Directory of Open Access Journals (Sweden)
Athanasios Lykidis
Full Text Available BACKGROUND: Cupriavidus necator JMP134 is a Gram-negative beta-proteobacterium able to grow on a variety of aromatic and chloroaromatic compounds as its sole carbon and energy source. METHODOLOGY/PRINCIPAL FINDINGS: Its genome consists of four replicons (two chromosomes and two plasmids containing a total of 6631 protein coding genes. Comparative analysis identified 1910 core genes common to the four genomes compared (C. necator JMP134, C. necator H16, C. metallidurans CH34, R. solanacearum GMI1000. Although secondary chromosomes found in the Cupriavidus, Ralstonia, and Burkholderia lineages are all derived from plasmids, analyses of the plasmid partition proteins located on those chromosomes indicate that different plasmids gave rise to the secondary chromosomes in each lineage. The C. necator JMP134 genome contains 300 genes putatively involved in the catabolism of aromatic compounds and encodes most of the central ring-cleavage pathways. This strain also shows additional metabolic capabilities towards alicyclic compounds and the potential for catabolism of almost all proteinogenic amino acids. This remarkable catabolic potential seems to be sustained by a high degree of genetic redundancy, most probably enabling this catabolically versatile bacterium with different levels of metabolic responses and alternative regulation necessary to cope with a challenging environment. From the comparison of Cupriavidus genomes, it is possible to state that a broad metabolic capability is a general trait for Cupriavidus genus, however certain specialization towards a nutritional niche (xenobiotics degradation, chemolithoautotrophy or symbiotic nitrogen fixation seems to be shaped mostly by the acquisition of "specialized" plasmids. CONCLUSIONS/SIGNIFICANCE: The availability of the complete genome sequence for C. necator JMP134 provides the groundwork for further elucidation of the mechanisms and regulation of chloroaromatic compound biodegradation.
Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase.
Li, Qunrui; Metthew Lam, L K; Xun, Luying
2011-11-01
Ethanol is a renewable biofuel, and it can be produced from lignocellulosic biomass. The biomass is usually converted to hydrolysates that consist of sugar and sugar derivatives, such as furfural. Yeast ferments sugar to ethanol, but furfural higher than 3 mM is inhibitory. It can take several days for yeast cells to reduce furfural to non-inhibitory furfuryl alcohol before producing ethanol. Bioreduction of furfural to furfuryl alcohol before fermentation may relieve yeast from furfural toxicity. We observed that Cupriavidus necator JMP134, a strict aerobe, rapidly reduced 17 mM furfural to less than 3 mM within 14 min with cell turbidity of 1.0 at 600 nm at 50°C. The rapid reduction consumed ethanol. The "furfural reductase" (FurX) was purified, and it oxidized ethanol to acetaldehyde and reduced furfural to furfuryl alcohol with NAD(+) as the cofactor. The protein was identified with mass spectrometry fingerprinting to be a hypothetical protein belonging to Zn-dependent alcohol dehydrogenase family. The furX-inactivation mutant of C. necator JMP134 lost the ability to rapidly reduce furfural, and Escherichia coli producing recombinant FurX gained the ability. Thus, an alcohol dehydrogenase enabled bacteria to rapidly reduce furfural with ethanol as the reducing power.
Energy Technology Data Exchange (ETDEWEB)
Lykidis, Athanasios; Perez-Pantoja, Danilo; Ledger, Thomas; Mavromatis, Kostantinos; Anderson, Iain J.; Ivanova, Natalia N.; Hooper, Sean D.; Lapidus, Alla; Lucas, Susan; Gonzalez, Bernardo; Kyrpides, Nikos C.
2010-02-01
Cupriavidus necator JMP134 (formerly Ralstonia eutropha JMP134) is a Gram-negative {beta}-proteobacterium able to degrade a variety of chloroaromatic compounds and chemically-related pollutants. It was originally isolated based on its ability to use 2,4 dichlorophenoxyacetic acid (2,4-D) as a sole carbon and energy source [1]. In addition to 2,4-D, this strain can also grow on a variety of aromatic substrates, such as 4-chloro-2-methylphenoxyacetate (MCPA), 3-chlorobenzoic acid (3-CB) [2], 2,4,6-trichlorophenol [3], and 4-fluorobenzoate [4]. The genes necessary for 2,4-D utilization have been identified. They are located in two clusters on plasmid pPJ4: tfd{sub I} and tfd{sub II} [5,6,7,8]. The sequence and analysis of plasmid pJP4 was reported and a congruent model for bacterial adaptation to chloroaromatic pollutants was proposed [9]. According to this model, catabolic gene clusters assemble in a modular manner into broad-host-range plasmid backbones by means of repeated chromosomal capture events. Cupriavidus and related Burkholderia genomes are typically multipartite, composed of two large replicons (chromosomes) accompanied by classical plasmids. Previous work with Burkholderia xenovorans LB400 revealed a differential gene distribution with core functions preferentially encoded by the larger chromosome and secondary functions by the smaller [10]. It has been proposed that the secondary chromosomes in many bacteria originated from ancestral plasmids which, in turn, had been the recipient of genes transferred earlier from ancestral primary chromosomes [11]. The existence of multiple Cupriavidus and Burkholderia genomes provides the opportunity for comparative studies that will lead to a better understanding of the evolutionary mechanisms for the formation of multipartite genomes and the relation with biodegradation abilities.
Kang, ChulHee; Hayes, Robert; Sanchez, Emiliano J.; Webb, Brian N.; Li, Qunrui; Hooper, Travis; Nissen, Mark S.; Xun, Luying
2012-01-01
Summary FurX is a tetrameric Zn-dependent alcohol dehydrogenase (ADH) from Cupriavidus necator JMP134. The enzyme rapidly reduces furfural with NADH as the reducing power. For the first time among characterized ADHs, the high-resolution structures of all reaction steps were obtained in a time-resolved manner, thereby illustrating the complete catalytic events of NADH-dependent reduction of furfural and the dynamic Zn2+ coordination among Glu66, water, substrate and product. In the fully closed conformation of the NADH complex, the catalytic turnover proved faster than observed for the partially closed conformation due to an effective proton transfer network. The domain motion triggered by NAD(H) association/dissociation appeared to facilitate dynamic interchanges in Zn2+ coordination with substrate and product molecules, ultimately increasing the enzymatic turnover rate. NAD+ dissociation appeared to be a slow process, involving multiple steps in concert with a domain opening and reconfiguration of Glu66. This agrees with the report that the cofactor is not dissociated from FurX during ethanol-dependent reduction of furfural, in which ethanol reduces NAD+ to NADH that is subsequently used for furfural reduction. PMID:22081946
Directory of Open Access Journals (Sweden)
Thomas Z. Lerch
2017-05-01
Full Text Available The development of bacterial biofilms in natural environments may alter important functions, such as pollutant bioremediation by modifying both the degraders' physiology and/or interactions within the matrix. The present study focuses on the influence of biofilm formation on the metabolism of a pesticide, 2,4-dichlorophenoxyacetic acid (2,4-D, by Cupriavidus necator JMP134. Pure cultures were established in a liquid medium with 2,4-D as a sole carbon source with or without sand grains for 10 days. Bacterial numbers and 2,4-D concentrations in solution were followed by spectrophotometry, the respiration rate by gas chromatography and the surface colonization by electron microscopy. In addition, isotopic techniques coupled with Fatty Acid Methyl Ester (FAME profiling were used to determine possible metabolic changes. After only 3 days, approximately 80% of the cells were attached to the sand grains and microscopy images showed that the porous medium was totally clogged by the development of a biofilm. After 10 days, there was 25% less 2,4-D in the solution in samples with sand than in control samples. This difference was due to (1 a higher (+8% mineralization of 2,4-D by sessile bacteria and (2 a retention (15% of 2,4-D in the biofilm matrix. Besides, the amount of carbohydrates, presumably constituting the biofilm polysaccharides, increased by 63%. Compound-specific isotope analysis revealed that the FAME isotopic signature was less affected by the biofilm lifestyle than was the FAME composition. These results suggest that sessile bacteria differ more in their anabolism than in their catabolism compared to their planktonic counterparts. This study stresses the importance of considering interactions between microorganisms and their habitat when studying pollutant dynamics in porous media.
Energy Technology Data Exchange (ETDEWEB)
Saavedra, Juan Matias; Acevedo, Francisca; Gonzalez, Myriam; Seeger, Michael [Universidad Tecnica Federico Santa Maria, Valparaiso (Chile). Lab. de Microbiologia Molecular y Biotecnologia
2010-07-15
Polychlorobiphenyls (PCBs) are classified as ''high-priority pollutants''. Diverse microorganisms are able to degrade PCBs. However, bacterial degradation of PCBs is generally incomplete, leading to the accumulation of chlorobenzoates (CBAs) as dead-end metabolites. To obtain a microorganism able to mineralize PCB congeners, the bph locus of Burkholderia xenovorans LB400, which encodes one of the most effective PCB degradation pathways, was incorporated into the genome of the CBA-degrading bacterium Cupriavidus necator JMP134-X3. The bph genes were transferred into strain JMP134-X3, using the mini-Tn5 transposon system and biparental mating. The genetically modified derivative, C. necator strain JMS34, had only one chromosomal insertion of bph locus, which was stable under nonselective conditions. This modified bacterium was able to grow on biphenyl, 3-CBA and 4-CBA, and degraded 3,5-CBA in the presence of m-toluate. The strain JMS34 mineralized 3-CB, 4-CB, 2,4{sup '}-CB, and 3,5-CB, without accumulation of CBAs. Bioaugmentation of PCB-polluted soils with C. necator strain JMS34 and with the native B. xenovorans LB400 was monitored. It is noteworthy that strain JMS34 degraded, in 1 week, 99% of 3-CB and 4-CB and approximately 80% of 2,4{sup '}-CB in nonsterile soil, as well as in sterile soil. Additionally, the bacterial count of strain JMS34 increased by almost two orders of magnitude in PCB-polluted nonsterile soil. In contrast, the presence of native microflora reduced the degradation of these PCBs by strain LB400 from 73% (sterile soil) to approximately 50% (nonsterile soil). This study contributes to the development of improved biocatalysts for remediation of PCB-contaminated environments. (orig.)
Czech Academy of Sciences Publication Activity Database
Samek, Ota; Obruča, S.; Šiler, Martin; Sedláček, P.; Benešová, P.; Kučera, D.; Márová, I.; Ježek, Jan; Bernatová, Silvie; Zemánek, Pavel
2016-01-01
Roč. 16, č. 11 (2016), 1808:1-7 ISSN 1424-8220 R&D Projects: GA ČR(CZ) GA15-20645S; GA MŠk(CZ) LO1212; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : Raman spectroscopy * Cupriavidus necator H16 * polyhydroxyalkanoates Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.677, year: 2016
Connecting lignin-degradation pathway with pretreatment inhibitor sensitivity of Cupriavidus necator
Directory of Open Access Journals (Sweden)
Wei eWang
2014-05-01
Full Text Available To produce lignocellulosic biofuels economically, the complete release of monomers from the plant cell wall components, cellulose, hemicellulose and lignin, through pretreatment and hydrolysis (both enzymatic and chemical, and the efficient utilization of these monomers as carbon sources, is crucial. In addition, the identification and development of robust microbial biofuel production strains that can tolerate the toxic compounds generated during pretreatment and hydrolysis is also essential. In this work, Cupriavidus necator was selected due to its capabilities for utilizing lignin monomers and producing polyhydroxylbutyrate (PHB, a bioplastic as well as an advanced biofuel intermediate. We characterized the growth kinetics of C. necator in pretreated corn stover slurry as well as individually in the presence of 11 potentially toxic compounds in the saccharified slurry. We found that C. necator was sensitive to the saccharified slurry produced from dilute acid pretreated corn stover. Five out of 11 compounds within the slurry were characterized as toxic to C. necator, namely ammonium acetate, furfural, hydroxymethylfurfural (HMF, benzoic acid, and p-coumaric acid. Aldehydes (e.g., furfural and HMF were more toxic than the acetate and the lignin degradation products benzoic acid and p-coumaric acid; furfural was identified as the most toxic compound. Although toxic to C. necator at high concentration, ammonium acetate, benzoic acid, and p-coumaric acid could be utilized by C. necator with a stimulating effect on C. necator growth. Consequently, the lignin degradation pathway of C. necator was reconstructed based on genomic information and literature. The efficient conversion of intermediate catechol to downstream products of cis,cis-muconate or 2-hydroxymuconate-6-semialdehyde may help improve the robustness of C. necator to benzoic acid and p-coumaric acid as well as improve PHB productivity.
Passanha, Pearl; Esteves, Sandra R; Kedia, Gopal; Dinsdale, Richard M; Guwy, Alan J
2013-11-01
The production of polyhydroxyalkanoates (PHAs) using digestate liquor as culture media is a novel application to extend the existing uses of digestates. In this study, two micro-filtered digestates (0.22 μm) were evaluated as a source of complex culture media for the production of PHA by Cupriavidus necator as compared to a conventional media. Culture media using a mixture of micro-filtered liquors from food waste and from wheat feed digesters showed a maximum PHA accumulation of 12.29 g/l PHA, with 90% cell dry weight and a yield of 0.48 g PHA/g VFA consumed, the highest reported to date for C. necator studies. From the analysis of the starting and residual media, it was concluded that ammonia, potassium, magnesium, sulfate and phosphate provided in the digestate liquors were vital for the initial growth of C. necator whereas copper, iron and nickel may have played a significant role in PHA accumulation. Copyright © 2013 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wang, W. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Yang, S. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Hunsinger, G. B. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Pienkos, P. T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Johnson, D. K. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2014-05-27
In order to produce lignocellulosic biofuels economically, the complete release of monomers from the plant cell wall components, cellulose, hemicellulose, and lignin, through pre-treatment and hydrolysis (both enzymatic and chemical), and the efficient utilization of these monomers as carbon sources, is crucial. In addition, the identification and development of robust microbial biofuel production strains that can tolerate the toxic compounds generated during pre-treatment and hydrolysis is also essential. In this work, Cupriavidus necator was selected due to its capabilities for utilizing lignin monomers and producing polyhydroxylbutyrate (PHB), a bioplastic as well as an advanced biofuel intermediate. We characterized the growth kinetics of C. necator in pre-treated corn stover slurry as well as individually in the pre-sence of 11 potentially toxic compounds in the saccharified slurry. We found that C. necator was sensitive to the saccharified slurry produced from dilute acid pre-treated corn stover. Five out of 11 compounds within the slurry were characterized as toxic to C. necator, namely ammonium acetate, furfural, hydroxymethylfurfural (HMF), benzoic acid, and p-coumaric acid. Aldehydes (e.g., furfural and HMF) were more toxic than the acetate and the lignin degradation products benzoic acid and p-coumaric acid; furfural was identified as the most toxic compound. Although toxic to C. necator at high concentration, ammonium acetate, benzoic acid, and p-coumaric acid could be utilized by C. necator with a stimulating effect on C. necator growth. Consequently, the lignin degradation pathway of C. necator was reconstructed based on genomic information and literature. The efficient conversion of intermediate catechol to downstream products of cis,cis-muconate or 2-hydroxymuconate-6-semialdehyde may help improve the robustness of C. necator to benzoic acid and p-coumaric acid as well as improve PHB productivity.
PURIFICATION AND CHARACTERIZATION OF POLY-HYDROXYBUTYRATE (PHB IN CUPRIAVIDUS NECATOR
Directory of Open Access Journals (Sweden)
Sergio Leon De Rooy
2010-06-01
Full Text Available Purification and characterization of biodegradable plastic namely Polyhydroxybutyrate (PHB in Cupriavidus necator have been carried out. C. necator was grown on a Ramsay medium with fixed substrate conditions and optimized for time. Stepwise purification of PHB was carried out, by using hydrogen peroxide and chloroform. The effect of temperature, time, and hydrogen peroxide concentration on the purification were also evaluated. The extracted PHB was studied with XRD, FTIR and 1H-NMR and 13C-NMR to determine its structure and purity. Yield and crystallinity were also studied with HPLC and XRD, respectively. The results of the research showed that higher concentrations of hydrogen peroxide gave better yields, whereas higher temperatures and longer lysis times led to different results. Higher crystallinity was observed when purification temperatures were elevated, but higher hydrogen peroxide concentration and longer extraction time gave varying crystallinity. The highest yield ca 66.10 % DCW was reached by purification using H2O2 20 %, at 100 oC for 2 h. The results of TGA analysis indicated that the purity of the PHB obtained was about 75 % and by using DSC, it was found that the PHB showed good thermal properties. Keywords: PHB, recovery, hydrogen peroxide, characterization
Sharma, Parveen K; Fu, Jilagamazhi; Spicer, Victor; Krokhin, Oleg V; Cicek, Nazim; Sparling, Richard; Levin, David B
2016-12-01
Synthesis of poly-[3-hydroxybutyrate] (PHB) by Cupriavidus necator H16 in batch cultures was evaluated using three biodiesel-derived by-products as the sole carbon sources: waste glycerol (REG-80, refined to 80 % purity with negligible free fatty acids); glycerol bottom (REG-GB, with up to 65 % glycerol and 35 % free fatty acids), and free fatty acids (REG-FFA, with up to 75 % FFA and no glycerol). All the three substrates supported growth and PHB production by C. necator, with polymer accumulation ranging from 9 to 84 % cell dry weight (cdw), depending on the carbon source. To help understand these differences, proteomic analysis indicated that although C. necator H16 was able to accumulate PHB during growth on all three biodiesel by-products, no changes in the levels of PHB synthesis enzymes were observed. However, significant changes in the levels of expression were observed for two Phasin proteins involved with PHB accumulation, and for a number of gene products in the fatty acid β-oxidation pathway, the Glyoxylate Shunt, and the hydrogen (H2) synthesis pathways in C. necator cells cultured with different substrates. The glycerol transport protein (GlpF) was induced in REG-GB and REG-80 glycerol cultures only. Cupriavidus necator cells cultured with REG-GB and REG-FFA showed up-regulation of β-oxidation and Glyoxylate Shunt pathways proteins at 24 h pi, but H2 synthesis pathways enzymes were significantly down-regulated, compared with cells cultured with waste glycerol. Our data confirmed earlier observations of constitutive expression of PHB synthesis proteins, but further suggested that C. necator H16 cells growing on biodiesel-derived glycerol were under oxidative stress.
Berezina, Nathalie
2013-01-25
In the global context of increased concerns for our environment, the use of bioplastics as a replacement for existing petroleum-based polymers is an important challenge. Indeed, bioplastics hardly meet economical and technical constraints. One, of the most promising among currently studied bioplastics, is the polyhydroxyalkanoate (PHA). To circumvent the economical issue for this particular biopolymer one solution can be the enhancement of the overall productivity by the improvement of the nutritional medium of the microorganism producing the biopolymer. Thus, several nutrition media, supplemented or not with sodium glutamate, were tested for the growth and the PHA production by Cupriavidus necator DSM 545 strain. The most efficient for the biomass and the PHA production improvement were found to be the Luria broth (LB) and the Bonnarme's media, both supplemented with 10 g/L sodium glutamate. Hence the overall productivity was 33 times enhanced comparing to traditional cultivation methods. These results open a new route for the PHA production by C. necator which appears to be more suitable on a rich, or enriched, medium with no limiting factors. Copyright © 2012 Elsevier B.V. All rights reserved.
Tolerance to and Accumulation of Cadmium, Copper, and Zinc by Cupriavidus necator
Directory of Open Access Journals (Sweden)
Rayssa Pereira Vicentin
2018-03-01
Full Text Available ABSTRACT Preliminary results of in vitro experiments with multicontaminated soils and solid media indicated that nodulating diazotrophic bacteria of the genus Cupriavidus are promising for the remediation of contaminated environments due to their symbiosis with legumes and metal tolerance. Thus, strains of Cupriavidus spp. (LMG 19424T, UFLA 01-659, UFLA 01-663, and UFLA 02-71 were tested for their ability to tolerate and bioaccumulate cadmium (Cd, copper (Cu, and zinc (Zn in Luria-Bertani broth. Changes in the growth pattern of Cupriavidus strains in the presence or absence of heavy metals were analyzed by scanning electron microscopy and metal allocation by transmission electron microscopy, to clarify the mechanisms of bioremediation. Highest tolerance was detected for strain UFLA 01-659 (minimum inhibitory concentration of 5, 4.95, and 14.66 mmol L−1 of Cd, Cu, and Zn, respectively. Among the removal rates of the metals tested (9.0, 4.6, and 3.2 mg L−1 of Cd, Cu, and Zn, respectively, the bacterial activity was clearly highest for Cd. The efficiency of strain UFLA 01-659 in removing the heavy metals is associated with its high biomass production and/or higher contents of heavy metals adsorbed and absorbed in the biomass. In response to the presence of heavy metals in the liquid culture medium, the bacteria produced exopolysaccharides and small and aggregated cells. However, these responses varied according to the strains and heavy metals. Regarding allocation, all heavy metals were adsorbed on the cell wall and membrane, whereas complexation was observed intracellularly and only for Cu and Zn. These results indicate the possibility of using C. necator UFLA 01-659 for remediation in areas with very high Cd, Cu, and Zn contents.
