss measurements. The relation between measured flux and sample magnetization was calculated for special cases of magnetization current distribution in the sample as a function of the pick-up coil position. Furthermore calibration factors were measured as a function of the ac-field amplitude and the result compared with available theoretical models. A good agreement was found between experiment and theory
Multi-terminal direct-current grids modeling, analysis, and control
Chaudhuri, Nilanjan; Majumder, Rajat; Yazdani, Amirnaser
2014-01-01
A comprehensive modeling, analysis, and control design framework for multi-terminal direct current (MTDC) grids is presented together with their interaction with the surrounding AC networks and the impact on overall stability. The first book of its kind on the topic of multi-terminal DC (MTDC) grids Presents a comprehensive modeling framework for MTDC grids which is compatible with the standard AC system modeling for stability studies Includes modal analysis and study of the interactions between the MTDC grid and the surrounding AC systems Addresses the problems of autonomous power sharing an
Hsu, Wan-Yu; Zanto, Theodore P; van Schouwenburg, Martine R; Gazzaley, Adam
2017-01-01
Multitasking is associated with the generation of stimulus-locked theta (4-7 Hz) oscillations arising from prefrontal cortex (PFC). Transcranial alternating current stimulation (tACS) is a non-invasive brain stimulation technique that influences endogenous brain oscillations. Here, we investigate whether applying alternating current stimulation within the theta frequency band would affect multitasking performance, and explore tACS effects on neurophysiological measures. Brief runs of bilateral PFC theta-tACS were applied while participants were engaged in a multitasking paradigm accompanied by electroencephalography (EEG) data collection. Unlike an active control group, a tACS stimulation group showed enhancement of multitasking performance after a 90-minute session (F1,35 = 6.63, p = 0.01, ηp2 = 0.16; effect size = 0.96), coupled with significant modulation of posterior beta (13-30 Hz) activities (F1,32 = 7.66, p = 0.009, ηp2 = 0.19; effect size = 0.96). Across participant regression analyses indicated that those participants with greater increases in frontal theta, alpha and beta oscillations exhibited greater multitasking performance improvements. These results indicate frontal theta-tACS generates benefits on multitasking performance accompanied by widespread neuronal oscillatory changes, and suggests that future tACS studies with extended treatments are worth exploring as promising tools for cognitive enhancement.
Directory of Open Access Journals (Sweden)
Wan-Yu Hsu
Full Text Available Multitasking is associated with the generation of stimulus-locked theta (4-7 Hz oscillations arising from prefrontal cortex (PFC. Transcranial alternating current stimulation (tACS is a non-invasive brain stimulation technique that influences endogenous brain oscillations. Here, we investigate whether applying alternating current stimulation within the theta frequency band would affect multitasking performance, and explore tACS effects on neurophysiological measures. Brief runs of bilateral PFC theta-tACS were applied while participants were engaged in a multitasking paradigm accompanied by electroencephalography (EEG data collection. Unlike an active control group, a tACS stimulation group showed enhancement of multitasking performance after a 90-minute session (F1,35 = 6.63, p = 0.01, ηp2 = 0.16; effect size = 0.96, coupled with significant modulation of posterior beta (13-30 Hz activities (F1,32 = 7.66, p = 0.009, ηp2 = 0.19; effect size = 0.96. Across participant regression analyses indicated that those participants with greater increases in frontal theta, alpha and beta oscillations exhibited greater multitasking performance improvements. These results indicate frontal theta-tACS generates benefits on multitasking performance accompanied by widespread neuronal oscillatory changes, and suggests that future tACS studies with extended treatments are worth exploring as promising tools for cognitive enhancement.
International Nuclear Information System (INIS)
Gung, C.Y.
1993-01-01
Energy dissipation, which is also called AC loss, of a composite multifilamentary superconducting wire is one of the most fundamental concerns in building a stable superconducting magnet. Characterization and reduction of AC losses are especially important in designing a superconducting magnet for generating transient magnetic fields. The goal of this thesis is to improve the understanding of AC-loss properties of superconducting wires developed for high-current ramp-field magnet applications. The major tasks include: (1) building an advanced AC-loss measurement system, (2) measuring AC losses of superconducting wires under simulated pulse magnet operations, (3) developing an analytical model for explaining the new AC-loss properties found in the experiment, and (4) developing a computational methodology for comparing AC losses of a superconducting wire with those of a cable for a superconducting pulse magnet. A new experimental system using an isothermal calorimetric method was designed and constructed to measure the absolute AC losses in a composite superconductor. This unique experimental setup is capable of measuring AC losses of a brittle Nb 3 Sn wire carrying high AC current in-phase with a large-amplitude pulse magnetic field. Improvements of the accuracy and the efficiency of this method are discussed. Three different types of composite wire have been measured: a Nb 3 Sn modified jelly-roll (MJR) internal-tin wire used in a prototype ohmic heating coil, a Nb 3 Sn internal-tin wire developed for a fusion reactor ohmic heating coil, and a NbTi wire developed for the magnets in a particle accelerator. The cross sectional constructions of these wires represent typical commercial wires manufactured for pulse magnet applications
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Design and A.C. loss considerations for the 60 mm dipole magnet in the High Energy Booster
International Nuclear Information System (INIS)
Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.
1991-01-01
The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor is presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Bean model and ac losses in Bi2Ca2Cu3O10/Ag tapes
International Nuclear Information System (INIS)
Suenaga, M.; Chiba, T.; Wiesmann, H.J.; Haldar, P.
1997-01-01
The Bean model is almost solely used to interpret ac losses in the powder-in-tube processed composite conductor, Bi 2 Sr 2 Ca 2 Cu 3 O 10 /Ag. In order to examine the limits of the applicability of the model, a detailed comparison was made between the values of critical current density J c for Bi(2223)/Ag tapes which were determined by standard four-probe-dc measurement, and which were deduced from the field dependence of the ac losses utilizing the model. A significant inconsistency between these values of J c were found, particularly at high fields. Possible sources of the discrepancies are discussed
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions
Wu, B. H.; Cao, J. C.; Timm, C.