Directory of Open Access Journals (Sweden)
Bat-Erdene Jugder
2016-07-01
Full Text Available Hydrogenases are metalloenzymes that reversibly catalyse the oxidation or production of molecular hydrogen (H2. Amongst a number of promising candidates for application in the oxidation of H2 is a soluble [Ni–Fe] uptake hydrogenase (SH produced by Cupriavidus necator H16. In the present study, molecular characterisation of the SH operon, responsible for functional SH synthesis, was investigated by developing a green fluorescent protein (GFP reporter system to characterise PSH promoter activity using several gene cloning approaches. A PSH promoter-gfp fusion was successfully constructed and inducible GFP expression driven by the PSH promoter under de-repressing conditions in heterotrophic growth media was demonstrated in the recombinant C. necator H16 cells. Here we report the first successful fluorescent reporter system to study PSH promoter activity in C. necator H16. The fusion construct allowed for the design of a simple screening assay to evaluate PSH activity. Furthermore, the constructed reporter system can serve as a model to develop a rapid fluorescent based reporter for subsequent small-scale process optimisation experiments for SH expression.
High cell density strategy for poly(3-hydroxybutyrate production by Cupriavidus necator
Directory of Open Access Journals (Sweden)
J. L. Ienczak
2011-12-01
Full Text Available Poly(3-hydroxybutyrate (P(3HB is a carbon and intracellular storage source for different microorganisms and its production can achieve high productivities by means of high cell density cultures. The aim of this study was to propose a high cell density strategy for P(3HB production by Cupriavidus necator. The exponential growth phase demands an accurate control of the oxygen transfer system in the bioreactor, due to maximum specific growth rate (µXr, and, consequently, a maximum specific oxygen uptake rate (QO2, in addition to significant residual biomass (Xr growth in high cell density cultures. In this context, this work investigated the strategy for obtaining high cell density, with the inclusion of a linear growth phase for P(3HB production by C. necator in a fed-batch culture. The linear growth phase was included between the exponential growth phase and the P(3HB production phase as a strategy to reduce the specific growth rate (µXr and specific oxygen uptake rate (QO2, with constant residual biomass growth rate (d(V.Xr/dt = k = constant and linear increase of biomass. Three strategies of culture were performed. The results showed that a high residual biomass concentration (30 gXr.L-1 can be reached by the inclusion of the linear growth strategy and specific growth rates (µXr between 0.08 and 0.05 h-1, at the beginning of the production phase, are necessary to attain a high P(3HB productivity.
Berezina, Nathalie; Yada, Bopha; Lefebvre, Rodrigue
2015-01-25
Organic pollution by aromatic compounds is of increasing concern to our environment. Therefore, the transformation of aromatic pollutants into valuable aliphatic and biodegradable bioplastics was studied. Since benzoic acid was found to be the key compound for such bioremediation processes, its transformation, and metabolic pathways of digestion, by Cupriavidus necator were specifically analysed. It was found that the degradation of aromatic compounds follows the 2,3-dioxygenase pathway in this strain and that the batch transformations of benzoic acid with either fresh or adapted cells were limited to an initial concentration of 2.5 g/L of pollutant. The repeated fed-batch with partial withdrawal process, however, showed a 17.5-fold improvement, thus allowing the transformation of a total of 43.7 g/L in 12 weeks. Copyright © 2014 Elsevier B.V. All rights reserved.
Harker, A R; Kim, Y
1990-01-01
The bacterium Alcaligenes eutrophus JMP134(pJP4) degrades trichloroethylene (TCE) by a chromosomal phenol-dependent pathway and by the plasmid-encoded 2,4-dichlorophenoxyacetic acid pathway. The two pathways were independent and exhibited different rates of removal and capacities for quantity of TCE removed. The phenol-dependent pathway was more rapid (0.2 versus 0.06 nmol of TCE removed per min per mg of protein) and consumed all detectable TCE. The 2,4-dichlorophenoxyacetic acid-dependent p...
Mozumder, Md Salatul Islam; Garcia-Gonzalez, Linsey; De Wever, Heleen; Volcke, Eveline I P
2015-09-01
This study evaluates the effect of sodium (Na(+)) concentration on the growth and PHB production by Cupriavidus necator. Both biomass growth and PHB production were inhibited by Na(+): biomass growth became zero at 8.9 g/L Na(+) concentration while PHB production was completely stopped at 10.5 g/L Na(+). A mathematical model for pure culture heterotrophic PHB production was set up to describe the Na(+) inhibition effect. The parameters related to Na(+) inhibition were estimated based on shake flask experiments. The accumulated Na(+) showed non-linear inhibition effect on biomass growth but linear inhibition effect on PHB production kinetics. Fed-batch experiments revealed that a high accumulation of Na(+) due to a prolonged growth phase, using NaOH for pH control, decreased the subsequent PHB production. The model was validated based on independent experimental data sets, showing a good agreement between experimental data and simulation results. Copyright © 2015 Elsevier Ltd. All rights reserved.
Benesova, P; Kucera, D; Marova, I; Obruca, S
2017-08-01
The chicken feather hydrolysate (FH) has been tested as a potential complex nitrogen source for the production of polyhydroxyalkanoates by Cupriavidus necator H16 when waste frying oil was used as a carbon source. The addition of FH into the mineral salt media with decreased inorganic nitrogen source concentration improved the yields of biomass and polyhydrohyalkanoates. The highest yields were achieved when 10 vol.% of FH prepared by microwave-assisted alkaline hydrolysis of 60 g l -1 feather was added. In this case, the poly(3-hydroxybutyrate) (PHB) yields were improved by more than about 50% as compared with control cultivation. A positive impact of FH was also observed for accumulation of copolymer poly(3-hydroxybutyrate-co-3-hydroxyvalerate) when sodium propionate was used as a precursor. The copolymer has superior processing and mechanical properties in comparison with PHB homopolymer. The application of FH eliminated the inhibitory effect of propionate and resulted in altered content of 3-hydroxyvalerate (3HV) in copolymer. Therefore, the hydrolysed feather can serve as an excellent complex source of nitrogen for the polyhydroxyalkanoates (PHA) production. Moreover, by the combination of two inexpensive types of waste, such as waste frying oil and feather hydrolysate, it is possible to produce PHA with substantially improved efficiency and sustainability. Millions of tons of feathers, important waste product of poultry-processing industry, are disposed off annually without any further benefits. Thus, there is an inevitable need for new technologies that enable ecologically and economically sensible processing of this waste. Herein, we report that alkali-hydrolysed feathers can be used as a complex nitrogen source considerably improving polyhydroxyalkanoates production on waste frying oil employing Cupriavidus necator. © 2017 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
Balakrishnan Kunasundari
Full Text Available Cupriavidus necator H16 (formerly known as Hydrogenomonas eutropha was famous as a potential single cell protein (SCP in the 1970s. The drawback however was the undesirably efficient accumulation of non-nutritive polyhydroxybutyrate (PHB storage compound in the cytoplasm of this bacterium. Eventually, competition from soy-based protein resulted in SCP not receiving much attention. Nevertheless, C. necator H16 remained in the limelight as a producer of PHB, which is a material that resembles commodity plastics such as polypropylene. PHB is a 100% biobased and biodegradable polyester. Although tremendous achievements have been attained in the past 3 decades in the efficient production of PHB, this bioplastic is still costly. One of the main problems has been the recovery of PHB from the cell cytoplasm. In this study, we showed for the first time that kilogram quantities of PHB can be easily recovered in the laboratory without the use of any solvents and chemicals, just by using the cells as SCP. In addition, the present study also demonstrated the safety and tolerability of animal model used, Sprague Dawley given lyophilized cells of C. necator H16. The test animals readily produced fecal pellets that were whitish in color, as would be expected of PHB granules. The pellets were determined to contain about 82-97 wt% PHB and possessed molecular mass of around 930 kg/mol. The PHB granules recovered biologically possessed similar molecular mass compared to chloroform extracted PHB [950 kg/mol]. This method now allows the production and purification of substantial quantities of PHB for various experimental trials. The method reported here is easy, does not require expensive instrumentation, scalable and does not involve extensive use of solvents and strong chemicals.
The initial metabolic conversion of levulinic acid in Cupriavidus necator.
Jaremko, Matt; Yu, Jian
2011-09-20
Levulinic acid or 4-ketovaleric acid is a potential renewable substrate for production of polyhydroxyalkanoates. In this work, the initial reactions of LA metabolism by Cupriavidus necator were examined in vitro. The organic acid was converted by membrane-bound crude enzymes obtained from the cells pre-grown on LA, while no LA activity was detected from cells pre-grown on acetic acid. Acetyl-CoA and propionyl-CoA were two major intermediates in the initial reactions of LA conversion. A mass balance on propionyl-CoA accounts for 84 mol% of LA added in vitro. It explains an interesting phenomenon that 3-hydroxbutyrate and 3-hydroxyvalerate are two major monomers of the biopolyester formed from LA, instead of 4-hydroxvalerate that has the similar chemical structure of LA as the precursor. A Monod model was used to describe the kinetics of LA utilization as a sole carbon source or a co-substrate of glucose and fructose. The μ(max) and K(m) of LA alone were 0.26 h⁻¹ and 0.01 g/L, respectively. The content and composition of PHA are also dependent on the culture conditions such as carbon to nitrogen ratio. The in vitro observation is supported by the high utilization rate of LA and the high molar percentage of 3HB and 3HV in the PHA derived from LA. Copyright © 2011 Elsevier B.V. All rights reserved.
Guzman Lagunes, F; Winterburn, J B
2016-12-01
The inhibitory effect of limonene on polyhydroxybutyrate (PHB) production in Cupriavidus necator H16 was studied. Firstly, results demonstrate the feasibility of using orange juicing waste (OJW) as a substrate for PHB production. An intracellular PHB content of 81.4% (w/w) was attained for a total dry matter concentration of 9.58gL -1 , when the OJW medium was used. Later, a mineral medium designed to mimic the nutrient levels found in the complex medium derived from OJW was used to study the effect of limonene on the production of PHB. Results showed a drop in specific growth rate (μ) of more than 50% when the initial limonene concentration was 2% (v/v) compared to the limonene free medium. This work highlights the importance of a limonene recovery stage prior to fermentation, to maintain levels below 1% (v/v) in the medium, adding value to the OJW and enhancing the fermentation process productivity. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Zhanhua Tao
2016-08-01
Full Text Available Poly-beta-hydroxybutyrate (PHB can be formed in large amounts in Cupriavidus necator and is important for the industrial production of biodegradable plastics. In this investigation, laser tweezers Raman spectroscopy (LTRS was used to characterize dynamic changes in PHB content—as well as in the contents of other common biomolecule—in C. necator during batch growth at both the population and single-cell levels. PHB accumulation began in the early stages of bacterial growth, and the maximum PHB production rate occurred in the early and middle exponential phases. The active biosynthesis of DNA, RNA, and proteins occurred in the lag and early exponential phases, whereas the levels of these molecules decreased continuously during the remaining fermentation process until the minimum values were reached. The PHB content inside single cells was relatively homogenous in the middle stage of fermentation; during the late growth stage, the variation in PHB levels between cells increased. In addition, bacterial cells in various growth phases could be clearly discriminated when principle component analysis was performed on the spectral data. These results suggest that LTRS is a valuable single-cell analysis tool that can provide more comprehensive information about the physiological state of a growing microbial population.
Arumugam, A; Senthamizhan, S G; Ponnusami, V; Sudalai, S
2018-06-01
Polyhydroxyalkanoates (PHA) are biodegradable polymers found in the cellular masses of a wide range of bacterial species and the demand for PHA is steadily growing. In this work we have produced PHA from a low-cost substrate, Calophyllum inophyllum oil, using Cupriavidus necator. Effects of various process parameters such as Oil concentration, Nitrogen source and inoculum size on the production of PHA were studied using Response Surface Methodology. A quadratic equation was used in the model to fit the experimental data. It was found that the model could satisfactorily predict the PHA yield (R 2 =99.17%). Linear, quadratic and interaction terms used in the model were found to be statistically significant. Maximum PHA yield of 10.6gL -1 was obtained under the optimized conditions of oil concentration - 17.5%, inoculum concentration - 50mL/L and nitrogen content - 1.125gL -1 , respectively. The product obtained was characterized using FTIR and NMR to confirm that it was PHA. The results demonstrate that C. inophyllum oil, a non-edible oil, can be potentially used as a low-cost substrate for the production of PHA. Copyright © 2018 Elsevier B.V. All rights reserved.
Murugesan, Sivananth; Iyyaswami, Regupathi
2017-08-15
Low frequency sonic waves, less than 10kHz were introduced to assist cloud point extraction of polyhydroxyalkanoate from Cupriavidus necator present within the crude broth. Process parameters including surfactant system variables and sonication parameters were studied for their effect on extraction efficiency. Introduction of low frequency sonic waves assists in the dissolution of microbial cell wall by the surfactant micelles and release of cellular content, polyhydroxyalkanoate granules released were encapsulated by the micelle core which was confirmed by crotonic acid assay. In addition, sonic waves resulted in the separation of homogeneous surfactant and broth mixture into two distinct phases, top aqueous phase and polyhydroxyalkanoate enriched bottom surfactant rich phase. Mixed surfactant systems showed higher extraction efficiency compared to that of individual Triton X-100 concentrations, owing to increase in the hydrophobicity of the micellar core and its interaction with polyhydroxyalkanoate. Addition of salts to the mixed surfactant system induces screening of charged surfactant head groups and reduces inter-micellar repulsion, presence of ammonium ions lead to electrostatic repulsion and weaker cation sodium enhances the formation of micellar network. Addition of polyethylene glycol 8000 resulted in increasing interaction with the surfactant tails of the micelle core there by reducing the purity of polyhydroxyalkanoate. Copyright © 2017 Elsevier B.V. All rights reserved.
Taxonomy of the genus Cupriavidus: a tale of lost and found.
Vandamme, Peter; Coenye, Tom
2004-11-01
DNA-DNA hybridization experiments and an evaluation of phenotypic characteristics, DNA base ratios and 16S rRNA gene sequences demonstrated that Wautersia eutropha (Davies 1969) Vaneechoutte et al. 2004, the type species of the genus Wautersia, is a later synonym of Cupriavidus necator Makkar and Casida 1987, the type species of the genus Cupriavidus. In conformity with Rules 15, 17, 23a and 37a(1) of the International Code of Nomenclature of Bacteria, the genus name Cupriavidus has priority over the genus name Wautersia, and all other members of the genus Wautersia are reclassified into Cupriavidus as Cupriavidus basilensis comb. nov. (type strain LMG 18990(T)=DSM 11853(T)), Cupriavidus campinensis comb. nov. (type strain LMG 19282(T)=CCUG 44526(T)), Cupriavidus gilardii comb. nov. (type strain LMG 5886(T)=CCUG 38401(T)), Cupriavidus metallidurans comb. nov. (type strain LMG 1195(T)=DSM 2839(T)), Cupriavidus oxalaticus comb. nov. (type strain LMG 2235(T)=CCUG 2086(T)=DSM 1105(T)), Cupriavidus pauculus comb. nov. (type strain LMG 3244(T)=CCUG 12507(T)), Cupriavidus respiraculi comb. nov. (type strain LMG 21510(T)=CCUG 46809(T)) and Cupriavidus taiwanensis comb. nov. (type strain LMG 19424(T)=CCUG 44338(T)).
Batcha, Abeed Fatima Mohidin; Prasad, D M Reddy; Khan, Maksudur R; Abdullah, Hamidah
2014-05-01
Poly(3-hydroxybutyrate) (PHB) is a biodegradable polymer that can be synthesized through bacterial fermentation. In this study, Cupriavidus necator H16 is used to synthesize PHB by using Jatropha oil as its sole carbon source. Different variables mainly jatropha oil and urea concentrations, and agitation rate were investigated to determine the optimum condition for microbial fermentation in batch culture. Based on the results, the highest cell dry weight and PHB concentrations of 20.1 and 15.5 g/L, respectively, were obtained when 20 g/L of jatropha oil was used. Ethanol was used as external stress factor and the addition of 1.5 % ethanol at 38 h had a positive effect with a high PHB yield of 0.987 g PHB/g jatropha oil. The kinetic studies for cell growth rate and PHB production were conducted and the data were fitted with Logistic and Leudeking–Piret models. The rate constants were evaluated and the theoretical values were in accordance with the experimental data obtained
EXTRAÇÃO DE POLI(3-HIDROXIBUTIRATO, PRODUZIDO POR Cupriavidus necator, COM CARBONATO DE PROPILENO
Directory of Open Access Journals (Sweden)
Luci K. M. Quines
2015-02-01
Full Text Available The environmental impact of plastic waste has attracted worldwide attention. Amid the current context of increasing concern for the environment, biodegradable plastics have been widely studied as a replacement for synthetic plastics. Poly(3-hydroxybutyrate (P(3HB is a biopolymer stored as an intracellular energy and reserve source in many microorganisms. Because it is an intracellular product, P(3HB must be extracted from the cells at the end of the culture. The purpose of this study was to investigate the effect of extraction time, heating temperature, first standing time (after filtration and extraction, second standing time (after P(3HB precipitation and solvent amount, during the process of extracting P(3HB from Cupriavidus necator DSM 545, using propylene carbonate as solvent. The extraction kinetic of P(3HB with propylene carbonate from thermally treated biomass was evaluated at different temperatures. The physical properties of the P(3HB obtained were also evaluated. In this case, P(3HB obtained at optimal conditions of recovery (98% and purity (99% was used. Results showed that temperature was the most important factor in these responses for the range of values studied (110-150 ºC.
Accumulation of PHA granules in Cupriavidus necator as seen by confocal fluorescence microscopy.
Mravec, Filip; Obruca, Stanislav; Krzyzanek, Vladislav; Sedlacek, Petr; Hrubanova, Kamila; Samek, Ota; Kucera, Dan; Benesova, Pavla; Nebesarova, Jana
2016-05-01
Many bacteria are capable of accumulating intracellular granules of polyhydroxyalkanoates (PHA). In this work, we developed confocal microscopy analysis of bacterial cells to study changes in the diameters of cells as well as PHA granules during growth and PHA accumulation in the bacterium Cupriavidus necator H16 (formerly Ralstonia eutropha). The cell envelope was stained by DiD(®) fluorescent probe and PHA granules by Nile Red. Signals from both probes were separated based on their spectral and fluorescence life-time properties. During growth and PHA accumulation, bacterial cells increased their length but the width of the cells remained constant. The volume fraction of PHA granules in cells increased during PHA accumulation, nevertheless, its value did not exceed 40 vol. % regardless of the PHA weight content. It seems that bacterial cultures lengthen the cells in order to control the PHA volume portion. However, since similar changes in cell length were also observed in a PHA non-accumulating mutant, it seems that there is no direct control mechanism, which regulates the prolongation of the cells with respect to PHA granules volume. It is more likely that PHA biosynthesis and the length of cells are influenced by the same external stimuli such as nutrient limitation. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Azizi, Nahid; Najafpour, Ghasem; Younesi, Habibollah
2017-08-01
The brown seaweed Sargassum sp. was used as a feedstock to produce polyhydroxybutyarte (PHB) using Cupriavidus necator PTCC 1615. In order to release monomeric sugars, dilute acid hydrolysis of Sargassum sp. biomass was followed by enzymatic saccharification. In addition, the effect of different nitrogen sources was evaluated for PHB production. The fermentation of hydrolysate with the ammonium sulfate as selected nitrogen source resulted PHB yield of 0.54±0.01g/g reducing sugar. Then, NaCl was used as external stress factor which was added to the media. Addition of 8g/L NaCl had a positive impact on high PHB yield of 0.74±0.01g/g reducing sugar. Increasing trend of NaCl concentration to 16g/L was found to inhibit the production of PHB. Based on obtained results using 20g/L of reducing sugar, at desired condition the highest cell dry weight and PHB concentrations were 5.36±0.22 and 3.93±0.24g/L, respectively. The findings of this study reveal that Sargassum sp. is a promising feedstock for biopolymer production. The characteristics of produced PHB were analyzed by FTIR, differential scanning calorimetry and 1 H NMR. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Brian J. Campbell
2017-10-01
Full Text Available Fatty acids produced by H2-metabolizing bacteria are sometimes observed to be more D-depleted than those of photoautotrophic organisms, a trait that has been suggested as diagnostic for chemoautotrophic bacteria. The biochemical reasons for such a depletion are not known, but are often assumed to involve the strong D-depletion of H2. Here, we cultivated the bacterium Cupriavidus necator H16 (formerly Ralstonia eutropha H16 under aerobic, H2-consuming, chemoautotrophic conditions and measured the isotopic compositions of its fatty acids. In parallel with the wild type, two mutants of this strain, each lacking one of two key hydrogenase enzymes, were also grown and measured. In all three strains, fractionations between fatty acids and water ranged from -173‰ to -235‰, and averaged -217‰, -196‰, and -226‰, respectively, for the wild type, SH- mutant, and MBH- mutant. There was a modest increase in δD as a result of loss of the soluble hydrogenase enzyme. Fractionation curves for all three strains were constructed by growing parallel cultures in waters with δDwater values of approximately -25‰, 520‰, and 1100‰. These curves indicate that at least 90% of the hydrogen in fatty acids is derived from water, not H2. Published details of the biochemistry of the soluble and membrane-bound hydrogenases confirm that these enzymes transfer electrons rather than intact hydride (H- ions, providing no direct mechanism to connect the isotopic composition of H2 to that of lipids. Multiple lines of evidence thus agree that in this organism, and presumably others like it, environmental H2 plays little or no direct role in controlling lipid δD values. The observed fractionations must instead result from isotope effects in the reduction of NAD(PH by reductases with flavin prosthetic groups, which transfer two electrons and acquire H+ (or D+ from solution. Parallels to NADPH reduction in photosynthesis may explain why D/H fractionations in C. necator
Fei, Tao; Cazeneuve, Stacy; Wen, Zhiyou; Wu, Lei; Wang, Tong
2016-05-01
This work demonstrates a significant advance in bioprocessing for a high-melting lipid polymer. A novel and environmental friendly solvent mixture, acetone/ethanol/propylene carbonate (A/E/P, 1:1:1 v/v/v) was identified for extracting poly-hydroxybutyrate (PHB), a high-value biopolymer, from Cupriavidus necator. A set of solubility curves of PHB in various solvents was established. PHB recovery of 85% and purity of 92% were obtained from defatted dry biomass (DDB) using A/E/P. This solvent mixture is compatible with water, and from non-defatted wet biomass, PHB recovery of 83% and purity of 90% were achieved. Water and hexane were evaluated as anti-solvents to assist PHB precipitation, and hexane improved recovery of PHB from biomass to 92% and the purity to 93%. A scale-up extraction and separation reactor was designed, built and successfully tested. Properties of PHB recovered were not significantly affected by the extraction solvent and conditions, as shown by average molecular weight (1.4 × 10(6) ) and melting point (175.2°C) not being different from PHB extracted using chloroform. Therefore, this biorenewable solvent system was effective and versatile for extracting PHB biopolymers. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:678-685, 2016. © 2016 American Institute of Chemical Engineers.
Eficiência simbiótica de estirpes de Cupriavidus necator tolerantes a zinco, cádmio, cobre e chumbo
Directory of Open Access Journals (Sweden)
Paulo Ademar Avelar Ferreira
2012-01-01
Full Text Available O objetivo deste trabalho foi avaliar a tolerância de estirpes de Cupriavidus necator a zinco, cádmio, cobre e chumbo, além de determinar a eficiência simbiótica das estirpes mais tolerantes em associação a espécies leguminosas com potencial para revegetação. A tolerância foi testada em meio LB, suplementado com 2,5; 5,0; 7,5; 10; 12,5 e 15 mmol L-1 de ZnSO4.7H2O, CdSO4.8H2O, CuSO4.5H2O e PbCl2, respectivamente, em comparação ao controle sem adição de metal. Determinou-se a eficiência simbiótica das quatro estirpes de C. necator mais tolerantes aos metais avaliados (UFLA02-71, UFLA02-73, UFLA01-659 e UFLA01-663, as quais foram inoculadas nas espécies: Leucaena leucocephala, Enterolobium contortisiliquum, Acacia mangium, Mimosa caesalpiniifolia, M. pudica, M. pigra e M. acutistipula. Em vasos com solos, avaliaram-se L. leucocephala, M. pudica e M. caesalpiniifolia e as estirpes UFLA01-659 e UFLA02-71, selecionadas na avaliação de eficiência simbiótica. A estirpe UFLA02-71 proporcionou incrementos de matéria seca da parte aérea de 870% em M. caesalpiniifolia, enquanto que UFLA01-659 proporcionou 885% em M. pudica e 924% em L. leucocephala. As estirpes UFLA01-659 e UFLA02-71, além da alta tolerância a metais pesados, apresentaram eficiência em fixar nitrogênio, em simbiose com essas leguminosas, em solos com rizóbios nativos capazes de nodulá-las, e devem ser avaliadas quanto ao seu potencial de utilização em programas de recuperação de áreas degradadas.
Leong, Yoong Kit; Lan, John Chi-Wei; Loh, Hwei-San; Ling, Tau Chuan; Ooi, Chien Wei; Show, Pau Loke
2017-03-01
Polyhydroxyalkanoates (PHAs), a class of renewable and biodegradable green polymers, have gained attraction as a potential substitute for the conventional plastics due to the increasing concern towards environmental pollution as well as the rapidly depleting petroleum reserve. Nevertheless, the high cost of downstream processing of PHA has been a bottleneck for the wide adoption of PHAs. Among the options of PHAs recovery techniques, aqueous two-phase extraction (ATPE) outshines the others by having the advantages of providing a mild environment for bioseparation, being green and non-toxic, the capability to handle a large operating volume and easily scaled-up. Utilizing unique properties of thermo-responsive polymer which has decreasing solubility in its aqueous solution as the temperature rises, cloud point extraction (CPE) is an ATPE technique that allows its phase-forming component to be recycled and reused. A thorough literature review has shown that this is the first time isolation and recovery of PHAs from Cupriavidus necator H16 via CPE was reported. The optimum condition for PHAs extraction (recovery yield of 94.8% and purification factor of 1.42 fold) was achieved under the conditions of 20 wt/wt % ethylene oxide-propylene oxide (EOPO) with molecular weight of 3900 g/mol and 10 mM of sodium chloride addition at thermoseparating temperature of 60°C with crude feedstock limit of 37.5 wt/wt %. Recycling and reutilization of EOPO 3900 can be done at least twice with satisfying yield and PF. CPE has been demonstrated as an effective technique for the extraction of PHAs from microbial crude culture. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Gahlawat, Geeta; Soni, Sanjeev Kumar
2017-11-01
Glycerol is a by-product of many industrial processes and huge amounts of it are generated in the form of waste, thereby necessitating a search for the method of its disposal. An interesting solution is the valorization of crude glycerol into value added product such as polyhydroxyalkanoates (PHAs). The feasibility of producing PHAs by Cupriavidus necator was evaluated using crude glycerol (WG). Various cultivation strategies were designed for the production of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) copolymer by adding different organic acids as precursors at different concentrations levels. Batch cultivation of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) production showed accumulation of 6.76g/L biomass containing 4.84g/L copolymer on WG with a maximum 3-hydroxyvalerate content of 24.6mol%. PHAs extraction using a non-toxic and recyclable solvent, 1,2 propylene carbonate, showed the highest recovery yield (90%) and purity (93%) at 120°C temperature and 30min incubation. This is the first report on jatropha based glycerol valorization for poly(3-hydroxybutyrate-co-3-hydroxyvalerate) production coupled with extraction using non-toxic solvent. Copyright © 2017 Elsevier Ltd. All rights reserved.
Dey, Pinaki; Rangarajan, Vivek
2017-10-01
Experimental investigations were carried out for Cupriavidus necator (MTCC 1472)-based improved production of poly-3 hydroxy butyrate (PHB) through induced nitrogen limiting fed-batch cultivation strategies. Initially Plackett-Burman design and response surface methodology were implemented to optimize most influencing process parameters. With optimized process parameter values, continuous feeding strategies ware applied in a 5-l fermenter with table sugar concentration of 100 g/l, nitrogen concentration of 0.12 g/l for fed-batch fermentation with varying dilution rates of 0.02 and 0.046 1/h. To get enriched production of PHB, concentration of the sugar was further increased to 150 and 200 g/l in feeding. Maximum concentrations of PHB achieved were 22.35 and 23.07 g/l at those dilution rates when sugar concentration maintains at 200 g/l in feeding. At maximum concentration of PHB (23.07 g/l), productivity of 0.58 g/l h was achieved with maximum PHB accumulation efficiency up to 64% of the dry weight of biomass. High purity of PHB, close to medical grade was achieved after surfactant hypochlorite extraction method, and it was further confirmed by SEM, EDX, and XRD studies.
Influence of bacteria on degradation of bioplastics
Blinková, M.; Boturová, K.
2017-10-01
The degradation rate of bioplastic in soil is closely related to the diversity of soil microbiota. To investigate the effect of soil bacterial on biodegradation, 4 bacterial strains of soil - Pseudomonas chlororaphis, Kocuria rosea, Cupriavidus necator and Bacillus cereus, were used to accelerate the decomposition of bioplastics manufactured from Polylactid acid (PLA) by direct action during 250 days. The best results were obtained with bacterial strains Cupriavidus necator and Pseudomonas chlororaphis that were isolated of lagoons with anthropogenic sediments.
Ramachandran, Hema; Shafie, Nur Asilla Hani; Sudesh, Kumar; Azizan, Mohamad Noor; Majid, Mohamad Isa Abdul; Amirul, Al-Ashraf Abdullah
2018-03-01
Bacterial classification on the basis of a polyphasic approach was conducted on three poly(3 hydroxybutyrate-co-4-hydroxybutyrate) [P(3HB-co-4HB)] accumulating bacterial strains that were isolated from samples collected from Malaysian environments; Kulim Lake, Sg. Pinang river and Sg. Manik paddy field. The Gram-negative, rod-shaped, motile, non-sporulating and non-fermenting bacteria were shown to belong to the genus Cupriavidus of the Betaproteobacteria on the basis of their 16S rRNA gene sequence analyses. The sequence similarity value with their near phylogenetic neighbour, Cupriavidus pauculus LMG3413 T , was 98.5%. However, the DNA-DNA hybridization values (8-58%) and ribotyping analysis both enabled these strains to be differentiated from related Cupriavidus species with validly published names. The RiboPrint patterns of the three strains also revealed that the strains were genetically related even though they displayed a clonal diversity. The major cellular fatty acids detected in these strains included C15:0 ISO 2OH/C16:1 ω7c, hexadecanoic (16:0) and cis-11-octadecenoic (C18:1 ω7c). Their G+C contents ranged from 68.0 to 68.6 mol%, and their major isoprenoid quinone was Ubiquinone Q-8. Of these three strains, only strain USMAHM13 (= DSM 25816 = KCTC 32390) was discovered to exhibit yellow pigmentation that is characteristic of the carotenoid family. Their assembled genomes also showed that the three strains were not identical in terms of their genome sizes that were 7.82, 7.95 and 8.70 Mb for strains USMAHM13, USMAA1020 and USMAA2-4, respectively, which are slightly larger than that of Cupriavidus necator H16 (7.42 Mb). The average nucleotide identity (ANI) results indicated that the strains were genetically related and the genome pairs belong to the same species. On the basis of the results obtained in this study, the three strains are considered to represent a novel species for which the name Cupriavidus malaysiensis sp. nov. is proposed. The
Biochemical characterization of ethanol-dependent reduction of furfural by alcohol dehydrogenases.
Li, Qunrui; Metthew Lam, L K; Xun, Luying
2011-11-01
Lignocellulosic biomass is usually converted to hydrolysates, which consist of sugars and sugar derivatives, such as furfural. Before yeast ferments sugars to ethanol, it reduces toxic furfural to non-inhibitory furfuryl alcohol in a prolonged lag phase. Bioreduction of furfural may shorten the lag phase. Cupriavidus necator JMP134 rapidly reduces furfural with a Zn-dependent alcohol dehydrogenase (FurX) at the expense of ethanol (Li et al. 2011). The mechanism of the ethanol-dependent reduction of furfural by FurX and three homologous alcohol dehydrogenases was investigated. The reduction consisted of two individual reactions: ethanol-dependent reduction of NAD(+) to NADH and then NADH-dependent reduction of furfural to furfuryl alcohol. The kinetic parameters of the coupled reaction and the individual reactions were determined for the four enzymes. The data indicated that limited NADH was released in the coupled reaction. The enzymes had high affinities for NADH (e.g., K ( d ) of 0.043 μM for the FurX-NADH complex) and relatively low affinities for NAD(+) (e.g., K ( d ) of 87 μM for FurX-NAD(+)). The kinetic data suggest that the four enzymes are efficient "furfural reductases" with either ethanol or NADH as the reducing power. The standard free energy change (ΔG°') for ethanol-dependent reduction of furfural was determined to be -1.1 kJ mol(-1). The physiological benefit for ethanol-dependent reduction of furfural is likely to replace toxic and recalcitrant furfural with less toxic and more biodegradable acetaldehyde.
Adult hookworms (Necator spp.) collected from researchers working with wild western lowland gorillas
Czech Academy of Sciences Publication Activity Database
Kalousová, B.; Hasegawa, H.; Petrželková, Klára Judita; Sakamaki, T.; Kooriyma, T.; Modrý, David
2016-01-01
Roč. 9, FEB 9 (2016), č. článku 75. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Necator spp * Necator gorillae * Necator americanus * hookworm * morphology * human infection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.080, year: 2016
Adult hookworms (Necator spp.) collected from researchers working with wild western lowland gorillas
Czech Academy of Sciences Publication Activity Database
Kalousová, B.; Hasegawa, H.; Petrželková, Klára Judita; Sakamaki, T.; Kooriyma, T.; Modrý, D.
2016-01-01
Roč. 9, č. 75 (2016), č. článku 75. ISSN 1756-3305 R&D Projects: GA ČR GA15-05180S Institutional support: RVO:68081766 Keywords : Necator spp * Hookworm * Morphology * Human infection * Necator gorillae * Necator americanus Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.080, year: 2016
Influence of Environmental Stressors on the Physiology of Pollutant Degrading Bacteria
DEFF Research Database (Denmark)
Svenningsen, Nanna Bygvraa
of model degrader bacteria to nutrient- and oxidative stress, two highly relevant stress scenarios in natural environments, and at evaluating the impact of these environmental stress conditions on catabolic gene expression. The results suggest that environmental bacteria, here represented by the toluene...... biodegradative or catabolic performance. To date, details concerning the physiology of degrader microorganisms and their ability to express the relevant catabolic genes in the context of a complex and stressful environment have yet to be elucidated. In order to fully exploit the catabolic potential of degrader......- and xylene degrading bacterium Pseudomonas putida mt-2 and the phenoxy acid herbicide degrading bacterium Cupriavidus pinatubonensis JMP134, have a high defense capacity towards archetypical environmental stressors. However, the results also showed that induction of a stress defense may have a cost in regard...
Al Rowaihi, Israa Salem; Paillier, Alexis; Rasul, Shahid; Karan, Ram; Grö tzinger, Stefan Wolfgang; Takanabe, Kazuhiro; Eppinger, Jö rg
2018-01-01
extorquens AM1 and Cupriavidus necator H16. This setup allows to investigate the influence of different stress conditions, such as coexisting electrolysis, relatively high salinity, nutrient limitation, and starvation, on the production of PHB. The overall
Fu, H; Zhang, J-J; Xu, Y; Chao, H-J; Zhou, N-Y
2017-03-01
The ortho-nitrophenol (ONP)-utilizing Alcaligenes sp. strain NyZ215, meta-nitrophenol (MNP)-utilizing Cupriavidus necator JMP134 and para-nitrophenol (PNP)-utilizing Pseudomonas sp. strain WBC-3 were assembled as a consortium to degrade three nitrophenol isomers in sequential batch reactors. Pilot test was conducted in flasks to demonstrate that a mixture of three mononitrophenols at 0·5 mol l -1 each could be mineralized by this microbial consortium within 84 h. Interestingly, neither ONP nor MNP was degraded until PNP was almost consumed by strain WBC-3. By immobilizing this consortium into polyurethane cubes, all three mononitrophenols were continuously degraded in lab-scale sequential reactors for six batch cycles over 18 days. Total concentrations of ONP, MMP and PNP that were degraded were 2·8, 1·5 and 2·3 mol l -1 during this time course respectively. Quantitative real-time PCR analysis showed that each member in the microbial consortium was relatively stable during the entire degradation process. This study provides a novel approach to treat polluted water, particularly with a mixture of co-existing isomers. Nitroaromatic compounds are readily spread in the environment and pose great potential toxicity concerns. Here, we report the simultaneous degradation of three isomers of mononitrophenol in a single system by employing a consortium of three bacteria, both in flasks and lab-scale sequential batch reactors. The results demonstrate that simultaneous biodegradation of three mononitrophenol isomers can be achieved by a tailor-made microbial consortium immobilized in sequential batch reactors, providing a pilot study for a novel approach for the bioremediation of mixed pollutants, especially isomers present in wastewater. © 2016 The Society for Applied Microbiology.
Bioethanol production from mannitol by a newly isolated bacterium, Enterobacter sp. JMP3.
Wang, Jing; Kim, Young Mi; Rhee, Hong Soon; Lee, Min Woo; Park, Jong Moon
2013-05-01
In this study a new bacterium capable of growing on brown seaweed Laminaria japonica, Enterobacter sp. JMP3 was isolated from the gut of turban shell, Batillus cornutus. In anaerobic condition, it produced high yields of ethanol (1.15 mol-EtOH mol-mannitol(-1)) as well as organic acids from mannitol, the major carbohydrate component of L. japonica. Based on carbon distribution and metabolic flux analysis, it was revealed that mannitol was more favorable than glucose for ethanol production due to their different redox states. This indicates that L. japonica is one of the promising feedstock for bioethanol production. Additionally, the mannitol dehydrogenation pathway in Enterobacter sp. JMP3 was examined and verified. Finally, an attempt was made to explore the possibility of controlling ethanol production by altering the redox potential via addition of external NADH in mannitol fermentation. Copyright © 2012 Elsevier Ltd. All rights reserved.
Abundant production of conidia is a driving factor for epidemics of grape powdery mildew (Erysiphe necator (syn. Uncinula necator). Previous investigations revealed evidence for a signal that coordinates the onset of asexual reproduction. The genetic basis for this signal in powdery mildews had not ...
Cupriavidus pauculus bacteremia in a child on extracorporeal membrane oxygenation.
Uzodi, Adaora S; Schears, Gregory J; Neal, James R; Henry, Nancy K
2014-01-01
We report a case of bacteremia secondary to Cupriavidus pauculus in a 15-month-old boy on extracorporeal membrane oxygenation (ECMO). The source of the organism was water in the thermoregulator reservoir. The child responded well to cefepime and ciprofloxacin, a delayed oxygenator change out and replacement of the thermoregulator reservoir with a unit that was cleaned and decontaminated with sodium hypochlorite. Isolation of Cupriavidus pauculus from a patient on ECMO support should raise suspicion of the reservoir as a source.
Directory of Open Access Journals (Sweden)
Francieli Dalcanton
2010-01-01
Full Text Available Poly (3-hydroxybutyrate (P(3HB is a biopolymer, completely biodegradable, which has similar properties to fuel-based polymers. However to make it economically competitive it is necessary the study of cheap sources of substrate. The influence of hydrolyzed rice starch supplemented with soybean oil at different temperatures (30, 35 and 40 °C was studied in the production of P(3HB by C. necator. The percentage of P(3HB produced in the cultures at 30, 35 °C was 30, 39% and 35, 43% without and with supplementation of oil, respectively. The culture at 40 °C showed no production phase due to a possible oxygen limitation. These results demonstrate that hydrolyzed rice starch supplemented with soybean oil increases the yield of P(3HB and temperature of 35 ºC is the most favorable for biopolymer production.
A Fatal Case of Community Acquired Cupriavidus Pauculus Pneumonia
Almasy Emoke; Szederjesi Janos; Rad Paul; Georgescu Anca
2016-01-01
Introduction: Cupriavidus pauculus is a rarely isolated non-fermentative, aerobic bacillus, which occasionally causes severe human infections, especially in immunocompromised patients. Strains have been isolated from various clinical and environmental sources.
Gene clusters involved in isethionate degradation by terrestrial and marine bacteria.
Weinitschke, Sonja; Sharma, Pia I; Stingl, Ulrich; Cook, Alasdair M; Smits, Theo H M
2010-01-01
Ubiquitous isethionate (2-hydroxyethanesulfonate) is dissimilated by diverse bacteria. Growth of Cupriavidus necator H16 with isethionate was observed, as was inducible membrane-bound isethionate dehydrogenase (IseJ) and inducible transcription of the genes predicted to encode IseJ and a transporter (IseU). Biodiversity in isethionate transport genes was observed and investigated by transcription experiments.
A Fatal Case of Community Acquired Cupriavidus Pauculus Pneumonia
Directory of Open Access Journals (Sweden)
Almasy Emoke
2016-10-01
Full Text Available Introduction: Cupriavidus pauculus is a rarely isolated non-fermentative, aerobic bacillus, which occasionally causes severe human infections, especially in immunocompromised patients. Strains have been isolated from various clinical and environmental sources.
Directory of Open Access Journals (Sweden)
Brewer Marin
2010-09-01
Full Text Available Abstract Background The grape powdery mildew fungus, Erysiphe necator, was introduced into Europe more than 160 years ago and is now distributed everywhere that grapes are grown. To understand the invasion history of this pathogen we investigated the evolutionary relationships between introduced populations of Europe, Australia and the western United States (US and populations in the eastern US, where E. necator is thought to be native. Additionally, we tested the hypothesis that populations of E. necator in the eastern US are structured based on geography and Vitis host species. Results We sequenced three nuclear gene regions covering 1803 nucleotides from 146 isolates of E. necator collected from the eastern US, Europe, Australia, and the western US. Phylogeographic analyses show that the two genetic groups in Europe represent two separate introductions and that the genetic groups may be derived from eastern US ancestors. Populations from the western US and Europe share haplotypes, suggesting that the western US population was introduced from Europe. Populations in Australia are derived from European populations. Haplotype richness and nucleotide diversity were significantly greater in the eastern US populations than in the introduced populations. Populations within the eastern US are geographically differentiated; however, no structure was detected with respect to host habitat (i.e., wild or cultivated. Populations from muscadine grapes, V. rotundifolia, are genetically distinct from populations from other Vitis host species, yet no differentiation was detected among populations from other Vitis species. Conclusions Multilocus sequencing analysis of the grape powdery mildew fungus is consistent with the hypothesis that populations in Europe, Australia and the western US are derived from two separate introductions and their ancestors were likely from native populations in the eastern US. The invasion history of E. necator follows a pattern
Epidermal response of rainbow trout to Ichthyobodo necator
DEFF Research Database (Denmark)
Chettri, Jiwan Kumar; Kuhn, Jesper Andreas; Mohammad, Rezkar Jaafar
2014-01-01
Infections with the parasitic flagellate Ichthyobodo necator (Henneguy, 1883) cause severe skin and gill disease in rainbow trout Oncorhynchus mykiss (Walbaum, 1792) juveniles. The epidermal disturbances including hyperplasia and mucous cell exhaustion caused by parasitization are known, but no d...