2012-07-01
We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
A Control Method of Current Type Matrix Converter for Plasma Control Coil Power Supply
International Nuclear Information System (INIS)
Shimada, K.; Matsukawa, M.; Kurihara, K.; Jun-ichi Itoh
2006-01-01
In exploration to a tokamak fusion reactor, the control of plasma instabilities of high β plasma such as neoclassical tearing mode (NTM), resistive wall mode (RWM) etc., is the key issue for steady-state sustainment. One of the proposed methods to avoid suppressing RWM is that AC current having a phase to work for reduction the RWM growth is generated in a coil (sector coil) equipped spirally on the plasma vacuum vessel. To stabilize RWM, precise and fast real-time feedback control of magnetic field with proper amplitude and frequency is necessary. This implies that an appropriate power supply dedicated for such an application is expected to be developed. A matrix converter as one of power supply candidates for this purpose could provide a solution The matrix converter, categorized in an AC/AC direct converter composed of nine bi-directional current switches, has a great feature that a large energy storage element is unnecessary in comparison with a standard existing AC/AC indirect converter, which is composed of an AC/DC converter and a DC/AC inverter. It is also advantageous in cost and size of its applications. Fortunately, a voltage type matrix converter has come to be available at the market recently, while a current type matrix converter, which is advantageous for fast control of the large-inductance coil current, has been unavailable. On the background above mentioned, we proposed a new current type matrix converter and its control method applicable to a power supply with fast response for suppressing plasma instabilities. Since this converter is required with high accuracy control, the gate control method is adopted to three-phase switching method using middle phase to reduce voltage and current waveforms distortion. The control system is composed of VME-bus board with DSP (Digital Signal Processor) and FPGA (Field Programmable Gate Array) for high speed calculation and control. This paper describes the control method of a current type matrix converter
Directory of Open Access Journals (Sweden)
James eDowsett
2016-03-01
Full Text Available Transcranial alternating current stimulation (tACS has until now mostly been administered as an alternating sinusoidal wave. Despite modern tACS stimulators being able to deliver alternating current with any arbitrary shape there has been no systematic exploration into the relative benefits of different waveforms. As tACS is a relatively new technique there is a huge parameter space of unexplored possibilities which may prove superior or complimentary to the traditional sinusoidal waveform. Here we begin to address this with an investigation into the effects of sawtooth wave tACS on individual alpha power. Evidence from animal models suggests that the gradient and direction of an electric current should be important factors for the subsequent neural firing rate; we compared positive and negative ramp sawtooth waves to test this. An additional advantage of sawtooth waves is that the resulting artefact in the electroencephalogram (EEG recording is significantly simpler to remove than a sine wave; accordingly we were able to observe alpha oscillations both during and after stimulation.We found that positive ramp sawtooth, but not negative ramp sawtooth, significantly enhanced alpha power during stimulation relative to sham (p<0.01. In addition we tested for an after-effect of both sawtooth and sinusoidal stimulation on alpha power but in this case did not find any significant effect. This preliminary study paves the way for further investigations into the effect of the gradient and direction of the current in tACS which could significantly improve the usefulness of this technique.
Improving Power Quality in AC Supply Grids
Directory of Open Access Journals (Sweden)
Piotr Fabijański
2015-12-01
Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.
Topologically protected loop flows in high voltage AC power grids
International Nuclear Information System (INIS)
Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I
2016-01-01
Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)
Wang, Rubing; Qian, Yuting; Li, Weiwei; Zhu, Shoupu; Liu, Fengkui; Guo, Yufen; Chen, Mingliang; Li, Qi; Liu, Liwei
2018-01-01
Graphene has been widely used in the active material, conductive agent, binder or current collector for supercapacitors, due to its large specific surface area, high conductivity, and electron mobility. However, works simultaneously employing graphene as conductive agent and current collector were rarely reported. Here, we report improved activated carbon (AC) electrodes (AC@G@NiF/G) simultaneously combining chemical vapor deposition (CVD) graphene-modified nickel foams (NiF/Gs) current collectors and high quality few-layer graphene conductive additive instead of carbon black (CB). The synergistic effect of NiF/Gs and graphene additive makes the performances of AC@G@NiF/G electrodes superior to those of electrodes with CB or with nickel foam current collectors. The performances of AC@G@NiF/G electrodes show that for the few-layer graphene addition exists an optimum value around 5 wt %, rather than a larger addition of graphene, works out better. A symmetric supercapacitor assembled by AC@G@NiF/G electrodes exhibits excellent cycling stability. We attribute improved performances to graphene-enhanced conductivity of electrode materials and NiF/Gs with 3D graphene conductive network and lower oxidation, largely improving the electrical contact between active materials and current collectors. PMID:29762528
Wang, Rubing; Qian, Yuting; Li, Weiwei; Zhu, Shoupu; Liu, Fengkui; Guo, Yufen; Chen, Mingliang; Li, Qi; Liu, Liwei
2018-05-15
Graphene has been widely used in the active material, conductive agent, binder or current collector for supercapacitors, due to its large specific surface area, high conductivity, and electron mobility. However, works simultaneously employing graphene as conductive agent and current collector were rarely reported. Here, we report improved activated carbon (AC) electrodes (AC@G@NiF/G) simultaneously combining chemical vapor deposition (CVD) graphene-modified nickel foams (NiF/Gs) current collectors and high quality few-layer graphene conductive additive instead of carbon black (CB). The synergistic effect of NiF/Gs and graphene additive makes the performances of AC@G@NiF/G electrodes superior to those of electrodes with CB or with nickel foam current collectors. The performances of AC@G@NiF/G electrodes show that for the few-layer graphene addition exists an optimum value around 5 wt %, rather than a larger addition of graphene, works out better. A symmetric supercapacitor assembled by AC@G@NiF/G electrodes exhibits excellent cycling stability. We attribute improved performances to graphene-enhanced conductivity of electrode materials and NiF/Gs with 3D graphene conductive network and lower oxidation, largely improving the electrical contact between active materials and current collectors.
AC magnetic measurements of the ALS Booster Synchrotron Dipole Magnet engineering model
International Nuclear Information System (INIS)
Green, M.I.; Hoyer, E.; Keller, R.; Nelson, D.H.
1988-09-01
We made a minimal set of AC magnetic measurements of the engineering model of the ALS Booster Dipole Magnet as part of the process of qualifying its design for production. Magnetic induction integrals over paths approximating electron-beam trajectories were measured with long curved coils connected to an electronic integrator. Magnetic induction was measured with point coils and an integrator and independently with a Hall-effect Gaussmeter. These quantities, and magnet current, were displayed on a commercial digital storage oscilloscope as parametric functions of time. The displayed waveforms were stored, processed and redisplayed as representations of selected magnet parameters. A waveform representing the magnet's effective-length was created by dividing the integral waveform by the magnetic induction waveform. Waveforms of the transfer functions were produced by dividing both the integral waveform and the magnetic induction waveform by the current waveform. Pairs of matched coils, connected in series opposition, provided differential measurements of field uniformity. Quadrupole and sextupole coefficients were derived from the uniformity data. These magnet parameters were measured at 2 and 10 Hz frequencies. Together with measurements of the magnetic field at selected dc levels, the ac measurements demonstrated that the magnet design met specifications and qualified it for production. 7 refs., 7 figs., 3 tabs
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Energy Technology Data Exchange (ETDEWEB)
Vasudevan, Subramanyan, E-mail: vasudevan65@gmail.com [CSIR-Central Electrochemical Research Institute, Karaikudi 630 006 (India); Lakshmi, Jothinathan; Sozhan, Ganapathy [CSIR-Central Electrochemical Research Institute, Karaikudi 630 006 (India)
2011-08-15
Highlights: {yields} Very high removal efficiency of cadmium was achieved by electrocoagulation. {yields} Alternating current (AC) avoids oxide layer and corrosion on anode surface. {yields} Good current transfer between anode and cathode results more removal efficiency. {yields} Compact treatment facility and complete automation. {yields} Aluminum alloy anode prevents residual aluminum in treated water. - Abstract: In practice, direct current (DC) is used in an electrocoagulation processes. In this case, an impermeable oxide layer may form on the cathode as well as corrosion formation on the anode due to oxidation. This prevents the effective current transfer between the anode and cathode, so the efficiency of electrocoagulation processes declines. These disadvantages of DC have been diminished by adopting alternating current (AC) in electrocoagulation processes. The main objective of this study is to investigate the effects of AC and DC on the removal of cadmium from water using aluminum alloy as anode and cathode. The results showed that the removal efficiency of 97.5 and 96.2% with the energy consumption of 0.454 and 1.002 kWh kl{sup -1} was achieved at a current density of 0.2 A/dm{sup 2} and pH of 7.0 using aluminum alloy as electrodes using AC and DC, respectively. For both AC and DC, the adsorption of cadmium was preferably fitting Langmuir adsorption isotherm, the adsorption process follows second order kinetics and the temperature studies showed that adsorption was exothermic and spontaneous in nature.
International Nuclear Information System (INIS)
Vasudevan, Subramanyan; Lakshmi, Jothinathan; Sozhan, Ganapathy
2011-01-01
Highlights: → Very high removal efficiency of cadmium was achieved by electrocoagulation. → Alternating current (AC) avoids oxide layer and corrosion on anode surface. → Good current transfer between anode and cathode results more removal efficiency. → Compact treatment facility and complete automation. → Aluminum alloy anode prevents residual aluminum in treated water. - Abstract: In practice, direct current (DC) is used in an electrocoagulation processes. In this case, an impermeable oxide layer may form on the cathode as well as corrosion formation on the anode due to oxidation. This prevents the effective current transfer between the anode and cathode, so the efficiency of electrocoagulation processes declines. These disadvantages of DC have been diminished by adopting alternating current (AC) in electrocoagulation processes. The main objective of this study is to investigate the effects of AC and DC on the removal of cadmium from water using aluminum alloy as anode and cathode. The results showed that the removal efficiency of 97.5 and 96.2% with the energy consumption of 0.454 and 1.002 kWh kl -1 was achieved at a current density of 0.2 A/dm 2 and pH of 7.0 using aluminum alloy as electrodes using AC and DC, respectively. For both AC and DC, the adsorption of cadmium was preferably fitting Langmuir adsorption isotherm, the adsorption process follows second order kinetics and the temperature studies showed that adsorption was exothermic and spontaneous in nature.
Magnetic force microscopy method and apparatus to detect and image currents in integrated circuits
Campbell, Ann. N.; Anderson, Richard E.; Cole, Jr., Edward I.
1995-01-01
A magnetic force microscopy method and improved magnetic tip for detecting and quantifying internal magnetic fields resulting from current of integrated circuits. Detection of the current is used for failure analysis, design verification, and model validation. The interaction of the current on the integrated chip with a magnetic field can be detected using a cantilevered magnetic tip. Enhanced sensitivity for both ac and dc current and voltage detection is achieved with voltage by an ac coupling or a heterodyne technique. The techniques can be used to extract information from analog circuits.