JMP Applications in Photovoltaic Reliability (Presentation)
Energy Technology Data Exchange (ETDEWEB)
Jordan, D.; Gotwalt, C.
2011-09-01
The ability to accurately predict power delivery over the course of time is of vital importance to the growth of the photovoltaic (PV) industry. Two key cost drivers are the efficiency with which sunlight is converted into power and secondly how this relationship develops over time. The accurate knowledge of power decline over time, also known as degradation rates, is essential and important to all stakeholders?utility companies, integrators, investors, and scientist alike. Outdoor testing plays a vital part in quantifying degradation rates of different technologies in various climates. Due to seasonal changes, however, several complete cycles (typically 3-5 years) need to be completed traditionally to obtain reasonably accurate degradation rates. In a rapidly evolving industry such a time span is often unacceptable and the need exists to determine degradation rates more accurately in a shorter period of time. Advanced time series modeling such as ARIMA (Autoregressive Integrated Moving Average) modeling can be utilized to decrease the required time span and is compared with some non-linear modeling. In addition, it will be demonstrated how the JMP 9 map feature was used to reveal important technological trends by climate.
Czech Academy of Sciences Publication Activity Database
Obruča, S.; Sedláček, P.; Mravec, F.; Krzyžánek, Vladislav; Nebesářová, Jana; Samek, Ota; Kučera, D.; Benešová, P.; Hrubanová, Kamila; Milerová, M.; Márová, I.
2017-01-01
Roč. 39, OCT (2017), s. 68-80 ISSN 1871-6784 R&D Projects: GA ČR(CZ) GA15-20645S Institutional support: RVO:68081731 ; RVO:60077344 Keywords : Poly(3-hydroxybutyrate) * PHB * cupriavidus necator * hyperosmotic conditions * plasmolysis * stress conditions Subject RIV: BH - Optics, Masers, Lasers; CE - Biochemistry (BC-A) OBOR OECD: Electrical and electronic engineering; Electrical and electronic engineering (BC-A) Impact factor: 3.813, year: 2016
Nosocomial transmission of Cupriavidus pauculus during extracorporeal membrane oxygenation.
Stovall, S H; Wisdom, C; McKamie, W; Ware, W; Dedman, H; Fiser, R T
2010-01-01
Patients undergoing extracorporeal membrane oxygenation (ECMO) are at increased risk of infection. We present the first known report of nosocomial infection with Cupriavidus pauculus attributable to contamination from ECMO equipment and describe the measures taken to halt subsequent infections. A cluster of infections in ECMO patients should prompt team members to consider contamination of equipment with environmental pathogens as a possible cause.
Draft Genome Sequence of an Active Heterotrophic Nitrifier-Denitrifier, Cupriavidus pauculus UM1
Putonti, Catherine; Polley, Nathaniel; Castignetti, Domenic
2018-01-01
ABSTRACT Here, we present the draft genome sequence of Cupriavidus pauculus UM1, a metal-resistant heterotrophic nitrifier-denitrifier capable of synthesizing nitrite from pyruvic oxime. The size of the genome is 7,402,815 bp with a GC content of 64.8%. This draft assembly consists of 38 scaffolds.
Ramirez, Miguel; Obrzydowski, Jennifer; Ayers, Mary; Virparia, Sonia; Wang, Meijing; Stefan, Kurtis; Linchangco, Richard; Castignetti, Domenic
2014-01-01
Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2) and nitrous oxide (N2O) while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3-C(NOH)-COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a genus (Cupriavidus) known for its resistance to metals and its metabolism of xenobiotics. The microbe (a Cupriavidus pauculus designated as C. pauculus strain UM1) was examined for its ability to perform heterotrophic nitrification in the presence of Cu(2+) and Ni(2+) and to metabolize the xenobiotic phenol. The bacterium heterotrophically nitrified well when either 1 mM Cu(2+) or 0.5 mM Ni(2+) was present in either enriched or minimal medium. The organism also used phenol as a sole carbon source in either the presence or absence of 1 mM Cu(2+) or 0.5 mM Ni(2+). The ability of this isolate to perform a number of different metabolisms, its noteworthy resistance to copper and nickel, and its potential use as a bioremediation agent are discussed.
Draft Genome Sequence of an Active Heterotrophic Nitrifier-Denitrifier, Cupriavidus pauculus UM1.
Putonti, Catherine; Polley, Nathaniel; Castignetti, Domenic
2018-02-08
Here, we present the draft genome sequence of Cupriavidus pauculus UM1, a metal-resistant heterotrophic nitrifier-denitrifier capable of synthesizing nitrite from pyruvic oxime. The size of the genome is 7,402,815 bp with a GC content of 64.8%. This draft assembly consists of 38 scaffolds. Copyright © 2018 Putonti et al.
Ichthyobodo necator is a single celled biflagellate that can cause significant mortalities in fish, particularly young, tank-reared fish. Copper sulfate (CuSO4), potassium permanganate (KMnO4) and peracetic acid (PAA) were evaluated for effectiveness against Ichthybodosis in juvenile channel catfis...
Directory of Open Access Journals (Sweden)
Miguel Ramirez
2014-01-01
Full Text Available Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2 and nitrous oxide (N2O while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3–C(NOH–COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a genus (Cupriavidus known for its resistance to metals and its metabolism of xenobiotics. The microbe (a Cupriavidus pauculus designated as C. pauculus strain UM1 was examined for its ability to perform heterotrophic nitrification in the presence of Cu2+ and Ni2+ and to metabolize the xenobiotic phenol. The bacterium heterotrophically nitrified well when either 1 mM Cu2+ or 0.5 mM Ni2+ was present in either enriched or minimal medium. The organism also used phenol as a sole carbon source in either the presence or absence of 1 mM Cu2+ or 0.5 mM Ni2+. The ability of this isolate to perform a number of different metabolisms, its noteworthy resistance to copper and nickel, and its potential use as a bioremediation agent are discussed.
Cao, Li; Liu, Hongming; Zhang, Hao; Huang, Ke; Gu, Tao; Ni, Haiyan; Hong, Qing; Li, Shunpeng
2012-09-01
A bacterial strain P2 capable of degrading 3,5,6-trichloro-2-pyridinol (TCP) was isolated and characterized. Phylogenetic analysis based on 16S rRNA gene sequence indicated that it belonged to the genus of Cupriavidus, because it showed the highest sequence similarity to Cupriavidus pauculus LMG 3413(T) (99.7 %) and DNA-DNA relatedness value between strain P2 and C. pauculus LMG 3413(T) was 76.8 %. In combination with morphological, physiological and biochemical characters, strain P2 was identified as C. pauculus. It could use TCP as the sole carbon source and energy source for its growth. It showed a high average degradation rate of 10 mg/L h in mineral salt medium amended with TCP (50-800 mg/L). During TCP degradation, chloridion was released into the medium in two obvious discontinuous stages. Along with this, two colorful metabolites were produced. Finally, the molarity of the total released chloridion was three times that of the initial TCP in the medium. This is the first report of TCP-degrading strain from the genus of Cupriavidus and the detection of two colorful metabolites during TCP degradation. Strain P2 might be a promising candidate for its application in the bioremediation of TCP-polluted environments.
Wang, Ya-Fei; Wang, Ya-Fei; Li, Hui; Li, Xiao-Bin
2013-11-01
Based on triparental mating, we isolated a total of eight broad host range (BHR) petroleum hydrocarbon catabolic plasmids from the soils, sediments, and wastewater samples in the Shen-Fu irrigation zone. The antibiotic resistance of the plasmids was tested, and then, the plasmids were transferred to Escherichia coli EC100. The plasmids carrying no antibiotic resistance were tagged by miniTn5 transposon consisting of antibiotic resistant genes. The PCR-based incompatibility test revealed that the pS3-2C and pS4-6G belonged to Inc P group, the pS3-2G, pW22-3G, and pA15-7G belonged to Inc N group, the pS7-2G was identified as Inc W plasmid, and the pA23-1G and pA10-1C were placed into Inc Q group. By adopting the reported PCR amplification methods of petroleum hydrocarbon-degrading catabolic genes, the petroleum-degrading capability of these BHR plasmids were preliminarily analyzed. The plasmids pS3-2G, pS7-2G, pA23-1G, pW22-3G, and pA10-1C carried aromatic ring- hydroxylating dioxygenase gene phdA and toluene monooxygenase gene touA; the plasmid pA15-7G carried touA and toluene dioxygenase gene tod; the plasmid pS3-2C carried ben, phdA, and tod; whereas the pS4-6G only carried ben. The host range test showed that all the isolated plasmids except pS3-2C could be transferred and maintained stably in the representative strains Agrobacterium tumefaciens C58, Cupriavidus necator JMP228, and E. coli EC100 of the alpha-, beta-, and gamma-Proteobacteria, respectively.
Fukuoka, Kimiko; Ozeki, Yasuhiro; Kanaly, Robert A
2015-09-01
3-Methylindole, also referred to as skatole, is a pollutant of environmental concern due to its persistence, mobility and potential health impacts. Petroleum refining, intensive livestock production and application of biosolids to agricultural lands result in releases of 3-methylindole to the environment. Even so, little is known about the aerobic biodegradation of 3-methylindole and comprehensive biotransformation pathways have not been established. Using glycerol as feedstock, the soil bacterium Cupriavidus sp. strain KK10 biodegraded 100 mg/L of 3-methylindole in 24 h. Cometabolic 3-methylindole biodegradation was confirmed by the identification of biotransformation products through liquid chromatography electrospray ionization tandem mass spectrometry analyses. In all, 14 3-methylindole biotransformation products were identified which revealed that biotransformation occurred through different pathways that included carbocyclic aromatic ring-fission of 3-methylindole to single-ring pyrrole carboxylic acids. This work provides first comprehensive evidence for the aerobic biotransformation mechanisms of 3-methylindole by a soil bacterium and expands our understanding of the biodegradative capabilities of members of the genus Cupriavidus towards heteroaromatic pollutants.
First case of pneumonia caused by Cupriavidus pauculus in an infant in the Gulf Cooperation Council.
Yahya, Raghda; Alyousef, Wafaa; Omara, Abdelwahab; Alamoudi, Suha; Alshami, Alanoud; Abdalhamid, Baha
2017-02-28
Cupriavidus pauculus is an emerging organism causing infections in immunocompromised and immunocompetent patients. We report a C.pauculus pneumonia case susceptible to cefepime in an infant with end-stage renal failure. To our knowledge, this is the first case report of C. pauculus causing respiratory infections in the Gulf Cooperation Council.
Balada-Llasat, Joan-Miquel; Elkins, Camille; Swyers, Lettie; Bannerman, Tammy; Pancholi, Preeti
2010-07-01
Cupriavidus pauculus is a water microorganism rarely isolated from clinical specimens. We describe a pseudo-outbreak in which multiple strains that were associated with moistening of culturette swabs with tap water were isolated from a single clinic before collecting the patient specimen.
Balada-Llasat, Joan-Miquel; Elkins, Camille; Swyers, Lettie; Bannerman, Tammy; Pancholi, Preeti
2010-01-01
Cupriavidus pauculus is a water microorganism rarely isolated from clinical specimens. We describe a pseudo-outbreak in which multiple strains that were associated with moistening of culturette swabs with tap water were isolated from a single clinic before collecting the patient specimen.
A case of newborn with community acquired pneumonia caused by Cupriavidus pauculus.
Aydın, Banu; Dilli, Dilek; Zenciroğlu, Ayşegül; Okumuş, Nurullah; Ozkan, Sengül; Tanır, Gönül
2012-01-01
Cupriavidus pauculus is a gram-negative, aerobic, non-spore forming, non-fermentative motile bacillus. The bacillus can be isolated from water, bottled mineral water, and water from ultrafiltration systems in hospital setting. C. pauculus rarely causes human infections, however it may be an infectious agent especially in immunocompromised individuals. In this report, we present the first case of community acquired pneumonia caused by C. pauculus in a previously healthy newborn who was hospitalized in neonatal intensive care unit on postnatal day 16 because of respiratory distress.
An opportunistic study was conducted to determine the effects of two chemical therapeutants on channel catfish (CCF) Ictalurus punctatus concurrently infected Flavobacterium columnare and Ichthyobodo necator. Copper sulfate (CuSO4) and potassium permanganate (KMnO4) were investigated for their abil...
Rosier, Caroline; Leys, Natalie; Henoumont, Céline; Mergeay, Max
2012-01-01
Acetone carboxylase (Acx) is a key enzyme involved in the biodegradation of acetone by bacteria. Except for the Helicobacteraceae family, genome analyses revealed that bacteria that possess an Acx, such as Cupriavidus metallidurans strain CH34, are associated with soil. The Acx of CH34 forms the heterohexameric complex α2β2γ2 and can carboxylate only acetone and 2-butanone in an ATP-dependent reaction to acetoacetate and 3-keto-2-methylbutyrate, respectively. PMID:22492439
Teng, Ying; Wang, Xiaomi; Zhu, Ye; Chen, Wei; Christie, Peter; Li, Zhengao; Luo, Yongming
2017-04-01
Pentachloronitrobenzene (PCNB) is a toxic chlorinated nitroaromatic compound. However, only a few bacteria have been reported to be able to utilize PCNB. In the present study, one pentachloronitrobenzene (PCNB)-degrading bacterium, Cupriavidus sp. YNS-85, was isolated from a contaminated Panax notoginseng plantation. The strain co-metabolized 200 mg L -1 PCNB in aqueous solution with a removal rate of 73.8% after 5 days. The bacterium also degraded PCNB effectively under acid conditions (pH 4-6) and showed resistance to toxic trace elements (arsenic, copper, and cadmium). Its ability to utilize proposed PCNB intermediates as sole carbon sources was also confirmed. The soil microcosm experiment further demonstrated that bacterial bioaugmentation enhanced the removal of PCNB (37.8%) from soil and the accumulation of pentachloroaniline (89.3%) after 30 days. Soil enzyme activity and microbial community functional diversity were positively influenced after bioremediation. These findings indicate that Cupriavidus sp. YNS-85 may be a suitable inoculant for in situ bioremediation of PCNB-polluted sites, especially those with acid soils co-contaminated with heavy metal(loid)s.
Balada-Llasat, Joan-Miquel; Elkins, Camille; Swyers, Lettie; Bannerman, Tammy; Pancholi, Preeti
2010-01-01
Cupriavidus pauculus is a water microorganism rarely isolated from clinical specimens. We describe a pseudo-outbreak in which multiple strains that were associated with moistening of culturette swabs with tap water were isolated from a single clinic before collecting the patient specimen. PMID:20444965
A new biological recovery approach for PHA using mealworm, Tenebrio molitor.
Murugan, Paramasivam; Han, Lizhu; Gan, Chee-Yuen; Maurer, Frans H J; Sudesh, Kumar
2016-12-10
Bacterial polyhydroxyalkanoates (PHA) are expensive partly due to the recovery and purification processes. Thus, many studies have been carried out in order to minimize the cost. Here we report on the use of mealworm, which is the larva of mealworm beetle (Tenebrio molitor) to recover PHA granules from Cupriavidus necator. Mealworms were shown to readily consume the freeze-dried C. necator cells and excrete the PHA granules in the form of whitish feces. Further purification using water, detergent and heat resulted in almost 100% pure PHA granules. Comparison with chloroform extraction showed no signs of reduction in the molecular weight and dispersion of the PHA molecules. Scanning electron microscopy and dynamic light scattering measurements revealed that the biologically recovered PHA granules retained their native spherical morphology. The PHA granules were subjected to a battery of tests to determine their purity and properties in comparison to the chloroform extracted PHA. This study has demonstrated the possibility of using mealworms as a biological agent to partially purify the PHA granules. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Israa Salem Al Rowaihi
Full Text Available Poly(3-hydroxybutyrate (PHB, a biodegradable polymer, can be produced by different microorganisms. The PHB belongs to the family of polyhydroxyalkanoate (PHA that mostly accumulates as a granule in the cytoplasm of microorganisms to store carbon and energy. In this study, we established an integrated one-pot electromicrobial setup in which carbon dioxide is reduced to formate electrochemically, followed by sequential microbial conversion into PHB, using the two model strains, Methylobacterium extorquens AM1 and Cupriavidus necator H16. This setup allows to investigate the influence of different stress conditions, such as coexisting electrolysis, relatively high salinity, nutrient limitation, and starvation, on the production of PHB. The overall PHB production efficiency was analyzed in reasonably short reaction cycles typically as short as 8 h. As a result, the PHB formation was detected with C. necator H16 as a biocatalyst only when the electrolysis was operated in the same solution. The specificity of the source of PHB production is discussed, such as salinity, electricity, concurrent hydrogen production, and the possible involvement of reactive oxygen species (ROS.
Al Rowaihi, Israa Salem; Paillier, Alexis; Rasul, Shahid; Karan, Ram; Grötzinger, Stefan Wolfgang; Eppinger, Jörg
2018-01-01
Poly(3-hydroxybutyrate) (PHB), a biodegradable polymer, can be produced by different microorganisms. The PHB belongs to the family of polyhydroxyalkanoate (PHA) that mostly accumulates as a granule in the cytoplasm of microorganisms to store carbon and energy. In this study, we established an integrated one-pot electromicrobial setup in which carbon dioxide is reduced to formate electrochemically, followed by sequential microbial conversion into PHB, using the two model strains, Methylobacterium extorquens AM1 and Cupriavidus necator H16. This setup allows to investigate the influence of different stress conditions, such as coexisting electrolysis, relatively high salinity, nutrient limitation, and starvation, on the production of PHB. The overall PHB production efficiency was analyzed in reasonably short reaction cycles typically as short as 8 h. As a result, the PHB formation was detected with C. necator H16 as a biocatalyst only when the electrolysis was operated in the same solution. The specificity of the source of PHB production is discussed, such as salinity, electricity, concurrent hydrogen production, and the possible involvement of reactive oxygen species (ROS). PMID:29698424
Al Rowaihi, Israa Salem
2018-04-26
Poly(3-hydroxybutyrate) (PHB), a biodegradable polymer, can be produced by different microorganisms. The PHB belongs to the family of polyhydroxyalkanoate (PHA) that mostly accumulates as a granule in the cytoplasm of microorganisms to store carbon and energy. In this study, we established an integrated one-pot electromicrobial setup in which carbon dioxide is reduced to formate electrochemically, followed by sequential microbial conversion into PHB, using the two model strains, Methylobacterium extorquens AM1 and Cupriavidus necator H16. This setup allows to investigate the influence of different stress conditions, such as coexisting electrolysis, relatively high salinity, nutrient limitation, and starvation, on the production of PHB. The overall PHB production efficiency was analyzed in reasonably short reaction cycles typically as short as 8 h. As a result, the PHB formation was detected with C. necator H16 as a biocatalyst only when the electrolysis was operated in the same solution. The specificity of the source of PHB production is discussed, such as salinity, electricity, concurrent hydrogen production, and the possible involvement of reactive oxygen species (ROS).
Massively parallel sequencing and analysis of the Necator americanus transcriptome.
Directory of Open Access Journals (Sweden)
Cinzia Cantacessi
2010-05-01
Full Text Available The blood-feeding hookworm Necator americanus infects hundreds of millions of people worldwide. In order to elucidate fundamental molecular biological aspects of this hookworm, the transcriptome of the adult stage of Necator americanus was explored using next-generation sequencing and bioinformatic analyses.A total of 19,997 contigs were assembled from the sequence data; 6,771 of these contigs had known orthologues in the free-living nematode Caenorhabditis elegans, and most of them encoded proteins with WD40 repeats (10.6%, proteinase inhibitors (7.8% or calcium-binding EF-hand proteins (6.7%. Bioinformatic analyses inferred that the C. elegans homologues are involved mainly in biological pathways linked to ribosome biogenesis (70%, oxidative phosphorylation (63% and/or proteases (60%; most of these molecules were predicted to be involved in more than one biological pathway. Comparative analyses of the transcriptomes of N. americanus and the canine hookworm, Ancylostoma caninum, revealed qualitative and quantitative differences. For instance, proteinase inhibitors were inferred to be highly represented in the former species, whereas SCP/Tpx-1/Ag5/PR-1/Sc7 proteins ( = SCP/TAPS or Ancylostoma-secreted proteins were predominant in the latter. In N. americanus, essential molecules were predicted using a combination of orthology mapping and functional data available for C. elegans. Further analyses allowed the prioritization of 18 predicted drug targets which did not have homologues in the human host. These candidate targets were inferred to be linked to mitochondrial (e.g., processing proteins or amino acid metabolism (e.g., asparagine t-RNA synthetase.This study has provided detailed insights into the transcriptome of the adult stage of N. americanus and examines similarities and differences between this species and A. caninum. Future efforts should focus on comparative transcriptomic and proteomic investigations of the other predominant human
Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke
2015-01-01
We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.