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields
International Nuclear Information System (INIS)
Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent
2017-01-01
Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘ self-induced ’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power. (paper)
New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields
Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent
2017-02-01
Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘self-induced’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Characteristics of alternating current hopping conductivity in DNA sequences
International Nuclear Information System (INIS)
Song-Shan, Ma; Hui, Xu; Huan-You, Wang; Rui, Guo
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences, in which DNA is considered as a one-dimensional (1D) disordered system, and electrons transport via hopping between localized states. It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises, and it takes the form of ø ac (ω) ∼ ω 2 ln 2 (1/ω). Also AC conductivity of DNA sequences increases with the increase of temperature, this phenomenon presents characteristics of weak temperature-dependence. Meanwhile, the AC conductivity in an off-diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures, which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity, while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition, the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences. For p < 0.5, the conductivity of DNA sequence decreases with the increase of p, while for p ≥ 0.5, the conductivity increases with the increase of p. (cross-disciplinary physics and related areas of science and technology)
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Directory of Open Access Journals (Sweden)
Liwei Wang
2018-03-01
Full Text Available Influence of alternating current (AC on pitting corrosion and stress corrosion cracking (SCC behavior of X70 pipeline steel in the near-neutral pH environment under cathodic protection (CP was investigated. Both corrosion and SCC are inhibited by −0.775 VSCE CP without AC interference. With the superimposition of AC current (1–10 mA/cm2, the direct current (DC potential shifts negatively under the CP of −0.775 VSCE and the cathodic DC current decreases and shifts to the anodic direction. Under the CP potential of −0.95 VSCE and −1.2 VSCE, the applied AC current promotes the cathodic reaction and leads to the positive shift of DC potential and increase of cathodic current. Local anodic dissolution occurs attributing to the generated anodic current transients in the positive half-cycle of the AC current, resulting in the initiation of corrosion pits (0.6–2 μm in diameter. AC enhances the SCC susceptibility of X70 steel under −0.775 VSCE CP, attributing to the promotion of anodic dissolution and hydrogen evolution. Even an AC current as low as 1 mA/cm2 can enhance the SCC susceptibility.
tACS phase locking of frontal midline theta oscillations disrupts working memory performance
Directory of Open Access Journals (Sweden)
Bankim Subhash Chander
2016-05-01
Full Text Available Frontal midline theta (FMT oscillations (4-8Hz are strongly related to cognitive and executive control during mental tasks such as memory processing, arithmetic problem solving or sustained attention. While maintenance of temporal order information during a working memory (WM task was recently linked to FMT phase, a positive correlation between FMT power, WM demand and WM performance was shown. However, the relationship between these measures is not well understood, and it is unknown whether purposeful FMT phase manipulation during a WM task impacts FMT power and WM performance. Here we present evidence that FMT phase manipulation mediated by transcranial alternating current stimulation (tACS can block WM demand-related FMT power increase and disrupt normal WM performance. Methods: 20 healthy volunteers were assigned to one of two groups (group A, group B and performed a 2-back task across a baseline block (block 1 and an intervention block (block 2 while 275-sensor magnetoencephalography (MEG was recorded. After no stimulation was applied during block 1, participants in group A received tACS oscillating at their individual FMT frequency over the prefrontal cortex (PFC while group B received sham stimulation during block 2. After assessing and mapping phase locking values (PLV between the tACS signal and brain oscillatory activity across the whole brain, FMT power and WM performance were assessed and compared between blocks and groups. Results: During block 2 of group A but not B, FMT oscillations showed increased PLV across task-related cortical areas underneath the frontal tACS electrode. While WM task-related FMT power increase (FMTpower and WM performance were comparable across groups in block 1, tACS resulted in lower FMTpower and WM performance compared to sham stimulation in block 2. Conclusion: tACS-related manipulation of FMT phase can disrupt WM performance and influence WM task-related FMT power increase. This finding may have
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
El-Shabaan, M. M.
2018-02-01
Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.
An AMOLED AC-Biased Pixel Design Compensating the Threshold Voltage and I-R Drop
Directory of Open Access Journals (Sweden)
Ching-Lin Fan
2011-01-01
Full Text Available We propose a novel pixel design and an AC bias driving method for active-matrix organic light-emitting diode (AM-OLED displays using low-temperature polycrystalline silicon thin-film transistors (LTPS-TFTs. The proposed threshold voltage and I-R drop compensation circuit, which comprised three transistors and one capacitor, have been verified to supply uniform output current by simulation work using the Automatic Integrated Circuit Modeling Simulation Program with Integrated Circuit Emphasis (AIM-SPICE simulator. The simulated results demonstrate excellent properties such as low error rate of OLED anode voltage variation (<0.7% and low voltage drop of VDD power line. The proposed pixel circuit effectively enables threshold-voltage-deviation correction of driving TFT and compensates for the voltage drop of VDD power line using AC bias on OLED cathode.
A new method for measuring the wall charge waveforms of AC PDP
International Nuclear Information System (INIS)
Liang Zhihu; Liu Zujun; Liu Chunliang
2004-01-01
A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period. (authors)
Nb46, 5wt% Ti Eb-melting for AC and DC superconducting applications
International Nuclear Information System (INIS)
Bormio, C.; Ramos, M.J.; Pinatti, D.G.
1990-01-01
This paper reports on the superconductor alloy Nb46, 5wt % Ti which presents the best superconducting and mechanical properties for the systems Nb-Ti. The greatest difficulty in obtaining this alloy is related to the difference between the raw materials melting temperatures, which is about 700 degrees C. As a result the alloy homogeneity as well as Ti desired content, turn to be hard to control. The authors choose an electrode sandwich type, where Nb and Ti sheets are interposed. The electrode dimensions calculation is based on the Ti evaporation rate, energy balance and superficial tension of liquid titanium between Nb sheets. The ingots were electron beam melted. Herein, we present the following ingot results: Ti, intersticial and trace contents compared to international manufactures as well as its mechanical workability. This alloy will be used in NbTi wire production for AC and DC applications. The AC and DC wires are produced by coswaging and codrawing of NbTi bars and C u Ni-tubes for AC wires and Cu-tubes for DC wires. High area reductions of about 2 x 10 8 are reached without intermediate heat treatment, and they are essential since they are precursors of collective pinning centers, responsible for high critical current densities
Design and A.C. loss considerations for the 60 mm dipole magnet in the high energy booster
International Nuclear Information System (INIS)
Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.
1991-04-01
The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat and load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor will be presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors. 13 refs., 3 figs., 7 tabs
Directory of Open Access Journals (Sweden)
Christoph S Herrmann
2013-06-01
Full Text Available Brain oscillations of different frequencies have been associated with a variety of cognitive functions. Convincing evidence supporting those associations has been provided by studies using intracranial stimulation, pharmacological interventions and lesion studies. The emergence of novel non-invasive brain stimulation techniques like repetitive transcranial magnetic stimulation (rTMS and transcranial alternating current stimulation (tACS now allows to modulate brain oscillations directly. Particularly, tACS offers the unique opportunity to causally link brain oscillations of a specific frequency range to cognitive processes, because it uses sinusoidal currents that are bound to one frequency only. Using tACS allows to modulate brain oscillations and in turn to influence cognitive processes, thereby demonstrating the causal link between the two. Here, we review findings about the physiological mechanism of tACS and studies that have used tACS to modulate basic motor and sensory processes as well as higher cognitive processes like memory, ambiguous perception, and decision making.
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Single stage buck-boost DC-AC neutral point clamped inverter
DEFF Research Database (Denmark)
Mo, Wei; Loh, Poh Chiang; Andrew, A.
2012-01-01
This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence......, it has enhanced buck-boost functionality and low output voltage distortions compared to the traditional Z-source inverter; it has continuous input current which reduces the source stress and inverter noise; it also contains two built-in capacitors which can block the DC current in the transformer...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...
Barriers and solutions for AC low voltage fault ride-through on multi-terminal HVDC grids
Energy Technology Data Exchange (ETDEWEB)
Silva, B.; Moreira, C.L.; Leite, H.; Pecas Lopes, J.A. [Porto Univ. (Portugal). Dept. de Engenharia Electrotecnica e de Computadores (DEEC); Tecnologia e Ciencia, Porto (Portugal). Inst. de Engenharia de Sistemas e Computadores (INESCTEC)
2012-07-01
This work analyzes the multi-terminal DC grids dynamics under AC mainland grid fault events envisioning to assess the feasibility of fault ride-through provision. The major bottleneck related with the operation under AC fault consists on the DC side power imbalance that takes place due to the HVDC converter current limits and consequent incapability of delivering all the generated power to the grid. It was also verified that the power imbalance leads to a DC overvoltage occurrence. The mechanism of including chopper devices at the onshore converters DC terminals has been studied as a mean of power equilibrium promotion. Simulations comparing the both cases were performed and the comparison and the effectiveness of the adopted approach are also presented. (orig.)
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
AC losses in (Bi,Pb) 2Sr 2Ca 2Cu 3O x tapes
D'Anna, G.; Indenbom, M. V.; André, M.-O.; Benoit, W.; Grivel, J.-C.; Hensel, B.; Flükiger, R.
1994-05-01
A double peak structure is observed in the AC losses of (Bi,Pb) 2Sr 2Ca 2Cu 3O x silver-sheathed tapes using a torsion-pendulum oscillator. The low-temperature peak is associated to the intragrain flux expulsion, while the high-temperature peak results from a macroscopic current path around the whole sample due to a well-coupled fraction of the grains. The flux pinning by the dislocations forming small-angle grain boundaries is suggested to control the transport current.
Research on the Plasma Anemometer Based on AC Glow Discharge
Directory of Open Access Journals (Sweden)
Bing Yu
2017-01-01
Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
International Nuclear Information System (INIS)
Yuan Wujie; Luo Xiaoshu; Jiang Pinqun
2007-01-01
In this paper, we propose a new model of weighted small-world biological neural networks based on biophysical Hodgkin-Huxley neurons with side-restrain mechanism. Then we study excitement properties of the model under alternating current (AC) stimulation. The study shows that the excitement properties in the networks are preferably consistent with the behavior properties of a brain nervous system under different AC stimuli, such as refractory period and the brain neural excitement response induced by different intensities of noise and coupling. The results of the study have reference worthiness for the brain nerve electrophysiology and epistemological science.
AC electric field induced dipole-based on-chip 3D cell rotation.
Benhal, Prateek; Chase, J Geoffrey; Gaynor, Paul; Oback, Björn; Wang, Wenhui
2014-08-07
The precise rotation of suspended cells is one of the many fundamental manipulations used in a wide range of biotechnological applications such as cell injection and enucleation in nuclear transfer (NT) cloning. Noticeably scarce among the existing rotation techniques is the three-dimensional (3D) rotation of cells on a single chip. Here we present an alternating current (ac) induced electric field-based biochip platform, which has an open-top sub-mm square chamber enclosed by four sidewall electrodes and two bottom electrodes, to achieve rotation about the two axes, thus 3D cell rotation. By applying an ac potential to the four sidewall electrodes, an in-plane (yaw) rotating electric field is generated and in-plane rotation is achieved. Similarly, by applying an ac potential to two opposite sidewall electrodes and the two bottom electrodes, an out-of-plane (pitch) rotating electric field is generated and rolling rotation is achieved. As a prompt proof-of-concept, bottom electrodes were constructed with transparent indium tin oxide (ITO) using the standard lift-off process and the sidewall electrodes were constructed using a low-cost micro-milling process and then assembled to form the chip. Through experiments, we demonstrate rotation of bovine oocytes of ~120 μm diameter about two axes, with the capability of controlling the rotation direction and the rate for each axis through control of the ac potential amplitude, frequency, and phase shift, and cell medium conductivity. The maximum observed rotation rate reached nearly 140° s⁻¹, while a consistent rotation rate reached up to 40° s⁻¹. Rotation rate spectra for zona pellucida-intact and zona pellucida-free oocytes were further compared and found to have no effective difference. This simple, transparent, cheap-to-manufacture, and open-top platform allows additional functional modules to be integrated to become a more powerful cell manipulation system.