Koopman, F.; Wierckx, N.; Winde, de, J.H.; Ruijssenaars, H.J.
2010-01-01
The toxic fermentation inhibitors in lignocellulosic hydrolysates pose significant problems for the production of second-generation biofuels and biochemicals. Among these inhibitors, 5-(hydroxymethyl)furfural (HMF) and furfural are specifically notorious. In this study, we describe the complete molecular identification and characterization of the pathway by which Cupriavidus basilensis HMF14 metabolizes HMF and furfural. The identification of this pathway enabled the construction of an HMF an...
Biodegradation of 2,4-dichlorophenol originating from ...
African Journals Online (AJOL)
STORAGESEVER
2009-06-03
Jun 3, 2009 ... of high concentration of chlorophenols. Appl. Microbiol. Biotechnol. 59: 599-604. Louie TM, Webster CM, Xun L (2002). Genetic and biochemical characterization of a 2,4,6- trichlorophenol degradation pathway in. Ralstonia eutropha JMP 134. J. Bacteriol. 184: 3492-3500. Lysetska M, Knoll A, Boehringer D ...
S Duggal; R Gur; R Nayar; S R Rongpharpi; D Jain; R K Gupta
2013-01-01
Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and sep...
Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke
2015-03-26
We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.
Schmidt, M.; Ienczak, J. L.; Quines, L. K.; Zanfonato, K.; Schmidell, W.; Aragão, G. M. F.
2016-01-01
Abstract Studies have shown that the supplementation of vegetable oils, in poly(3-hydroxybutyrate) production, provides an increase in the process productivity, besides inducing lipase activity in the medium. The supplementation with miniemulsified oils could potentialize these results. In this work, the influence of supplementation of the medium with soybean oil, without treatment and miniemulsified, on polymerr production was evaluated. The best moment to supplement the medium and its influ...
Lafi, Feras Fawzi; Bokhari, Ameerah; Alam, Intikhab; Bajic, Vladimir B.; Hirt, Heribert; Saad, Maged
2016-01-01
We isolated the plant endophytic bacterium Cupriavidus gilardii strain JZ4 from the roots of the desert plant Tribulus terrestris, collected from the Jizan region, Saudi Arabia. We report here the draft genome sequence of JZ4, together with several enzymes related to plant growth-promoting activity, environmental adaption, and antifungal activity.
Lafi, Feras Fawzi
2016-07-28
We isolated the plant endophytic bacterium Cupriavidus gilardii strain JZ4 from the roots of the desert plant Tribulus terrestris, collected from the Jizan region, Saudi Arabia. We report here the draft genome sequence of JZ4, together with several enzymes related to plant growth-promoting activity, environmental adaption, and antifungal activity.
SBRC-Nottingham: sustainable routes to platform chemicals from C1 waste gases.
Burbidge, Alan; Minton, Nigel P
2016-06-15
Synthetic Biology Research Centre (SBRC)-Nottingham (www.sbrc-nottingham.ac.uk) was one of the first three U.K. university-based SBRCs to be funded by the Biotechnology and Biological Sciences Research Council (BBSRC) and Engineering and Physical Sciences Research Council (EPSRC) as part of the recommendations made in the U.K.'s Synthetic Biology Roadmap. It was established in 2014 and builds on the pioneering work of the Clostridia Research Group (CRG) who have previously developed a range of gene tools for the modification of clostridial genomes. The SBRC is primarily focussed on the conversion of single carbon waste gases into platform chemicals with a particular emphasis on the use of the aerobic chassis Cupriavidus necator. © 2016 The Author(s).
Sokal-Gutierrez, Karen; Ivey, Susan L; Garcia, Roxanna M; Azzam, Amin
2015-01-01
Medical educators, clinicians, and health policy experts widely acknowledge the need to increase the diversity of our healthcare workforce and build our capacity to care for medically underserved populations and reduce health disparities. The Program in Medical Education for the Urban Underserved (PRIME-US) is part of a family of programs across the University of California (UC) medical schools aiming to recruit and train physicians to care for underserved populations, expand the healthcare workforce to serve diverse populations, and promote health equity. PRIME-US selects medical students from diverse backgrounds who are committed to caring for underserved populations and provides a 5-year curriculum including a summer orientation, a longitudinal seminar series with community engagement and leadership-development activities, preclerkship clinical immersion in an underserved setting, a master's degree, and a capstone rotation in the final year of medical school. This is a mixed-methods evaluation of the first 4 years of the PRIME-US at the UC Berkeley-UC San Francisco Joint Medical Program (JMP). From 2006 to 2010, focus groups were conducted each year with classes of JMP PRIME-US students, for a total of 11 focus groups; major themes were identified using content analysis. In addition, 4 yearly anonymous, online surveys of all JMP students, faculty and staff were conducted and analyzed. Most PRIME-US students came from socioeconomically disadvantaged backgrounds and ethnic backgrounds underrepresented in medicine, and all were committed to caring for underserved populations. The PRIME-US students experienced many program benefits including peer support, professional role models and mentorship, and curricular enrichment activities that developed their knowledge, skills, and sustained commitment to care for underserved populations. Non-PRIME students, faculty, and staff also benefited from participating in PRIME-sponsored seminars and community-based activities
Gazda, Daniel B.; Schultz, John R.; Wong, Wing; Algate, Michelle T.; Bryant, Becky; Castro, Victoria A.
2009-01-01
Contingency Water Containers (CWCs) are used to store potable and technical water that is transferred to the International Space Station (ISS) from the Shuttle orbiter vehicles. When CWCs are filled, water from the orbiter galley is passed through an ion exchange/activated carbon cartridge that removes the residual iodine biocide used on Shuttle before silver biocide is added. Removal of iodine and addition of silver is necessary to inhibit microbial growth inside CWCs and maintain compatibility with the water systems in the Russian segment of ISS. As part of nominal water transfer activities, crewmembers collect samples from several CWCs for postflight analysis. Results from the analysis of water transfer samples collected during the docked phases of STS-118/13A.1 and STS-120/10A showed that several of the CWCs contained up to 10(exp 4) CFU/mL of bacteria despite the fact that the silver concentrations in the CWCs were within acceptable limits. The samples contained pure cultures of a single bacteria, a Cupriavidus (formerly Wautersia) species that has been shown to be resistant to metallic biocides. As part of the investigation into the cause and remediation of the bacterial contamination in these CWCs, ground studies were initiated to evaluate the resistance of the Cupriavidus species to the silver biocides used on ISS and to determine the minimum effective concentration for the different forms of silver present in the biocides. The initial findings from those experiments are discussed herein.
Ramirez, Miguel; Obrzydowski, Jennifer; Ayers, Mary; Virparia, Sonia; Wang, Meijing; Stefan, Kurtis; Linchangco, Richard; Castignetti, Domenic
2014-01-01
Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2) and nitrous oxide (N2O) while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3–C(NOH)–COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a g...
Duggal, S; Gur, R; Nayar, R; Rongpharpi, S R; Jain, D; Gupta, R K
2013-01-01
Ralstonia paucula (formerly classified as CDC (Centre for Disease Control) group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus) is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.
Directory of Open Access Journals (Sweden)
S Duggal
2013-01-01
Full Text Available Ralstonia paucula (formerly classified as CDC (Centre for Disease Control group IVc-2, Wautersia paucula; recently renamed as Cupriavidus pauculus is an environmental Gram-negative bacillus isolated from water sources and can cause serious human infections. Patients recover bacteriologically indicating low virulence. A total of 32 cases have been reported world-wide, but no isolation has ever been reported from cerebrospinal fluid or in India. The first case of R. paucula meningitis and septicemia is being reported here along with the brief summary of cases reported world-wide.
Mijnendonckx, Kristel; van Houdt, Rob; Provoost, Ann; Bossus, Albert; Ott, C. Mark; Venkateswaran, Kasthuri; Leys, Natalie
The craving of modern man to explore life beyond earth presents a lot of challenges. The control of microbial contamination of the confined manned spacecraft is an important aspect that has to be taken into account in this journey. Because the human body contains a huge amount of microorganisms, the crew itself is the most important contamination source. But contamination can also originate from residing environmental microorganisms or from materials that are supplied from the Earth. These microbial contaminations can cause problems for the astronauts -well documented to have a decreased immunity -and the infrastructure of the space station. In this study, 14 different Cupriavidus metallidurans and Ralstonia pickettii strains, isolated from such space-related environments, where characterised in detail. These unique strains were isolated from drinking water that returned from ISS (3), from the cooling water system of the American ISS segment (4), from a swab sample of the Mars Odyssey Orbitor surface prior to flight (4), and from an air sample taken in the space assembly facility PHSF during Mars exploration Rover assembly (3). Their resistance to heavy metals and antibiotics was screened. The C. metallidurans isolates were more resistant to Zn2+ and Hg+ but more sensitive to Ni2+ than the R. pickettii strains. The MIC values for Cu2+ ranged from 1,5mM to 12mM, for Co2+ from 1,58mM to 12,63mM and for Cd2+ from 0,25mM to 1mM. For Ni2+ , the MIC values were between 2 and 8mM, except for the strain C. metallidurans IV (0502478) that was able to grow on Ni+2 concentrations up to 48mM. A metal of special interest was Ag+ because it is used to sanitize ISS drinking water. The strains isolated from air and surface samples showed a MIC value ranging from 0,35µM to 4µM. The isolates from the water samples had MIC values from 0,3µM to 2µM, which is lower than (or comparable with) the lowest limit of the silver concentration used in the ISS (1,9µM -4,6µM). However, all
Obruca, Stanislav; Sedlacek, Petr; Mravec, Filip; Krzyzanek, Vladislav; Nebesarova, Jana; Samek, Ota; Kucera, Dan; Benesova, Pavla; Hrubanova, Kamila; Milerova, Miluse; Marova, Ivana
2017-10-25
Numerous prokaryotes accumulate polyhydroxybutyrate (PHB) intracellularly as a storage material. It has also been proposed that PHB accumulation improves bacterial stress resistance. Cupriavidus necator and its PHB non-accumulating mutant were employed to investigate the protective role of PHB under hypertonic conditions. The presence of PHB granules enhanced survival of the bacteria after exposure to hypertonic conditions. Surprisingly, when coping with such conditions, the bacteria did not utilize PHB to harvest carbon or energy, suggesting that, in the osmotic upshock of C. necator, the protective mechanism of PHB granules is not associated with their hydrolysis. The presence of PHB granules influenced the overall properties of the cells, since challenged PHB-free cells underwent massive plasmolysis accompanied by damage to the cell membrane and the leakage of cytoplasm content, while no such effects were observed in PHB containing bacteria. Moreover, PHB granules demonstrated "liquid-like" properties indicating that they can partially repair and stabilize cell membranes by plugging small gaps formed during plasmolysis. In addition, the level of dehydration and changes in intracellular pH in osmotically challenged cells were less pronounced for PHB-containing cultures, demonstrating the important role of PHB for bacterial survival under hyperosmotic conditions. Copyright © 2017 Elsevier B.V. All rights reserved.
Seid, Christopher A; Curti, Elena; Jones, R Mark; Hudspeth, Elissa; Rezende, Wanderson; Pollet, Jeroen; Center, Lori; Versteeg, Leroy; Pritchard, Sonya; Musiychuk, Konstantin; Yusibov, Vidadi; Hotez, Peter J; Bottazzi, Maria Elena
2015-01-01
Over 400 million people living in the world's poorest developing nations are infected with hookworms, mostly of the genus Necator americanus. A bivalent human hookworm vaccine composed of the Necator americanus Glutathione S-Transferase-1 (Na-GST-1) and the Necator americanus Aspartic Protease-1 (Na-APR-1 (M74)) is currently under development by the Sabin Vaccine Institute Product Development Partnership (Sabin PDP). Both monovalent vaccines are currently in Phase 1 trials. Both Na-GST-1 and Na-APR-1 antigens are expressed as recombinant proteins. While Na-GST-1 was found to express with high yields in Pichia pastoris, the level of expression of Na-APR-1 in this host was too low to be suitable for a manufacturing process. When the tobacco plant Nicotiana benthamiana was evaluated as an expression system, acceptable levels of solubility, yield, and stability were attained. Observed expression levels of Na-APR-1 (M74) using this system are ∼300 mg/kg. Here we describe the achievements and obstacles encountered during process development as well as characterization and stability of the purified Na-APR-1 (M74) protein and formulated vaccine. The expression, purification and analysis of purified Na-APR-1 (M74) protein obtained from representative 5 kg reproducibility runs performed to qualify the Na-APR-1 (M74) production process is also presented. This process has been successfully transferred to a pilot plant and a 50 kg scale manufacturing campaign under current Good Manufacturing Practice (cGMP) has been performed. The 50 kg run has provided a sufficient amount of protein to support the ongoing hookworm vaccine development program of the Sabin PDP.
Gao, Yu-Rong; Han, Yong-Tao; Zhao, Feng-Li; Li, Ya-Juan; Cheng, Yuan; Ding, Qin; Wang, Yue-Jin; Wen, Ying-Qiang
2016-01-01
The most economically important disease of cultivated grapevines worldwide is powdery mildew caused by the biotrophic fungal pathogen Erysiphe necator. To integrate effective genetic resistance into cultivated grapevines, numerous disease resistance screens of diverse Vitis germplasm, including wild species, have been conducted to identify powdery mildew resistance, but the results have been inconsistent. Here, a new powdery mildew isolate that is infectious on grapevines, designated Erysiphe necator NAFU1 (En. NAFU1), was identified and characterized by phylogeny inferred from the internal transcribed spacer (ITS) of pathogen ribosomal DNA sequences. Three classical methods were compared for the maintenance of En. NAFU1, and the most convenient method was maintenance on detached leaves and propagation by contact with infected leaves. Furthermore, controlled inoculations of En. NAFU1 were performed using detached leaves from 57 wild Chinese grapevine accessions to quickly evaluate powdery mildew resistance based on trypan blue staining of leaf sections. The results were compared with previous natural epidemics in the field. Among the screened accessions inoculated with En. NAFU1, 22.8% were resistant, 33.3% were moderately resistant, and 43.9% were susceptible. None of the accessions assessed herein were immune from infection. These results support previous findings documenting the presence of race-specific resistance to E. necator in wild Chinese grapevine. The resistance of wild Chinese grapevine to En. NAFU1 could be due to programmed cell death. The present results suggest that En. NAFU1 isolate could be used for future large-scale screens of resistance to powdery mildew in diverse Vitis germplasms and investigations of the interaction between grapevines and pathogens. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
13 CFR 134.402 - Appeal petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.402 Appeal petition. In addition to the requirements of § 134.203, an appeal petition must state...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Settlement. 134.25 Section 134.25 Foreign... Considering Applications § 134.25 Settlement. The applicant and the Department of State may agree on a proposed settlement of the award before final action on the application, either in connection with a...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Investigation. 13.4 Section 13.4 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.4 Investigation. (a) If an Investigating Official concludes that a subpoena pursuant to the Authority conferred by...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.310 Section 134.310 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.310 Discovery. Discovery will not be permitted in appeals from size determinations or NAICS...
Arundhati Pal; A. K. Paul
2013-01-01
Extracellular polymeric substances (EPS) are complex biopolymers produced by a wide array of microorganisms for protection against dessication, aggregation, adhesion, and expression of virulence. Growth associated production of EPS by Ni-resistant Cupriavidus pauculus KPS 201 was determined in batch culture using sodium gluconate as the sole carbon source. The optimum pH and temperature for EPS production were 6.5 and 25°C, respectively. Optimal EPS yield (118 μg/mL) was attained at 0.35% Na-...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Discovery. 134.213 Section 134.213... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.213 Discovery. (a) Motion. A party may obtain discovery only upon motion, and for good cause shown. (b) Forms. The forms of discovery...
Agurto, Mario; Schlechter, Rudolf O.; Armijo, Grace; Solano, Esteban; Serrano, Carolina; Contreras, Rodrigo A.; Zúñiga, Gustavo E.; Arce-Johnson, Patricio
2017-01-01
Fungal pathogens are the cause of the most common diseases in grapevine and among them powdery mildew represents a major focus for disease management. Different strategies for introgression of resistance in grapevine are currently undertaken in breeding programs. For example, introgression of several resistance genes (R) from different sources for making it more durable and also strengthening the plant defense response. Taking this into account, we cross-pollinated P09-105/34, a grapevine plant carrying both RUN1 and REN1 pyramided loci of resistance to Erysiphe necator inherited from a pseudo-backcrossing scheme with Muscadinia rotundifolia and Vitis vinifera ‘Dzhandzhal Kara,’ respectively, with the susceptible commercial table grape cv. ‘Crimson Seedless.’ We developed RUN1REN1 resistant genotypes through conventional breeding and identified them by marker assisted selection. The characterization of defense response showed a highly effective defense mechanism against powdery mildew in these plants. Our results reveal that RUN1REN1 grapevine plants display a robust defense response against E. necator, leading to unsuccessful fungal establishment with low penetration rate and poor hypha development. This resistance mechanism includes reactive oxygen species production, callose accumulation, programmed cell death induction and mainly VvSTS36 and VvPEN1 gene activation. RUN1REN1 plants have a great potential as new table grape cultivars with durable complete resistance to E. necator, and are valuable germplasm to be included in grape breeding programs to continue pyramiding with other sources of resistance to grapevine diseases. PMID:28553300
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Settlement. 134.217 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.217 Settlement. At any... have settled the case, and may file with such motion a copy of the settlement agreement. If the Judge...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reports. 13.4 Section 13.4 Housing... PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 13.4 Reports. HUD shall compile and submit... report on its experience in implementing S. 1195 Official Mail Use in the Location and Recovery of...
Directory of Open Access Journals (Sweden)
Yang, T. A.
2013-01-01
Full Text Available Aims: Improper disposal of domestic wastes, such as waste cooking oil (WCO, contributes to the deterioration of the environment and may lead to health problems. In this study, we evaluated the potential of plant-based WCO as a carbon source for the commercial biosynthesis of the bio-plastics, poly(3-hydroxybutyrate and poly(3-hydroxybutyrate-co-3-hydroxyhexanoate. The consumption of WCO for this purpose would mitigate their pollution of the environment at the same time.Methodology and Results: WCO collected from several cafeterias in USM was tested as the carbon source for polyhydroxyalkanoates (PHA production. A selection of suitable nitrogen source was first conducted in order to obtain an acceptable number of dry cell weight (DCW and PHA content. Urea was found to be a suitable nitrogen source for the two bacterial strains used in our study, Cupriavidus necator H16 and its transformed mutant, C. necator PHB¯4 harboring the PHA synthase gene of Aeromonas caviae (PHB¯4/pBBREE32d13. With WCO as the sole carbon source, C. necator H16 yielded a relatively good dry cell weight (DCW=25.4 g/L, with 71 wt% poly(3-hydroxybutyrate P(3HBcontent. In comparison, the DCW obtained with fresh cooking oil (FCO was 24.8 g/L. The production of poly(3 hydroxybutyrate-co-3- hydroxyhexanoate [P(3HB-co-3HHx] from WCO by the transformant C. necator PHB¯4 was comparable, yielding a DCW of 22.3 g/L and P(3HB-co-3HHx content of 85 wt%. Lipase activities for both bacterial strains reached a maximum after 72 h of cultivation when time profile was conducted. Conclusion, significance and impact of study: The use of WCO as a carbon source in the biosynthesis of the bioplastic, PHA, turns a polluting domestic waste into a value-added biodegradable product. This renewable source material can thus be exploited for the low cost production of PHA.
Aziz, A.; Izzudin; Mainil, A. K.
2017-09-01
The objective of this study is to compare the performance of refrigerator system using working fluid between R134a refrigerant and HCR134a as hydrocarbon refrigerant for substitution of R134a. The use of capillary tube (CT) 1.5 m with HCR134a showed that slightly better COP than among the others, due to the lower pressure of condenser, conversely thermostatic expansion valve (TEV) showed that better COP than among the others with R134a. COP of CT 1.25 m and CT 1.5 m using HCR134a increase about 42.89% and 18.09% compared to R134a, where the electric current of refrigerator system decrease about 11.63% and 10.98%. However, the COP of HCR134a with CT 2.7 m and TEV were obtained lower than R134a about 16.2% and 17.06% and the use of electric current is higher than R134a about 12.98% and 16.5%. The use of HCR134a provides a higher refrigeration effect than R134a about 66.71%-88.27% for various types of expansion devices. The results confirmed that HCR134a could be an alternative refrigerant for replacement of R134a refrigerant.
Directory of Open Access Journals (Sweden)
Xiaoyu Wang
Full Text Available Cupriavidus sp. are generally heavy metal tolerant bacteria with the ability to degrade a variety of aromatic hydrocarbon compounds, although the degradation pathways and substrate versatilities remain largely unknown. Here we studied the bacterium Cupriavidus gilardii strain CR3, which was isolated from a natural asphalt deposit, and which was shown to utilize naphthenic acids as a sole carbon source. Genome sequencing of C. gilardii CR3 was carried out to elucidate possible mechanisms for the naphthenic acid biodegradation. The genome of C. gilardii CR3 was composed of two circular chromosomes chr1 and chr2 of respectively 3,539,530 bp and 2,039,213 bp in size. The genome for strain CR3 encoded 4,502 putative protein-coding genes, 59 tRNA genes, and many other non-coding genes. Many genes were associated with xenobiotic biodegradation and metal resistance functions. Pathway prediction for degradation of cyclohexanecarboxylic acid, a representative naphthenic acid, suggested that naphthenic acid undergoes initial ring-cleavage, after which the ring fission products can be degraded via several plausible degradation pathways including a mechanism similar to that used for fatty acid oxidation. The final metabolic products of these pathways are unstable or volatile compounds that were not toxic to CR3. Strain CR3 was also shown to have tolerance to at least 10 heavy metals, which was mainly achieved by self-detoxification through ion efflux, metal-complexation and metal-reduction, and a powerful DNA self-repair mechanism. Our genomic analysis suggests that CR3 is well adapted to survive the harsh environment in natural asphalts containing naphthenic acids and high concentrations of heavy metals.
Mugambi, Robert Muriuki; Agola, Eric L.; Mwangi, Ibrahim N.; Kinyua, Johnson; Shiraho, Esther Andia; Mkoji, Gerald M.
2015-01-01
Background Hookworm infection is a major concern in sub-Saharan Africa, particularly in children and pregnant women. Necator americanus and Ancylostoma duodenale are responsible for this condition. Hookworm disease is one of the Neglected tropical diseases (NTDs) that are targeted for elimination through global mass chemotherapy. To support this there is a need for reliable diagnostic tools. The conventional diagnostic test, Kato-Katz that is based on microscopic detection of parasite ova in ...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT
19 CFR 134.34 - Certain repacked articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in the...
19 CFR 134.53 - Examination packages.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 134.53 Section 134.53... TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.53 Examination packages. (a) Site of marking—(1) Customs custody. Articles (or containers) in examination packages may be marked by...
Sahimin, Norhidayu; Lim, Yvonne Ai Lian; Douadi, Benacer; Mohd Khalid, Mohd Khairul Nizam; Wilson, John-James; Behnke, Jerzy M; Mohd Zain, Siti Nursheena
2017-09-01
Ongoing urbanisation of the working population as well as cross-border migration of workers particularly into large cities has contributed to the development and growth of urban slums. These deprived areas are conducive for the transmission of intestinal pathogens including hookworm. The aim of this study was to determine both the prevalence and species identity of hookworm infections among the migrant worker community in Malaysia. A total of 388 faecal samples were collected from migrant workers between September 2014 and August 2015, representing workers from five employment sectors: construction, manufacturing, agriculture and plantations, food services and domestic services. Faecal samples were examined by microscopy and positive samples were subjected to molecular analysis. A total of 51 samples (13.1%) were positive by microscopy for hookworm infections. A two-step PCR based method amplifying a fragment of the 28S rRNA-ITS2 region was used to identify infections by Necator americanus and Ancylostoma spp. PCR products positive for Ancylostoma spp. were sequenced bidirectionally, and sequences analysed through BLAST and phylogenetic analysis. Samples containing Ancylostoma duodenale were further characterized by amplification and sequencing a fragment of cytochrome c oxidase subunit 1 (cox1) gene. PCR amplicons were successfully obtained from 42 (82.4%) of 51 samples, with 81.0% (34 of 42) identified as Necator americanus, 16.7% (7 of 42) as Ancylostoma spp. and 2.4% (1 of 42) as mixed infections of both species. All eight Ancylostoma spp. were confirmed to be Ancylostoma duodenale and this is the first time A. duodenale was reported in Malaysia. Samples containing A. duodenale from Nepalese and Indonesian workers shared high-similarity and were distinct compared to sequences from other countries. This study highlights the prevalence of hookworm infections among migrant workers living in Malaysia. Our findings underscore the necessity of screening migrant
Study of interaction of the bacterium cupriavidus metallidurans with strontium
International Nuclear Information System (INIS)
Boussiga, Rim
2010-01-01
Cupriavidus metallidurans strain Ch 34 (previously known as Ralstonia metallidurans, Ralstonia eutropha, and Alcaligenes eutrophus) is an ideal subject to study heavy metal disturbance of cellular processes. Moreover, the capacity of C. metallidurans Ch 34 for in situ bioremediation was assessed and proved to be feasible on pilot scale. In this work, the molecular and physiological response to strontium cations (Sr 2+ ) by C.metallidurans Ch 34 was studied. Results showed that C. metallidurans Ch 34 resisted to high concentrations of Sr (120 m M) and that this resistance is not linked to the presence of its 2 large plasmid pMOL30 or pMOL28. During this study, a tctCBA-dependent tripartite tricarboxylate transport (TTT) system in strain Ch 34 was discovered. Transmission Electron Microscopy (TEM) observation of C.metallidurans challenged with strontium confirms the precipitation of Sr 2+ ) directly onto the surface of cells, inside and in the microenvironment around the cells. These results highlight the potential of C. metalliduras Ch 34 to endure environmental extremes and suggest that in situ bioremediation of Sr-containing waste with Ch 34 might be feasible.
13 CFR 134.203 - The petition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false The petition. 134.203 Section 134... BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.203 The petition. (a) A petition must contain the following: (1) The basis of OHA's jurisdiction; (2) A copy of the SBA...
Metabolic engineering to expand the substrate spectrum of Pseudomonas putida toward sucrose.
Löwe, Hannes; Schmauder, Lukas; Hobmeier, Karina; Kremling, Andreas; Pflüger-Grau, Katharina
2017-08-01
Sucrose is an important disaccharide used as a substrate in many industrial applications. It is a major component of molasses, a cheap by-product of the sugar industry. Unfortunately, not all industrially relevant organisms, among them Pseudomonas putida, are capable of metabolizing sucrose. We chose a metabolic engineering approach to circumvent this blockage and equip P. putida with the activities necessary to consume sucrose. Therefore, we constructed a pair of broad-host range mini-transposons (pSST - sucrose splitting transposon), carrying either cscA, encoding an invertase able to split sucrose into glucose and fructose, or additionally cscB, encoding a sucrose permease. Introduction of cscA was sufficient to convey sucrose consumption and the additional presence of cscB had no further effect, though the sucrose permease was built and localized to the membrane. Sucrose was split extracellularly by the activity of the invertase CscA leaking out of the cell. The transposons were also used to confer sucrose consumption to Cupriavidus necator. Interestingly, in this strain, CscB acted as a glucose transporter, such that C. necator also gained the ability to grow on glucose. Thus, the pSST transposons are functional tools to extend the substrate spectrum of Gram-negative bacterial strains toward sucrose. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.
Dahman, Yaser; Ugwu, Charles U
2014-08-01
This work describes potential opportunities for utilization of agro-industrial residues to produce green biodegradable plastics of poly(3-hydroxybutyrate) (PHB). Wheat straws were examined with good efficacy of carbon substrates using Cupriavidus necator. Production was examined in separate hydrolysis and fermentation (SHF) in the presence and absence of WS hydrolysis enzymes, and in simultaneous saccharification and fermentation (SSF) with enzymes. Results showed that production of PHB in SSF was more efficient in terms of viable cell count, cell dry weight, and PHB production and yield compared to those of SHF and glucose-control cultures. While glucose control experiment produced 4.6 g/L PHB; SSF produced 10.0 g/L compared to 7.1 g/L in SHF when utilizing enzymes during WS hydrolysis. Results showed that most of sugars produced during the hydrolysis were consumed in SHF (~98 %) compared to 89.2 % in SSF. Results also demonstrated that a combination of glucose and xylose can compensate for the excess carbon required for enhancing PHB production by C. necator. However, higher concentration of sugars at the beginning of fermentation in SHF can lead to cell inhibition and consequently catabolite repressions. Accordingly, results demonstrated that the gradual release of sugars in SSF enhanced PHB production. Moreover, the presence of sugars other than glucose and xylose can eliminate PHB degradation in medium of low carbon substrate concentrations in SSF.
Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a
Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul
2012-06-01
An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.
Behavior of cesium-134 in the tea tree
International Nuclear Information System (INIS)
Xu Yinliang; Chen Kaixuan; Chen Chuangqun
1996-01-01
The radioactivity changes of 134 Cs in the aged and the young leaves followed an exponential regression function after spraying 134 Cs in the tea trees. Contamination by spraying 134 Cs greatly harmed tea tree and by irrigating or mixing 134 Cs with soil resulted in a potential endangerment. The concentrating ability of tea leaves for 134 CS was very low and K value was 0.02. After the fresh tea leaves were processed to dry tea, the content of 134 Cs decreased by about 13.3%. When the tea leaves were soaked in hot water, the extraction ratio was around 83.6%
Zhou, Yuhua; Lin, Feishen; Cui, Zelin; Zhang, Xiangrong; Hu, Chunmei; Shen, Tian; Chen, Chunyan; Zhang, Xia; Guo, Xiaokui
2015-01-01
Pulmonary tuberculosis (TB) has gained attention in recent decades because of its rising incidence trend; simultaneously, increasing numbers of studies have identified the relationship between microbiota and chronic infectious diseases. In our work, we enrolled 32 patients with primary TB characterised by unilateral TB lesion formation diagnosed by chest radiographic exam. Bronchoalveolar lavage fluid was taken from both lungs. Twenty-four healthy people were chosen as controls. Pyrosequencing was performed on the V3 hypervariable region of 16S rDNA in all bacterial samples and used as a culture-independent method to describe the phylogenetic composition of the microbiota. Through pyrosequencing, 271,764 amplicons were detected in samples and analysed using tools in the Ribosomal Database Project (RDP) and bioinformatics. These analyses revealed significant differences in the microbiota in the lower respiratory tract (LRT) of TB patients compared with healthy controls; in contrast, the microbiota of intra/extra-TB lesions were similar. These results showed that the dominant bacterial genus in the LRT of TB patients was Cupriavidus and not Streptococcus, which resulted in a significant change in the microbiota in TB patients. The abundance of Mycobacteria and Porphyromonas significantly increased inside TB lesions when compared with non-lesion-containing contralateral lungs. From these data, it can be concluded that Cupriavidus plays an important role in TB's secondary infection and that in addition to Mycobacteria, Porphyromonas may also be a co-factor in lesion formation. The mechanisms underlying this connection warrant further research.
Behaviour of 134Cs in the aquatic ecosystems
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun
1992-07-01
The diminution of 134 Cs in the aquatic phases and the absorption of 134 Cs by aquatic lives observe the exponential expression. i.e. Y Ae be . The relationships between the enrichment factor of 134 Cs(K) and the time(t) in the aquatic lives can be represented by a linear equation, K A + Bt. The value of K in the Alternanthera philoxeroides was about 560. That can be used for monitoring and purifying the water phase contaminated by 134 Cs. Fish can absorb 134 Cs from water phase and store it in liver and kidney. The specific activity of 134 Cs in fish flesh was low but the percentage of radioactivity was high that was about 30% of total radioactivity in the fish. River mud can strongly absorb 134 Cs and reduce the absorption by aquatic lives. It is a good adsorbent and purifying agent with low cost for treatment of 134 Cs. The K + can prevent aquatic lives from absorbing Cs + because of antagonistic function
Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie
2012-01-01
Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.
Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie
2012-01-01
Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623
29 CFR 2570.134 - Consequences of default.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.134 Section 2570.134 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(7) § 2570.134 Consequences of default. For 502(c)(7) civil penalty proceedings...
49 CFR 195.134 - CPM leak detection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...
13 CFR 134.409 - Decision on appeal.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is the...
19 CFR 134.14 - Articles usually combined.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is usually...
12 CFR 13.4 - Recommendations to customers.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Recommendations to customers. 13.4 Section 13.4... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the...
Energy Technology Data Exchange (ETDEWEB)
Koopman, F.; De Winde, J.H. [Bio-Based Sustainable Industrial Chemistry (B-Basic), Delft University of Technology, Department of Biotechnology, Julianalaan 67, 2628 BC, Delft (Netherlands); Wierckx, N. [Kluyver Centre for Genomics of Industrial Fermentation, P.O. Box 5057, 2600 GB, Delft (Netherlands); Ruijssenaars, H.J. [Netherlands Organization for Applied Scientific Research, Quality of Life, Department of Bioconversion, Julianalaan 67, 2628 BC, Delft (Netherlands); O' Neal Ingram, L. (ed.) [University of Florida, Gainesville, Gainesville, FL (United States)
2010-03-16
The toxic fermentation inhibitors in lignocellulosic hydrolysates pose significant problems for the production of second-generation biofuels and biochemicals. Among these inhibitors, 5-(hydroxymethyl) furfural (HMF) and furfural are specifically notorious. In this study, we describe the complete molecular identification and characterization of the pathway by which Cupriavidus basilensis HMF14 metabolizes HMF and furfural. The identification of this pathway enabled the construction of an HMF and furfural-metabolizing Pseudomonas putida. The genetic information obtained furthermore enabled us to predict the HMF and furfural degrading capabilities of sequenced bacterial species that had not previously been connected to furanic aldehyde metabolism. These results pave the way for in situ detoxification of lignocellulosic hydrolysates, which is a major step toward improved efficiency of utilization of lignocellulosic feedstock.
Koopman, Frank; Wierckx, Nick; de Winde, Johannes H.; Ruijssenaars, Harald J.
2010-01-01
The toxic fermentation inhibitors in lignocellulosic hydrolysates pose significant problems for the production of second-generation biofuels and biochemicals. Among these inhibitors, 5-(hydroxymethyl)furfural (HMF) and furfural are specifically notorious. In this study, we describe the complete molecular identification and characterization of the pathway by which Cupriavidus basilensis HMF14 metabolizes HMF and furfural. The identification of this pathway enabled the construction of an HMF and furfural-metabolizing Pseudomonas putida. The genetic information obtained furthermore enabled us to predict the HMF and furfural degrading capabilities of sequenced bacterial species that had not previously been connected to furanic aldehyde metabolism. These results pave the way for in situ detoxification of lignocellulosic hydrolysates, which is a major step toward improved efficiency of utilization of lignocellulosic feedstock. PMID:20194784
The 134Cs uptake by sunflower (Helianthus anuus, Less) cultivated on soil contaminated with 134Cs
International Nuclear Information System (INIS)
Poppy Intan Tjahaja; Putu Sukmabuana
2008-01-01
One of the methods for remediation of contaminated environment is phytoremediation techniques, i.e. the environmental remediation using plants. In this research the bioavailability of sunflower plant (Helianthus anuus, Less) in radiocaesium uptake from soil was studied for being considered as a phytoremediator later. Sunflower plants were cultivated on soil contaminated with 134 Cs with the concentrations of 29,3 kBq/kg ; 117,2 kBq/kg ; 557 kBq/kg for 45 days. As control the sunflowers were also cultivated on non contaminated soil. Observation was carried out every 5 days by sampling 3 plants and soils. The plant and soil samples were dried using infra red lamp for 24 hours, and then counted using gamma spectrometer. The counting results i.e. 134 Cs concentration on soil and plant parts were then analyzed to obtain transfer factor (TF) values. The highest TF values was reached on 26 th day, i.e. 0,87; 1,89 ; 2,82 for initial soil 134 Cs concentrations of 29,3 Bq/g ; 117,2 Bq/g ; 557 Bq/g, respectively. The TF values obtained expressed the capability of plants to accumulate 134 Cs from soils. The observation to the plants growth showed that the plants grew normally on the 134 Cs contaminated soil until the concentration of 557 Bq/g. The sunflower can be considered to be phytoremediator of andosol soil contaminated with Cs radionuclides. (author)
29 CFR 1915.134 - Abrasive wheels.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Abrasive wheels. 1915.134 Section 1915.134 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... wheels shall fit freely on the spindle and shall not be forced on. The spindle nut shall be tightened...
Unveiling the biotransformation mechanism of indole in a Cupriavidus sp. strain.
Qu, Yuanyuan; Ma, Qiao; Liu, Ziyan; Wang, Weiwei; Tang, Hongzhi; Zhou, Jiti; Xu, Ping
2017-12-01
Indole, an important signaling molecule as well as a typical N-heterocyclic aromatic pollutant, is widespread in nature. However, the biotransformation mechanisms of indole are still poorly studied. Here, we sought to unlock the genetic determinants of indole biotransformation in strain Cupriavidus sp. SHE based on genomics, proteomics and functional studies. A total of 177 proteins were notably altered (118 up- and 59 downregulated) in cells grown in indole mineral salt medium when compared with that in sodium citrate medium. RT-qPCR and gene knockout assays demonstrated that an indole oxygenase gene cluster was responsible for the indole upstream metabolism. A functional indole oxygenase, termed IndA, was identified in the cluster, and its catalytic efficiency was higher than those of previously reported indole oxidation enzymes. Furthermore, the indole downstream metabolism was found to proceed via the atypical CoA-thioester pathway rather than conventional gentisate and salicylate pathways. This unusual pathway was catalyzed by a conserved 2-aminobenzoyl-CoA gene cluster, among which the 2-aminobenzoyl-CoA ligase initiated anthranilate transformation. This study unveils the genetic determinants of indole biotransformation and will provide new insights into our understanding of indole biodegradation in natural environments and its functional studies. © 2017 John Wiley & Sons Ltd.
Uranium and selenium resistance in Cupriavidus metallidurans CH34
International Nuclear Information System (INIS)
Avoscan, L.; Untereiner, G.; Carriere, M.; Gouget, B.; Degrouard, J.
2007-01-01
Cupriavidus metallidurans CH34, a soil bacterium, is known to resist a variety of heavy metals and metalloids. Its capacity to resist, accumulate and transform selenium (Se as selenite or selenate) and uranium (U as uranyl-carbonate and uranyl-citrate) was investigated. C. metallidurans CH34 resists to high U concentrations (up to 10 mM) whatever its speciation. However, no major accumulation could be measured: U-carbonate and U-citrate are not bio-available for the bacteria. The anaerobic response of C. metallidurans CH34 to U will be looked for. C. metallidurans CH34 resists to high Se concentrations (up to 4 mM of selenite and 8 mM of selenate). Bacteria exposed to 2 mM of selenite accumulate 25 times more Se than when they are exposed to same concentration of selenate. Se resistance is characterized by the reduction of oxy-anions in the bacteria. Selenite is reduced to elemental Se by an intracellular process, but the metabolic fate of selenate is unknown. By combining three methods of speciation (X-ray absorption spectroscopy (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGE coupled with particle induced X-ray emission (PIXE)), we both identified and specified the chemical intermediates formed by this bacterium upon exposure to these oxy-anions. Two mechanisms of reduction of Se oxides in C. metallidurans CH34 were highlighted. Assimilation transforms selenite and selenate into organic Se, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental Se. (authors)
Sophorolipid biosurfactants: Possible uses as antibacterial and antibiofilm agent.
Díaz De Rienzo, Mayri A; Banat, Ibrahim M; Dolman, Ben; Winterburn, James; Martin, Peter J
2015-12-25
Biosurfactants are amphipathic, surface-active molecules of microbial origin which accumulate at interfaces reducing interfacial tension and leading to the formation of aggregated micellular structures in solution. Some biosurfactants have been reported to have antimicrobial properties, the ability to prevent adhesion and to disrupt biofilm formation. We investigated antimicrobial properties and biofilm disruption using sophorolipids at different concentrations. Growth of Gram negative Cupriavidus necator ATCC 17699 and Gram positive Bacillus subtilis BBK006 were inhibited by sophorolipids at concentrations of 5% v/v with a bactericidal effect. Sophorolipids (5% v/v) were also able to disrupt biofilms formed by single and mixed cultures of B. subtilis BBK006 and Staphylococcus aureus ATCC 9144 under static and flow conditions, as was observed by scanning electron microscopy. The results indicated that sophorolipids may be promising compounds for use in biomedical application as adjuvants to other antimicrobial against some pathogens through inhibition of growth and/or biofilm disruption. Copyright © 2015 Elsevier B.V. All rights reserved.
Peña, C; Castillo, T; García, A; Millán, M; Segura, D
2014-07-01
Poly-(3-hydroxybutyrate) [P(3HB)] is a polyester synthesized as a carbon and energy reserve material by a wide number of bacteria. This polymer is characterized by its thermo-plastic properties similar to plastics derived from petrochemical industry, such as polyethylene and polypropylene. Furthermore, P(3HB) is an inert, biocompatible and biodegradable material which has been proposed for several uses in medical and biomedical areas. Currently, only few bacterial species such as Cupriavidus necator, Azohydromonas lata and recombinant Escherichia coli have been successfully used for P(3HB) production at industrial level. Nevertheless, in recent years, several fermentation strategies using other microbial models such as Azotobacter vinelandii, A. chroococcum, as well as some methane-utilizing species, have been developed in order to improve the P(3HB) production and also its mean molecular weight. © 2014 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.
Biofunctionalized Nanofibers Using Arthrospira (Spirulina Biomass and Biopolymer
Directory of Open Access Journals (Sweden)
Michele Greque de Morais
2015-01-01
Full Text Available Electrospun nanofibers composed of polymers have been extensively researched because of their scientific and technical applications. Commercially available polyhydroxybutyrate (PHB and polyhydroxybutyrate-co-valerate (PHB-HV copolymers are good choices for such nanofibers. We used a highly integrated method, by adjusting the properties of the spinning solutions, where the cyanophyte Arthrospira (formally Spirulina was the single source for nanofiber biofunctionalization. We investigated nanofibers using PHB extracted from Spirulina and the bacteria Cupriavidus necator and compared the nanofibers to those made from commercially available PHB and PHB-HV. Our study assessed nanofiber formation and their selected thermal, mechanical, and optical properties. We found that nanofibers produced from Spirulina PHB and biofunctionalized with Spirulina biomass exhibited properties which were equal to or better than nanofibers made with commercially available PHB or PHB-HV. Our methodology is highly promising for nanofiber production and biofunctionalization and can be used in many industrial and life science applications.
Measurement limits to 134Cs concentration in soil
International Nuclear Information System (INIS)
Ahn, J.K.; Kim, J.S.; Lee, H.M.; Kim, H.; Kim, T.H.; Park, J.N.; Kang, Y.S.; Lee, H.S.; Kim, S.J.; Park, J.Y.; Ryu, S.Y.; Kim, H.-Ch.; Kang, W.G.; Kim, S.K.
2011-01-01
We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the 134 Cs. In order to lower the minimum detectable amount (MDA) of activity for the 134 Cs, we have used the ammonium molybdophosphate (AMP) precipitation method to get rid of the 40 K existing in natural radioactivity, which reduces the MDA activity about 10 times smaller than those without the AMP precipitation method. The MDA results for the 134 Cs were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the 134 Cs in the samples the MDA should be reduced to the level of mBq/kg-dry weight. - Highlights: → We study the caesium concentrations in soils in mountain areas near Gori NPT in Korea. → We use the AMP precipitation method to lower the minimum detectable amount (MDA) of activity for the 134 Cs. → The results of the MDA for the 134 Cs turn out to be in the range between 0.015 and 0.044. → In order to detect the 134 Cs in the samples, the MDA should be reduced to the level of mBq/kg-dry weight.
13 CFR 134.404 - Decision by Administrative Law Judge.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under this...
Directory of Open Access Journals (Sweden)
Paul J Janssen
Full Text Available Many bacteria in the environment have adapted to the presence of toxic heavy metals. Over the last 30 years, this heavy metal tolerance was the subject of extensive research. The bacterium Cupriavidus metallidurans strain CH34, originally isolated by us in 1976 from a metal processing factory, is considered a major model organism in this field because it withstands milli-molar range concentrations of over 20 different heavy metal ions. This tolerance is mostly achieved by rapid ion efflux but also by metal-complexation and -reduction. We present here the full genome sequence of strain CH34 and the manual annotation of all its genes. The genome of C. metallidurans CH34 is composed of two large circular chromosomes CHR1 and CHR2 of, respectively, 3,928,089 bp and 2,580,084 bp, and two megaplasmids pMOL28 and pMOL30 of, respectively, 171,459 bp and 233,720 bp in size. At least 25 loci for heavy-metal resistance (HMR are distributed over the four replicons. Approximately 67% of the 6,717 coding sequences (CDSs present in the CH34 genome could be assigned a putative function, and 9.1% (611 genes appear to be unique to this strain. One out of five proteins is associated with either transport or transcription while the relay of environmental stimuli is governed by more than 600 signal transduction systems. The CH34 genome is most similar to the genomes of other Cupriavidus strains by correspondence between the respective CHR1 replicons but also displays similarity to the genomes of more distantly related species as a result of gene transfer and through the presence of large genomic islands. The presence of at least 57 IS elements and 19 transposons and the ability to take in and express foreign genes indicates a very dynamic and complex genome shaped by evolutionary forces. The genome data show that C. metallidurans CH34 is particularly well equipped to live in extreme conditions and anthropogenic environments that are rich in metals.
The absorption and distribution of Cesium-134 in rice-soil system
International Nuclear Information System (INIS)
Xu Yinliang; Chen Chuanqun; Chen Bin; Sun Zhiming
1991-01-01
Dynamics of absorption of 134 Cs by rice shows that absorption rate is the fastest at boot stage; absorption capacities of 134 Cs in soils are different with the different physical-chemical properties of soils; absorption amounts vary with the time of irrigating 134 Cs; the closer the irrigation time to mature stage is, the more the absorption amount of 134 Cs in rice will be; the more the irrigating times are, and the higher the radioactivity of 134 Cs in irrigating water is, the more the absorption amount in rice will be. After brown rice is polished, contamination of 134 Cs can be decreased by 22.6-45.6%. The order of specific activity in rice is: bran > root > straw > husk > polished rice. Percentage activity of straw, brown rice, root and husk is 51.4%, 28.4%, 11.8% and 8.4% respectively. The migration of 134 Cs is very slow in soil and 95.1% of 134 Cs is concentrated in surface soil (0-2.5 cm). The distribution ratio of 134 Cs in the rice and soil is 6.1%:93.9%. Potassium ion can inhibit the absorption of 134 Cs by rice. There is an exponential function between the concentration of potassium ion and specific activity of 134 Cs in rice
13 CFR 134.209 - Requirement of signature.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the party...
13 CFR 134.702 - Who may appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may appeal? 134.702 Section 134.702 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
2010-01-01
... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false [Reserved] 3.134-3.135 Section 3.134-3.135 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...
22 CFR 134.30 - Payment of award.
2010-04-01
... will pay the amount awarded to the applicant within 60 days, unless judicial review of the award or of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Payment of award. 134.30 Section 134.30 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS EQUAL ACCESS TO JUSTICE ACT; IMPLEMENTATION Procedures for...
Davis, Ryan; Bienvenue, David; Swierczek, Sabina I; Gilner, Danuta M; Rajagopal, Lakshman; Bennett, Brian; Holz, Richard C
2006-03-01
Glutamate-134 (E134) is proposed to act as the general acid/base during the hydrolysis reaction catalyzed by the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase (DapE) from Haemophilus influenzae. To date, no direct evidence has been reported for the role of E134 during catalytic turnover by DapE. In order to elucidate the catalytic role of E134, altered DapE enzymes were prepared in which E134 was substituted with an alanine and an aspartate residue. The Michaelis constant (K (m)) does not change upon substitution with aspartate but the rate of the reaction changes drastically in the following order: glutamate (100% activity), aspartate (0.09%), and alanine (0%). Examination of the pH dependence of the kinetic constants k (cat) and K (m) for E134D-DapE revealed ionizations at pH 6.4, 7.4, and approximately 9.7. Isothermal titration calorimetry experiments revealed a significant weakening in metal K (d) values of E134D-DapE. D134 and A134 perturb the second divalent metal binding site significantly more than the first, but both altered enzymes can still bind two divalent metal ions. Structural perturbations of the dinuclear active site of DapE were also examined for two E134-substituted forms, namely E134D-DapE and E134A-DapE, by UV-vis and electron paramagnetic resonance (EPR) spectroscopy. UV-vis spectroscopy of Co(II)-substituted E134D-DapE and E134A-DapE did not reveal any significant changes in the electronic absorption spectra, suggesting that both Co(II) ions in E134D-DapE and E134A-DapE reside in distorted trigonal bipyramidal coordination geometries. EPR spectra of [Co_(E134D-DapE)] and [Co_(E1341A-DapE] are similar to those observed for [CoCo(DapE)] and somewhat similar to the spectrum of [Co(H(2)O)(6)](2+) which typically exhibit E/D values of approximately 0.1. Computer simulation returned an axial g-tensor with g ((x,y))=2.24 and E/D=0.07; g ( z ) was only poorly determined, but was estimated as 2.5-2.6. Upon the addition of a second Co
Rojas, Luis A.; Yáñez, Carolina; González, Myriam; Lobos, Soledad; Smalla, Kornelia; Seeger, Michael
2011-01-01
Background Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. Methodology/Principal Findings To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg2+. The minimum inhibitory concentrations (mM) for strain MSR33 were: Hg2+, 0.12 and CH3Hg+, 0.08. The addition of Hg2+ (0.04 mM) at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg2+ (0.10 and 0.15 mM) was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM) after 2 h. Conclusions/Significance A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel and stable bacterial strain
Directory of Open Access Journals (Sweden)
Luis A Rojas
Full Text Available BACKGROUND: Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. METHODOLOGY/PRINCIPAL FINDINGS: To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg(2+. The minimum inhibitory concentrations (mM for strain MSR33 were: Hg(2+, 0.12 and CH(3Hg(+, 0.08. The addition of Hg(2+ (0.04 mM at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg(2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg(2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg(2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg(2+ (0.10 and 0.15 mM was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM after 2 h. CONCLUSIONS/SIGNIFICANCE: A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel
Gafni, Rachel I; Guthrie, Lori C; Kelly, Marilyn H; Brillante, Beth A; Christie, C Michele; Reynolds, James C; Yovetich, Nancy A; James, Robert; Collins, Michael T
2015-11-01
Synthetic human PTH 1-34 (hPTH 1-34) replacement therapy in hypoparathyroidism maintains eucalcemia and converts quiescent bone to high-turnover bone. However, the skeletal and metabolic effects of drug discontinuation have not been reported. Nine subjects with hypoparathyroidism received subcutaneous injections of hPTH 1-34 two to three times daily for 19.8 to 61.3 months and then transitioned back to calcium and calcitriol. Biochemistries and bone mineral density (BMD) by dual-energy X-ray absorptiometry (DXA) were assessed at baseline, while on treatment, and at follow-up 3 to 12 months after drug discontinuation. Two subjects developed hypocalcemia when hPTH 1-34 was abruptly discontinued. Thus, to avoid hypocalcemia, subjects were slowly weaned from hPTH 1-34 over several weeks. When hPTH 1-34 was stopped, subjects were requiring two to three times pretreatment doses of calcitriol and calcium to maintain blood calcium levels. Doses were gradually reduced over many weeks until calcium levels were stable on doses similar to baseline. Bone-specific alkaline phosphatase (BSAP), N-telopeptide (NTX), and osteocalcin (OC) increased significantly with hPTH 1-34; at follow-up, BSAP and NTX had returned to baseline while OC was still slightly elevated. During treatment, BMD was unchanged at the hip and lateral spine but declined at the anterior-posterior (AP) spine, radius, and total body. During weaning, BMD increased, with the hip and lateral spine exceeding pre-hPTH 1-34 values and the whole body returning to baseline. AP spine was increased non-significantly compared to baseline at follow-up. hPTH 1-34 must be gradually weaned in hypoparathyroid patients with high doses of oral medications given to avoid hypocalcemia. The transient increased requirements accompanied by increased BMD after long-term hPTH 1-34 therapy suggest a reversal of the expanded remodeling space favoring bone formation as the skeleton returns to a low-turnover state, reminiscent of the hungry
The R-134a energy efficiency problem
International Nuclear Information System (INIS)
Behrens, N.; Dekleva, T.W.; Hartley, J.G.; Murphy, F.T.; Powell, R.L.
1990-01-01
This paper examines the controversy over the relative energy efficiencies of R-134a and R-12, from a theoretical thermodynamic perspective. In this regard, the authors have used an in-house process flowsheeting program which allows to simulate the complete thermodynamic cycle, and investigate the effects of superheat and subcooling. Special attention is given to the suitable basis for comparing the energy efficiencies of different refrigerants calculated from thermodynamic data. Modelling experiments demonstrate the relative extent to which R-12 and R-134a respond differently to superheat and subcooling. With appropriate superheat and subcooling taken into consideration, such as applied in standard practice in the home appliance industry, R-134a can provide COP values essentially equivalent to that of R-12
Daskalakis, Markos I; Magoulas, Antonis; Kotoulas, Georgios; Katsikis, Ioannis; Bakolas, Asterios; Karageorgis, Aristomenis P; Mavridou, Athena; Doulia, Danae; Rigas, Fotis
2014-08-01
Bacterially induced calcium carbonate precipitation of a Cupriavidus metallidurans isolate was investigated to develop an environmentally friendly method for restoration and preservation of ornamental stones. Biomineralization performance was carried out in a growth medium via a Design of Experiments (DoE) approach using, as design factors, the temperature, growth medium concentration, and inoculum concentration. The optimum conditions were determined with the aid of consecutive experiments based on response surface methodology (RSM) and were successfully validated thereafter. Statistical analysis can be utilized as a tool for screening bacterial bioprecipitation as it considerably reduced the experimental time and effort needed for bacterial evaluation. Analytical methods provided an insight to the biomineral characteristics, and sonication tests proved that our isolate could create a solid new layer of vaterite on marble substrate withstanding sonication forces. C. metallidurans ACA-DC 4073 provided a compact vaterite layer on the marble substrate with morphological characteristics that assisted in its differentiation. The latter proved valuable during spraying minimum amount of inoculated media on marble substrate under conditions close to an in situ application. A sufficient and clearly distinguishable layer was identified.
41 CFR 105-53.134 - Office of Administration.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the agency...
Direct and indirect contamination of tree crops with Cs-134
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Arapis, G.; Haidouti, C.
1996-01-01
A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)
Daskalakis, M I; Magoulas, A; Kotoulas, G; Catsikis, I; Bakolas, A; Karageorgis, A P; Mavridou, A; Doulia, D; Rigas, F
2013-08-01
Bacterially induced calcium carbonate precipitation from various isolates was investigated aiming at developing an environmentally friendly technique for ornamental stone protection and restoration. Micro-organisms isolated from stone samples and identified using 16S rDNA and biochemical tests promoted calcium carbonate precipitation in solid and novel liquid growth media. Biomineral morphology was studied on marble samples with scanning electron microscopy. Most isolates demonstrated specimen weight increase, covering partially or even completely the marble surfaces mainly with vaterite. The conditions under which vaterite precipitated and its stability throughout the experimental runs are presented. A growth medium that facilitated bacterial growth of different species and promoted biomineralization was formulated. Most isolates induced biomineralization of CaCO3 . Micro-organisms may actually be a milestone in the investigation of vaterite formation facilitating our understanding of geomicrobiological interactions. Pseudomonas, Pantoea and Cupriavidus strains could be candidates for bioconsolidation of ornamental stone protection. Characterization of biomineralization capacity of different bacterial species improves understanding of the bacterially induced mineralization processes and enriches the list of candidates for biorestoration applications. Knowledge of biomineral morphology assists in differentiating mineral from biologically induced precipitates. © 2013 The Society for Applied Microbiology.
Energy Technology Data Exchange (ETDEWEB)
Desaunay, Aurélien; Martins, Jean M.F., E-mail: jean.martins@ujf-grenoble.fr
2014-05-01
Highlights: • Subcellular distribution of cadmium in Cupriavidus metallidurans CH34 cells. • Comparison of a chemical (EDTA washing) and a physical method (physical disruption). • EDTA washings strongly overestimated membrane-bound Cd concentrations. • The physical method revealed surprisingly over 80% of Cd internalization in the cells. • Metal biosorption by bacteria cannot be considered as a surface complexation process. - Abstract: Bacterial biosorption of heavy metals is often considered as a surface complexation process, without considering other retention compartments than cell walls. Although this approach gives a good description of the global biosorption process, it hardly permits the prediction of the fate of biosorbed metals in the environment. This study examines the subcellular distribution of cadmium (Cd) in the metal-tolerant bacterium Cupriavidus metallidurans CH34 through the comparison of an indirect chemical method (washing cells with EDTA) and a direct physical method (physical disruption of cells). The chemical washing approach presented strong experimental biases leading to the overestimation of washed amount of Cd, supposedly bound to cell membranes. On the contrary, the physical disruption approach gave reproducible and robust results of Cd subcellular distribution. Unexpectedly, these results showed that over 80% of passively biosorbed Cd is internalized in the cytoplasm. In disagreement with the common concept of surface complexation of metals onto bacteria the cell wall was poorly reactive to Cd. Our results indicate that metal sorption onto bacterial surfaces is only a first step in metal management by bacteria and open new perspectives on metal biosorption by bacteria in the environment, with implications for soil bioremediation or facilitated transport of metals by bacteria.
42 CFR 84.134 - Respirator containers; minimum requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...
134Cs emission probabilities determination by gamma spectrometry
de Almeida, M. C. M.; Poledna, R.; Delgado, J. U.; Silva, R. L.; Araujo, M. T. F.; da Silva, C. J.
2018-03-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of 134Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. 134Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration. The gamma emission probabilities (Pγ) were determined mainly for some energies of the 134Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1).
40 CFR 86.134-96 - Running loss test.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Running loss test. 86.134-96 Section... Heavy-Duty Vehicles; Test Procedures § 86.134-96 Running loss test. (a) Overview. Gasoline- and methanol-fueled vehicles are to be tested for running loss emissions during simulated high-temperature urban...
Investigation of R-134a as a modeling fluid for supercritical water
International Nuclear Information System (INIS)
Jouvin, J.C.; Pioro, I.
2014-01-01
The objective of this paper is to investigate the feasibility of using Refrigerant-134a (R-134a) as a potential modeling fluid by comparing the thermophysical properties with those of water. Operating conditions of SuperCritical Water-cooled Reactors (SCWRs) are scaled into those of R-134a, in order to provide proper SCWR-equivalent conditions. The thermophysical properties for R-134a are obtained from NIST REFPROP software. The results indicate that the thermophysical properties of R-134a undergo significant changes within the critical and pseudocritical regions similar to that of supercritical water. An investigation into the pseudocritical region of R-134a was also conducted. (author)
MicroRNA-134 regulates poliovirus replication by IRES targeting
Bakre, Abhijeet A.; Shim, Byoung-Shik; Tripp, Ralph A.
2017-01-01
Global poliovirus eradication efforts include high vaccination coverage with live oral polio vaccine (OPV), surveillance for acute flaccid paralysis, and OPV “mop-up” campaigns. An important objective involves host-directed strategies to reduce PV replication to diminish viral shedding in OPV recipients. In this study, we show that microRNA-134-5p (miR-134) can regulate Sabin-1 replication but not Sabin-2 or Sabin-3 via direct interaction with the PV 5′UTR. Hypochromicity data showed miR-134 ...
40 CFR 81.134 - Austin-Waco Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Austin-Waco Intrastate Air Quality Control Region. 81.134 Section 81.134 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.134 Austin-Waco Intrastate Air Quality Control Region. The Austin-Waco...
Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells
Institute of Scientific and Technical Information of China (English)
ZhuShou-Peng; XiaFen; 等
1997-01-01
Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.
Johnston, Brian; Jiang, Guozhan; Hill, David; Adamus, Grazyna; Kwiecień, Iwona; Zięba, Magdalena; Sikorska, Wanda; Green, Matthew; Kowalczuk, Marek; Radecka, Iza
2017-08-28
There is an increasing demand for bio-based polymers that are developed from recycled materials. The production of biodegradable polymers can include bio-technological (utilizing microorganisms or enzymes) or chemical synthesis procedures. This report demonstrates the corroboration of the molecular structure of polyhydroxyalkanoates (PHAs) obtained by the conversion of waste polyethylene (PE) via non-oxygenated PE wax (N-PEW) as an additional carbon source for a bacterial species. The N-PEW, obtained from a PE pyrolysis reaction, has been found to be a beneficial carbon source for PHA production with Cupriavidus necator H16. The production of the N-PEW is an alternative to oxidized polyethylene wax (O-PEW) (that has been used as a carbon source previously) as it is less time consuming to manufacture and offers fewer industrial applications. A range of molecular structural analytical techniques were performed on the PHAs obtained; which included nuclear magnetic resonance (NMR) and electrospray ionisation tandem mass spectrometry (ESI-MS/MS). Our study showed that the PHA formed from N-PEW contained 3-hydroxybutyrate (HB) with 11 mol% of 3-hydroxyvalerate (HV) units.
International Nuclear Information System (INIS)
Badri, Hanene; Sghaier, Haitham; Barkallah, Insaf; Ben Salem, Issam; Wafa; Essouiss, Imen; Saied, Nadia; Saidi, M.; Gatri, Faten; Gatri, Maher; Boadabous, Abdellatifs; Leys, Natalie
2009-01-01
Deinococcus radiodurans R1 is a poly-extremophile for which a system of genetic transformation and manipulation has been developed and it is being engineered for in situ bioremediation of wastes particularly for cleanup of radioactive waste sites. In this study, additional attempts have been made to evaluate ''bioremediation determinants'' in the genome of D. radiodurans using a comparative-genomic approach with Cupriavidus metallidurans CH34, a multiple metal resistant bacterium. This resulted in the delineation of a set of ORFs that are common or peculiar to C. metallidurans and D. radiodurans. We identified 12 ORFs related to multidrug resistance efflux pumps as a special feature of C. metallidurans compared to D. radiodurans, which is the subject of further experimental work
134Cs in heather seed plants grown with and without mycorrhiza
International Nuclear Information System (INIS)
Strandberg, M.; Johansson, M.
1988-01-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of 134 Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of 134 Cs to the shoots than heather without mycorrhiza. As an average the concentration of 134 Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of 134 Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of 134 Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
19 CFR 134.43 - Methods of marking specific articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of the...
13 CFR 134.713 - When is the record closed?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When is the record closed? 134.713 Section 134.713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women-Owned Small...
19 CFR 134.54 - Articles released from Customs custody.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles released from Customs custody. 134.54...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... value of the articles not properly marked or redelivered. (b) Failure to petition for relief. A written...
miR-134: A Human Cancer Suppressor?