Current-driven parametric resonance in magnetic multilayers
International Nuclear Information System (INIS)
Wang, C; Seinige, H; Tsoi, M
2013-01-01
Current-induced parametric excitations were observed in point-contact spin-valve nanodevices. Point contacts were used to inject high densities of direct and microwave currents into spin valves, thus producing oscillating spin-transfer and Oersted-field torques on magnetic moments. The resulting magnetodynamics were observed electrically by measuring rectified voltage signals across the contact. In addition to the spin-torque-driven ferromagnetic resonance we observe doubled-frequency signals which correspond to the parametric excitation of magnetic moments. Numerical simulations suggest that while both spin-transfer torque and ac Oersted field contribute to the parametrically excited dynamics, the ac spin torque dominates, and dc spin torque can switch it on and off. The dc bias dependence of the parametric resonance signal enabled the mapping of instability regions characterizing the nonlinearity of the oscillation. (paper)
Effects of Linear Falling Ramp Reset Pulse on Addressing Operation in AC PDP
International Nuclear Information System (INIS)
Liu Zujun; Liang Zhihu; Liu Chunliang; Meng Lingguo
2006-01-01
The effects of linear falling ramp reset pulse related to addressing operation in an alternating current plasma display panel (AC PDP) were studied. The wall charge waveforms were measured by the electrode balance method in a 12-inch coplanar AC PDP. The wall charge waveforms show the relationship between the slope ratio of the falling ramp reset pulse and the wall charges at the end of the falling ramp reset pulse which influences the addressing stability. Then the effects of the slope ratio of the linear falling ramp reset pulse on the addressing voltage and addressing time were investigated. The experimental results show that the minimum addressing voltage increases with the increase of the slope ratio of the falling ramp reset pulse, and so does the minimum addressing time. Based on the experimental results, the optimization of the addressing time and the slope ratio of the falling ramp pulse is discussed
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals
Directory of Open Access Journals (Sweden)
Nan Gao
2017-05-01
Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.
Comparative study of superconducting fault current limiter both for LCC-HVDC and VSC-HVDC systems
Energy Technology Data Exchange (ETDEWEB)
Lee, Jong-Geon; Khan, Umer Amir; Lim, Sung-Woo; Shin, Woo-ju; Seo, In-Jin; Lee, Bang-Wook, E-mail: bangwook@hanyang.ac.kr
2015-11-15
Highlights: • The role of SFCL in types of HVDC system was evaluated. • A simulation model based on Korea Jeju–Haenam HVDC power system was designed in Matlab/Simulink. • Utilizing the designed both HVDC power system models, the efficiency of DC-SFCL was relatively low, compared to AC-SFCL. • It was deduced that the AC-SFCL was more effective in LCC-HVDC system than VSC-HVDC system. - Abstract: High Voltage Direct Current (HVDC) system has been evaluated as the optimum solution for the renewable energy transmission and long-distance power grid connections. In spite of the various advantages of HVDC system, it still has been regarded as an unreliable system compared to AC system due to its vulnerable characteristics on the power system fault. Furthermore, unlike AC system, optimum protection and switching device has not been fully developed yet. Therefore, in order to enhance the reliability of the HVDC systems mitigation of power system fault and reliable fault current limiting and switching devices should be developed. In this paper, in order to mitigate HVDC fault, both for Line Commutated Converter HVDC (LCC-HVDC) and Voltage Source Converter HVDC (VSC-HVDC) system, an application of resistive superconducting fault current limiter which has been known as optimum solution to cope with the power system fault was considered. Firstly, simulation models for two types of LCC-HVDC and VSC-HVDC system which has point to point connection model were developed. From the designed model, fault current characteristics of faulty condition were analyzed. Second, application of SFCL on each types of HVDC system and comparative study of modified fault current characteristics were analyzed. Consequently, it was deduced that an application of AC-SFCL on LCC-HVDC system with point to point connection was desirable solution to mitigate the fault current stresses and to prevent commutation failure in HVDC electric power system interconnected with AC grid.
Comparative study of superconducting fault current limiter both for LCC-HVDC and VSC-HVDC systems
International Nuclear Information System (INIS)
Lee, Jong-Geon; Khan, Umer Amir; Lim, Sung-Woo; Shin, Woo-ju; Seo, In-Jin; Lee, Bang-Wook
2015-01-01
Highlights: • The role of SFCL in types of HVDC system was evaluated. • A simulation model based on Korea Jeju–Haenam HVDC power system was designed in Matlab/Simulink. • Utilizing the designed both HVDC power system models, the efficiency of DC-SFCL was relatively low, compared to AC-SFCL. • It was deduced that the AC-SFCL was more effective in LCC-HVDC system than VSC-HVDC system. - Abstract: High Voltage Direct Current (HVDC) system has been evaluated as the optimum solution for the renewable energy transmission and long-distance power grid connections. In spite of the various advantages of HVDC system, it still has been regarded as an unreliable system compared to AC system due to its vulnerable characteristics on the power system fault. Furthermore, unlike AC system, optimum protection and switching device has not been fully developed yet. Therefore, in order to enhance the reliability of the HVDC systems mitigation of power system fault and reliable fault current limiting and switching devices should be developed. In this paper, in order to mitigate HVDC fault, both for Line Commutated Converter HVDC (LCC-HVDC) and Voltage Source Converter HVDC (VSC-HVDC) system, an application of resistive superconducting fault current limiter which has been known as optimum solution to cope with the power system fault was considered. Firstly, simulation models for two types of LCC-HVDC and VSC-HVDC system which has point to point connection model were developed. From the designed model, fault current characteristics of faulty condition were analyzed. Second, application of SFCL on each types of HVDC system and comparative study of modified fault current characteristics were analyzed. Consequently, it was deduced that an application of AC-SFCL on LCC-HVDC system with point to point connection was desirable solution to mitigate the fault current stresses and to prevent commutation failure in HVDC electric power system interconnected with AC grid.
A perpendicular AC biased ferrite tuned cavity for the TRIUMF KAON factory booster synchrotron
International Nuclear Information System (INIS)
Poirier, R.L.; Enegren, T.A.; Haddock, C.; Enchevich, I.
1990-06-01
The rf cavity for the booster synchrotron requires a frequency swing of 46 MHz at a repetition rate of 50 Hz. This will be accomplished using a tuner containing yttrium garnet ferrite where the bias field is perpendicular to the rf magnetic field. Conventional methods use parallel biased NiZn ferrite. Yttrium garnet ferrite possess a high electric quality factor. However the ac magnetizing circuit is much more complicated and special care must be taken to minimize the induced eddy current losses when designing the tuner. A dc biased prototype cavity was constructed and tested at Los Alamos. As part of the project definition study for the proposed KAON factory, this cavity has now been almost entirely rebuilt at TRIUMF with a completely redesigned tuner for ac bias operation. Measurements and test results will be reported. (Author) 2 refs., 8 figs
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Hierarchical Control of Parallel AC-DC Converter Interfaces for Hybrid Microgrids
DEFF Research Database (Denmark)
Lu, Xiaonan; Guerrero, Josep M.; Sun, Kai
2014-01-01
In this paper, a hierarchical control system for parallel power electronics interfaces between ac bus and dc bus in a hybrid microgrid is presented. Both standalone and grid-connected operation modes in the dc side of the microgrid are analyzed. Concretely, a three-level hierarchical control system...... equal or proportional dc load current sharing. The common secondary control level is designed to eliminate the dc bus voltage deviation produced by the droop control, with dc bus voltage in the hybrid microgrid boosted to an acceptable range. After guaranteeing the performance of the dc side standalone...
DEFF Research Database (Denmark)
Zhang, Chi; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez
2017-01-01
In modular uninterruptible power supplies (UPSs), several DC/AC modules are required to work in parallel. This structure allows the system to be more reliable and flexible. These DC/AC modules share the same DC bus and AC critical bus. Module differences, such as filter inductor, filter capacitor......, control parameters, and so on, will make it possible for the potential zero sequence current to flow among the modules. This undesired type of circulating current will bring extra losses to the power semiconductor devices in the system, which should be paid special attention in high power application...... scenarios. In this paper, plug’n’play modules and cycle control are discussed and validated through experimental results. Moreover, potential zero sequence circulating current impact on power semiconductor devices thermal performance is also analyzed in this paper....
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
Power Electronic Transformer based Three-Phase PWM AC Drives
Basu, Kaushik
A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common
International Nuclear Information System (INIS)
Krueger Olsen, S.; Kuehle, A.; Traeholt, C.; C Rasmussen, C.; Toennesen, O.; Daeumling, M.; Rasmussen, C.N.; Willen, D.W.A.
1999-01-01
The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current and the voltage over the cable close to 90 degrees. This has the effect that the loss cannot be derived directly using most commercial lock-in amplifiers due to their limited absolute accuracy. However, by using two lock-in amplifiers and an appropriate correction scheme the high relative accuracy of such lock-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce the inductive voltage. The 1 μV cm -1 critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6±0.15 W m -1 . This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far at these high currents. (author)
Bächinger, Marc; Zerbi, Valerio; Moisa, Marius; Polania, Rafael; Liu, Quanying; Mantini, Dante; Ruff, Christian; Wenderoth, Nicole
2017-05-03
Resting state fMRI (rs-fMRI) is commonly used to study the brain's intrinsic neural coupling, which reveals specific spatiotemporal patterns in the form of resting state networks (RSNs). It has been hypothesized that slow rs-fMRI oscillations (5 Hz); however, causal evidence for this relationship is currently lacking. Here we measured rs-fMRI in humans while applying transcranial alternating current stimulation (tACS) to entrain brain rhythms in left and right sensorimotor cortices. The two driving tACS signals were tailored to the individual's α rhythm (8-12 Hz) and fluctuated in amplitude according to a 1 Hz power envelope. We entrained the left versus right hemisphere in accordance to two different coupling modes where either α oscillations were synchronized between hemispheres (phase-synchronized tACS) or the slower oscillating power envelopes (power-synchronized tACS). Power-synchronized tACS significantly increased rs-fMRI connectivity within the stimulated RSN compared with phase-synchronized or no tACS. This effect outlasted the stimulation period and tended to be more effective in individuals who exhibited a naturally weak interhemispheric coupling. Using this novel approach, our data provide causal evidence that synchronized power fluctuations contribute to the formation of fMRI-based RSNs. Moreover, our findings demonstrate that the brain's intrinsic coupling at rest can be selectively modulated by choosing appropriate tACS signals, which could lead to new interventions for patients with altered rs-fMRI connectivity. SIGNIFICANCE STATEMENT Resting state fMRI (rs-fMRI) has become an important tool to estimate brain connectivity. However, relatively little is known about how slow hemodynamic oscillations measured with fMRI relate to electrophysiological processes. It was suggested that slowly fluctuating power envelopes of electrophysiological signals synchronize across brain areas and that the topography of this activity is spatially correlated to
Application of digital PWM technology in current transducers
International Nuclear Information System (INIS)
Liu Huifang; Hu Zhimin; Li Rui
2012-01-01
With the development of DSP technology and mature use of PID technology,, a new program for DC or AC signal measurement is proposed. Combined with the DSP chip timer module and PID algorithm, PWM signals are generated to control the feedback circuit for the compensation current. Finally the measured current value can be obtained according to the ampere-turns compensation current and the measured current. Studies have shown that this technology enables new current transducers have high stability. (authors)
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
10-bit rapid single flux quantum digital-to-analog converter for ac voltage standard
International Nuclear Information System (INIS)
Maezawa, M; Hirayama, F
2008-01-01
Digital-to-analog (D/A) converters based on rapid single flux quantum (RSFQ) technology are under development for ac voltage standard applications. We present design and test results on a prototype 10-bit version integrated on a single chip. The 10-bit chip includes over 6000 Josephson junctions and consumes a bias current exceeding 1 A. To reduce the effects of the high bias current on circuit operation, a custom design method was employed in part and large circuit blocks were divided into smaller ones. The 10-bit chips were fabricated and tested at low speed. The test results suggested that our design approach could manage large bias currents on the order of 1 A per chip
Critical current measurements of high Tc superconductors in a scanning low temperature cryostat
International Nuclear Information System (INIS)
Telschow, K.L.; O'Brien, T.K.