Directory of Open Access Journals (Sweden)
Jing-Yu Pan
2017-03-01
Full Text Available MicroRNAs (miRNAs are small noncoding RNAs approximately 20–25 nt in length, which play crucial roles through directly binding to corresponding 3′ UTR of targeted mRNAs. It has been reported that miRNAs are involved in numerous of diseases, including cancers. Recently, miR-134 has been identified to dysregulate in handles of human cancers, such as lung cancer, glioma, breast cancer, colorectal cancer, and so on. Increasing evidence indicates that miR-134 is essential for human carcinoma and participates in tumor cell proliferation, apoptosis, invasion and metastasis, drug resistance, as well as cancer diagnosis, treatment, and prognosis. Nevertheless, its roles in human cancer are still ambiguous, and its mechanisms are sophisticated as well, referring to a variety of targets and signal pathways, such as STAT5B, KRAS, MAPK/ERK signal pathway, Notch pathway, etc. Herein, we review the crucial roles of miR-134 in scores of human cancers via analyzing latest investigations, which might provide evidence for cancer diagnose, treatment, prognosis, or further investigations.
{sup 134}Cs emission probabilities determination by gamma spectrometry
Energy Technology Data Exchange (ETDEWEB)
Almeida, M.C.M. de, E-mail: candida@cnen.gov.br [Comissão Nacional de Energia Nuclear (DINOR/CNEN), Riode Janeiro, RJ (Brazil); Poledna, R.; Delgado, J.U.; Silva, R.L.; Araujo, M.T.; Silva, C.J. da [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2017-07-01
The National Laboratory for Ionizing Radiation Metrology (LNMRI/IRD/CNEN) of Rio de Janeiro performed primary and secondary standardization of different radionuclides reaching satisfactory uncertainties. A solution of {sup 134}Cs radionuclide was purchased from commercial supplier to emission probabilities determination of some of its energies. {sup 134}Cs is a beta gamma emitter with 754 days of half-life. This radionuclide is used as standard in environmental, water and food control. It is also important to germanium detector calibration.The gamma emission probabilities (Pγ) were determined mainly for some energies of the {sup 134}Cs by efficiency curve method and the Pγ absolute uncertainties obtained were below 1% (k=1). (author)
Ha, Ji-Eun; Yang, Seung-Ju; Gong, Young-Dae
2018-02-12
An efficient solid-phase synthetic route for the construction of 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries based on branching diversity-oriented synthesis (DOS) has been developed in this study. The core skeleton resins, 1,3,4-oxadiazole and 1,3,4-thiadiazole, were obtained through desulfurative and dehydrative cyclizations of thiosemicarbazide resin, respectively. Various functional groups have been introduced to the core skeleton resins, such as aryl, amine, amide, urea, thiourea, and an amino acid. Most of the libraries were purified by simple trituration without extraction or column chromatography after cleavage of the products from the solid-supported resin. As a result, we obtained high yields of pure 1,3,4-oxadiazole and 1,3,4-thiadiazole derivatives (total numbers = 128). Finally, we confirmed the drug-like properties of our library by calculation of physicochemical properties, displays of the skeletal diversities of the library in 3D-space, and occupation of a broad range of areas by their functional groups.
24 CFR 17.134 - Procedures for salary offset: when deductions may begin.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for salary offset: when deductions may begin. 17.134 Section 17.134 Housing and Urban Development Office of the Secretary, Department... Government Salary Offset Provisions § 17.134 Procedures for salary offset: when deductions may begin. (a...
Rate constants for the reactions of OH with HFC-134a (CF3CH2F) and HFC-134 (CHF2CHF2)
Demore, W. B.
1993-01-01
Measurements of rate constants for HFC-134 (CF2HCF2H) relative to CH3CCl3, HFC-125, and HFC-134a are reported. The measurements were made in a slow-flow, temperature controlled photochemical reactor, and were based on relative rates of disappearance of the parent compounds as measured by FTIR spectroscopy. Hydroxyl radicals were generated by 254-nm photolysis of O3 in the presence of water vapor. NASA/JPL rate constants for the reference compounds are used to derive temperature-dependent rate constants of both compounds. Rate constants obtained from the different reference compounds are in excellent agreement. The presently recommended rate constant for HFC-134a is about 25 percent too high.
13 CFR 134.405 - Jurisdiction.
2010-01-01
... Jurisdiction. (a) The Administrative Law Judge selected to preside over an appeal shall decline to accept... disadvantage, economic disadvantage, ownership or control; (2) The appeal is untimely filed under § 134.202 or... before a court of competent jurisdiction over such matters. (b) Once the Administrative Law Judge accepts...
13 CFR 134.407 - Evidence beyond the record and discovery.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record nor...
2010-01-01
... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...
32 CFR 13.4 - Duties and responsibilities of the defense.
2010-07-01
... COMMISSIONS RESPONSIBILITIES OF THE CHIEF DEFENSE COUNSEL, DETAILED DEFENSE COUNSEL, AND CIVILIAN DEFENSE COUNSEL § 13.4 Duties and responsibilities of the defense. (a) Regular duties. The Defense shall perform... 32 National Defense 1 2010-07-01 2010-07-01 false Duties and responsibilities of the defense. 13.4...
27 CFR 17.134 - Determination of unfitness for beverage purposes.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Determination of unfitness for beverage purposes. 17.134 Section 17.134 Alcohol, Tobacco Products and Firearms ALCOHOL AND... an alcoholic concentration of 15% and tasted. Sale or use for beverage purposes is indicative of...
Energy Technology Data Exchange (ETDEWEB)
Giuliani, G.; Marchesi Donati, F.; Polonara, F. [Ancona Univ. (Italy). Dip. di Energetica; Hewitt, N.J. [University of Ulster at Coleraine, Northern Ireland (United Kingdom). NICERT
1999-09-01
The ability of zeotropic mixtures with a remarkable temperature glide to operate in liquid-recirculation systems is investigated and the results of an experimental comparison between the performances of the pure fluid R134a and the zeotropic mixture R32/134a (25/75% by mass) are presented. R134a performs slightly better in the liquid-recirculation mode than in the traditional dry-expansion mode; on the other hand, liquid-recirculation configuration has a detrimental effect on the zeotropic mixture's performance. The reason for this detrimental effect is the mixture component separation which occurs at the liquid/vapor separator. The effect of this separation is investigated using gas chromatograph analysis.
13 CFR 134.708 - What is the standard of review?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is the standard of review? 134.708 Section 134.708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.715 - Can a Judge reconsider his decision?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can a Judge reconsider his decision? 134.715 Section 134.715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF....715 Can a Judge reconsider his decision? (a) The Judge may reconsider an appeal decision within 20...
{sup 134}Cs in heather seed plants grown with and without mycorrhiza
Energy Technology Data Exchange (ETDEWEB)
Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)
1988-08-01
Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)
Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea
International Nuclear Information System (INIS)
Zhu Cong; Guo Jiangfeng
2008-01-01
Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)
[A case of ventilator-associated pneumonia caused by Cupriavidus pauculus].
Taşbakan, Mehmet Sezai; Yamazhan, Tansu; Aydemir, Söhret; Bacakoğlu, Feza
2010-01-01
Cupriavidus pauculus (formerly CDC Group IVc-2) is a non-fermentative, motile, gram-negative bacillus, rarely associated with human infections. It has been isolated from water, water from ultrafiltration systems and bottled mineral water. To date, 19 cases of bacteremia, two cases of peritonitis and one case of tenosynovitis associated with C. pauculus have been reported in English literature. In this paper, we report the first case of C. pauculus ventilator-associated pneumonia (VAP) in Turkey. A 47 years-old female with breast cancer was performed total mastectomy six years ago and received six cures of chemotherapy after surgery. The patient was hospitalized in medical oncology clinic with complaints of weight loss, nausea and vomiting for one year. Since she had problems of consiousness, dysphagia and pitosis, lumbar puncture was performed to rule out central nervous system infection or metastasis. Cryptococcal meningitis was diagnosed upon the examination of Indian-ink stained smear of cerebrospinal fluid and amphotericin B was initiated. On the 11th day of her follow up, she developed respiratory distress and was transferred to pulmonary intensive care and underwent invasive mechanical ventilator (IMV) therapy. On the 4th day of IMV; a new infiltration was detected on the upper zone of chest X-ray in addition to fever (38.3 degrees C) and intense endotracheal secretion. Therefore, bronchoscopic examination was performed and bronchoalveolar lavage and bronchoscope aspiration materials were obtained and cultivated. Bacteria grown at blood agar and EMB agar after 48 hours of incubation were stained as gram-negative bacilli and identified as C. pauculus by VITEK 2 compact system (bioMérieux Inc, USA). The strain was susceptible to ceftazidime, ciprofloxacin, imipenem, trimethoprim-sulfamethoxazole, piperacilin/tazobactam and resistant to amikacin. The case was considered as C. pauculus VAP and imipenem (500 mg, 4 x 1) for 14 days was initiated. Clinical and
Activity standardization of 134Cs and 137Cs
International Nuclear Information System (INIS)
Sochorová, Jana; Auerbach, Pavel
2014-01-01
The paper presents the results from a primary standardization of 137 Cs using two independent methods – efficiency tracing using PC-NaI coincidence and the TDCR method. The nuclides 60 Co and 134 Cs were used as the tracers. Primary standardization of the 134 Cs is also discussed. The efficiency extrapolation was carried out by measuring samples of varying mass and using the wet extrapolation method. The results obtained are in good agreement; the differences did not exceed 0.5%. The advantages, pitfalls and also possibilities for improvement of the procedures are discussed
Plant uptake of 134Cs in relation to soil properties and time
International Nuclear Information System (INIS)
Massas, I.; Skarlou, V.; Haidouti, C.
2002-01-01
134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants
Preservation of renal blood flow by the antioxidant EUK-134 in LPS-treated pigs.
Magder, Sheldon; Parthenis, Dimitrios G; Ghouleh, Imad Al
2015-03-25
Sepsis is associated with an increase in reactive oxygen species (ROS), however, the precise role of ROS in the septic process remains unknown. We hypothesized that treatment with EUK-134 (manganese-3-methoxy N,N'-bis(salicyclidene)ethylene-diamine chloride), a compound with superoxide dismutase and catalase activity, attenuates the vascular manifestations of sepsis in vivo. Pigs were instrumented to measure cardiac output and blood flow in renal, superior mesenteric and femoral arteries, and portal vein. Animals were treated with saline (control), lipopolysaccharide (LPS; 10 µg·kg-1·h-1), EUK-134, or EUK-134 plus LPS. Results show that an LPS-induced increase in pulmonary artery pressure (PAP) as well as a trend towards lower blood pressure (BP) were both attenuated by EUK-134. Renal blood flow decreased with LPS whereas superior mesenteric, portal and femoral flows did not change. Importantly, EUK-134 decreased the LPS-induced fall in renal blood flow and this was associated with a corresponding decrease in LPS-induced protein nitrotyrosinylation in the kidney. PO2, pH, base excess and systemic vascular resistance fell with LPS and were unaltered by EUK-134. EUK-134 also had no effect on LPS-associated increase in CO. Interestingly, EUK-134 alone resulted in higher CO, BP, PAP, mean circulatory filling pressure, and portal flow than controls. Taken together, these data support a protective role for EUK-134 in the renal circulation in sepsis.
42 CFR 410.134 - Provider qualifications.
2010-10-01
... after December 22, 2000: (a) Holds a bachelor's or higher degree granted by a regionally accredited college or university in the United States (or an equivalent foreign degree) with completion of the... PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider...
19 CFR 122.134 - When airline does not have in-bond liquor storeroom.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor storeroom. 122.134 Section 122.134 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline does not have in-bond liquor storeroom. (a...
International Nuclear Information System (INIS)
Gabrielsen, Mads; Rey-Burusco, M. Florencia; Griffiths, Kate; Roe, Andrew J.; Cooper, Alan; Smith, Brian O.; Kennedy, Malcolm W.; Corsico, Betina
2012-01-01
Na-FAR-1, a fatty acid- and retinol-binding protein, was expressed in bacteria, purified and crystallized. Crystals grew in two different morphologies under the same conditions. Na-FAR-1 is an unusual α-helix-rich fatty acid- and retinol-binding protein from Necator americanus, a blood-feeding intestinal parasitic nematode of humans. It belongs to the FAR protein family, which is unique to nematodes; no structural information is available to date for FAR proteins from parasites. Crystals were obtained with two different morphologies that corresponded to different space groups. Crystal form 1 exhibited space group P432 (unit-cell parameters a = b = c = 120.80 Å, α = β = γ = 90°) and diffracted to 2.5 Å resolution, whereas crystal form 2 exhibited space group F23 (unit-cell parameters a = b = c = 240.38 Å, α = β = γ = 90°) and diffracted to 3.2 Å resolution. Crystal form 2 showed signs of significant twinning
The accumulation of 134Cs in heart and skeletal muscle of healthy and dystrophic hamsters
International Nuclear Information System (INIS)
Szentkuti, L.; Breitrueck, H.; Giese, W.
1976-01-01
he accumulation of cesium-134 in heart and skeletal muscle of healthy and dystrophic hamsters was compared. It was lower in dystrophic hamsters than in normal ones after only a single dose of cesium-134. The 134 Cs-concentrations of heart and 'red' skeletal muscle were different between normal and dystrophic hamsters. When the isotope had equilibrated in the animals differences in 134 Cs-accumulation in muscle tissue between normal and dystrophic hamsters were even more obvious. The faster elimination of cesium-134 from the body as affected by muscular dystrophy was due to a reduction of 134 Cs-accumulation in muscle tissue. The reduced ability of damaged muscles to accumulate Cs-ions offers the possibility to use Cs-isotopes in diagnosis of skeletal muscle dystrophy. (author)
Neelamegam, Annamalai; Al-Battashi, Huda; Al-Bahry, Saif; Nallusamy, Sivakumar
2018-01-10
Waste paper, a major fraction of municipal solid waste, has a potential to serve as renewable feedstock for the biorefineries of fuels, chemicals and materials due to rich in cellulose and abundant at low cost. This study evaluates the possibility of waste office paper (WOP) to serve as a potential feedstock for the biorefinery production of poly (3-hydroxybutyrate). In this study, the WOP was pretreated, enzymatically saccharified and the hydrolysate was used for PHB production. The hydrolysate mainly consists of glucose (22.70g/L) and xylose (1.78g/L) and the corresponding sugar yield was about 816mg/g. Ammonium sulphate and C/N ratio 20 were identified as most favorable for high yield of PHB. The batch fermentation of Cupriavidus necator using the pretreated WOP hydrolysate resulted in cell biomass, PHB production and PHB content of 7.74g/L, 4.45g/L and 57.52%, respectively. The volumetric productivity and yield achieved were 0.061g/L/h and 0.210g/g sugar, respectively. The results suggested that WOP could be a potential alternative feedstock for the biorefinery production of bioplastics. Copyright © 2017 Elsevier B.V. All rights reserved.
Cloning and Expression of the PHA Synthase Gene From a Locally Isolated Chromobacterium sp. USM2
Directory of Open Access Journals (Sweden)
Bhubalan, K.
2010-01-01
Full Text Available Chromobacterium sp. USM2, a locally isolated bacterium was found to synthesize poly(3-hydroxybutyrate-co-3-hydroxyvalerate, P(3HB-co-3HV copolymer with high 3HV monomer composition. The PHA synthase gene was cloned and expressed in Cupriavidus necator PHB¯4 to investigate the possibilities of incorporating other monomer. The recombinant successfully incorporated 3-hydroxyhexanoate (3HHx monomer when fed with crude palm kernel oil (CPKO as the sole carbon source. Approximately 63 ± 2 wt% of P(3HB-co-3HHx copolymer with 4 mol% of 3HHx was synthesized from 5 g/L of oil after 48 h of cultivation. In addition, P(3HB-co-3HV-co-3HHx terpolymer with 9 mol% 3HV and 4 mol% 3HHx could be synthesized with a mixture of CPKO and sodium valerate. The presence of 3HV and 3HHx monomers in the copolymer and terpolymer was further confirmed with +H-NMR analysis. This locally isolated PHA synthase has demonstrated its ability to synthesize P(3HB-co-3HHx copolymer from a readily available and renewable carbon source; CPKO, without the addition of 3HHx precursors.
Energy Technology Data Exchange (ETDEWEB)
Wang, W.; Mittal, A.; Mohagheghi, A.; Johnson, D. K.
2014-04-01
PHAs are synthesized by many microorganisms to serve as intracellular carbon storage molecules. In some bacterial strains, PHB can account for up to 80% of cell mass. In addition to its application in the packaging sector, PHB also has great potential as an intermediate in the production of hydrocarbon fuels. PHB can be thermally depolymerized and decarboxylated to propene which can be upgraded to hydrocarbon fuels via commercial oligomerization technologies. Cupriavidus necator is the microorganism that has been most extensively studied and used for PHB production on an industrial scale; However the substrates used for producing PHB are mainly fructose, glucose, sucrose, fatty acids, glycerol, etc., which are expensive. In this study, we demonstrate production of PHB from a process relevant lignocellulosic derived sugar stream, i.e., saccharified slurry from pretreated corn stover. The strain was first investigated in shake flasks for its ability to utilize glucose, xylose and acetate. In addition, the strain was also grown on pretreated lignocellulose hydrolyzate slurry and evaluated in terms of cell growth, sugar utilization, PHB accumulation, etc. The mechanism of inhibition in the toxic hydrolysate generated by the pretreatment and saccharification process of biomass, was also studied.
Shamim, Saba; Rehman, Abdul; Qazi, Mahmood Hussain
2014-04-01
To use of microorganisms for bioremediation purposes, the study of their motility behavior toward metals is essential. In the present study, Cupriavidus metallidurans CH34 and Pseudomonas putida mt2 were used as cadmium (Cd)-resistant and -sensitive bacteria, respectively, to evaluate the effects of Cd on their motility behaviors. Potassium morpholinopropane sulfonate (MOPS) buffer was used to observe the motility behavior of both isolates. Movement of mt2 was less in MOPS buffer compared with CH34, likely reflecting the mono-flagellated nature of mt2 and the peritrichous nature of CH34. The swimming, swarming, twitching, and chemotaxis behaviors of mt2 were greater in the presence of glucose than that of Cd. mt2 exhibited negative motility behaviors when exposed to Cd, but the opposite effect was seen in CH34. Cd was found to be a chemorepellent for mt2 but a chemoattractant for CH34, suggesting that CH34 is a potential candidate for metal (Cd) bioremediation.
10 CFR 60.134 - Design of seals for shafts and boreholes.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals shall...
13 CFR 134.712 - What are the limitations on new evidence?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the limitations on new evidence? 134.712 Section 134.712 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.709 - When will a Judge dismiss an appeal?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When will a Judge dismiss an appeal? 134.709 Section 134.709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
13 CFR 134.706 - What are the service and filing requirements?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the service and filing requirements? 134.706 Section 134.706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Appeals From Women...
Directory of Open Access Journals (Sweden)
Jiahang Sun
2017-09-01
Full Text Available Background: MiR-134 is enriched in dendrites of hippocampal neurons and plays crucial roles in the progress of epilepsy. The present study aims to investigate the effects of antagomirs targeting miroRNA-134 (Ant-134 on limk1 expression and the binding of miR-134 and limk1 in experimental seizure. Methods: Status epilepticus (SE rat model was established by lithium chloride-pilocarpine injection and was treated with Ant-134 by intracerebroventricular injection. Low Mg2+-exposed primary neurons were used as an in vitro model of SE. The expression of miR-134 was determined using real-time PCR. Protein expressions of limk1 and cofilin were determined by Western blotting. Luciferase reporter assay was used to examine the binding between miR-134 and limk1 3’-untranslated region. Results: The expression of miR-134 was markedly enhanced in hippocampus of the SE rats and low Mg2+-exposed neurons. Ant-134 increased the expression of limk1 and reduced the expression of cofilin in the SE hippocampus and Low Mg2+-exposed neurons. In addition, luciferase reporter assay confirmed that miR-134 bound limk1 3’-UTR. MiR-134 overexpression inhibited limk1 mRNA and protein expressions in neurons. Conclusion: Blockage of miR-134 upregulates limk1 expression and downregulated cofilin expression in hippocampus of the SE rats. This mechanism may contribute to the neuroprotective effects of Ant-134.
Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system
International Nuclear Information System (INIS)
Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari
2012-01-01
Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.
Sulfur Bridged Multidentate Ligands Based on (Bipyridyl-(Bi-1,3,4-Thiadiazolyl Conjugates
Directory of Open Access Journals (Sweden)
M. Teresa Clasadonte
2003-03-01
Full Text Available The synthesis of a series of mixed (bipyridyl/(bi1,3,4-thiadiazolyl ligands, derived from the condensation of 2-mercapto-5-methylthio-1,3,4-thiadiazole or 5-mercapto-5'-methylthio-2,2'-bi-1,3,4-thiadiazole with 2,6-bis(chloromethylpyridine or 6,6’-bis(chloromethyl-2,2’-bipyridine (compounds L1–L4, and of 2,5-dimercapto-1,3,4-thiadiazole or 5,5'-dimercapto-2,2'-di-1,3,4-thiadiazole with picolyl chloride hydrochloride or 6-chloromethyl-6'-methyl-2,2'-bipyridine (compounds L5–L8 in the presence of triethylamine is described. All new compounds have been characterized by FAB (+ spectrometry and NMR spectroscopy. 13C-NMR spectra are crucial to firmly establish the thiol structure of the title ligands.