1991-01-01
Maintaining uniformity of properties over long distances is one of the fabrication problems encountered with the new high T c superconductors. Uniform properties are crucial in long tapes or wires with high critical current since local nonuniformities can limit the current carrying capacity of the whole piece. Transport critical currents in high T c superconductors are conventionally measured with the contact 4-point probe DC current-voltage technique. This technique requires contact with the sample and and spatially averages over the region between the two voltage contacts. Two techniques have been used to infer the critical state model. The first uses the net magnetization of a suitably shaped sample in an external magnetic field. The second combines a DC magnetic field with AC induced currents to infer spatial flux profiles. The AC magnetization technique offers an advantage in that it is noncontacting; however, it also averages the measurement over a large area and requires that the sample be shaped and positioned such that it exhibits zero demagnetizing factor. This paper describes a measurement technique and a scanning cryostat assembly that are capable of determining local critical current in a tape or wire with high resolution and without any direct sample electrical contact. A small compensated coil was used to induce AC currents in slab-shaped samples. The coil was situated near the surface on one side of the slab. With this method, the AC probe can be used as a noncontacting dissipation probe, replacing the voltage probe in the 4-point contact method, when an externally driven transport current is used, or by itself as a local critical state generator and dissipation detector. The results are shown to be meaningful even when the internal magnetic field is not uniform due to shape demagnetizing effects. 10 refs., 5 figs
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Xiong, Yuan; Chung, Suk-Ho; Cha, Min
2016-01-01
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
Xiong, Yuan
2016-06-24
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
Capacitance measurements and AC conductivity of Nickel Phthalocyanine films
International Nuclear Information System (INIS)
Darwish, S.
2005-01-01
A C dark Current measurements of nickel phthalocyanine thin films using ohmic gold electrodes are investigated in the frequency range 30-10 Hz and within the temperature range 295-385 K. The A C conductivity as D Ac is found to vary as within the index s < 1, indicating a dominant hopping process at low temperatures. From the temperature dependence of A C conductivity, free carrier conduction with mean activation energy of 0.31 eV is observed at higher temperatures. Capacitance and loss tangent are found to be decreased with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
Directory of Open Access Journals (Sweden)
S. Yu. Buryak
2014-12-01
Full Text Available Purpose. The paper is aimed to establish the dependence of changes in the time domain and spectral components of the current in the circuit of the AC electric point motor on its technical condition, to identify the common features for the same type of damage. It is necessary using the analysis of the received signals to carry out the remote diagnosis and determination of faults and defects of electric point motors. In addition it suggested to accelerate the process of the failure, malfunction and damage search. Authors propose the automated approach to the service of remote floor automation equipment, which is located in the envelope of trains. Reduction of the threat to life and health of staff by reducing the residence time in the zone of train movement. Reduce the impact of human factors on the result of service. Methodology. The paper studies the structure, parameters and characteristics, the operation and maintenance characteristics of the AC electric point motors. Determination of the main types of possible faults in the process depending on the operating conditions. Presentation of the electric motor as an object of diagnosis. Findings. The time dependences of the current in the circuit of electric point motor for its various states was obtained. The connection between the technical condition of electric point motor and the performance of current curve in time and spectral domains was established. The revealed deviations from the reference signal were justified. According to the obtained results it was made the conclusion. Originality. A method for diagnosing the state of the AC electric point motor by the time dependence and the spectral composition of the current in its circuit was proposed. The connection diagram to the motor windings based on non-infringement of electric parameters of connection circuit in the actual operating conditions was applied. Practical value. The obtained results suggest the possibility and feasibility of
Comparative study of superconducting fault current limiter both for LCC-HVDC and VSC-HVDC systems
Lee, Jong-Geon; Khan, Umer Amir; Lim, Sung-Woo; Shin, Woo-ju; Seo, In-Jin; Lee, Bang-Wook
2015-11-01
High Voltage Direct Current (HVDC) system has been evaluated as the optimum solution for the renewable energy transmission and long-distance power grid connections. In spite of the various advantages of HVDC system, it still has been regarded as an unreliable system compared to AC system due to its vulnerable characteristics on the power system fault. Furthermore, unlike AC system, optimum protection and switching device has not been fully developed yet. Therefore, in order to enhance the reliability of the HVDC systems mitigation of power system fault and reliable fault current limiting and switching devices should be developed. In this paper, in order to mitigate HVDC fault, both for Line Commutated Converter HVDC (LCC-HVDC) and Voltage Source Converter HVDC (VSC-HVDC) system, an application of resistive superconducting fault current limiter which has been known as optimum solution to cope with the power system fault was considered. Firstly, simulation models for two types of LCC-HVDC and VSC-HVDC system which has point to point connection model were developed. From the designed model, fault current characteristics of faulty condition were analyzed. Second, application of SFCL on each types of HVDC system and comparative study of modified fault current characteristics were analyzed. Consequently, it was deduced that an application of AC-SFCL on LCC-HVDC system with point to point connection was desirable solution to mitigate the fault current stresses and to prevent commutation failure in HVDC electric power system interconnected with AC grid.
Choi, Benjamin B.; Hunker, Keith R.; Hartwig, Jason; Brown, Gerald V.
2017-01-01
The NASA Glenn Research Center (GRC) has been developing the high efficiency and high-power density superconducting (SC) electric machines in full support of electrified aircraft propulsion (EAP) systems for a future electric aircraft. A SC coil test rig has been designed and built to perform static and AC measurements on BSCCO, (RE)BCO, and YBCO high temperature superconducting (HTS) wire and coils at liquid nitrogen (LN2) temperature. In this paper, DC measurements on five SC coil configurations of various geometry in zero external magnetic field are measured to develop good measurement technique and to determine the critical current (Ic) and the sharpness (n value) of the super-to-normal transition. Also, standard procedures for coil design, fabrication, coil mounting, micro-volt measurement, cryogenic testing, current control, and data acquisition technique were established. Experimentally measured critical currents are compared with theoretical predicted values based on an electric-field criterion (Ec). Data here are essential to quantify the SC electric machine operation limits where the SC begins to exhibit non-zero resistance. All test data will be utilized to assess the feasibility of using HTS coils for the fully superconducting AC electric machine development for an aircraft electric propulsion system.
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
Melville, G; Fan Liu, Sau; Allen, B J
2006-09-01
Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry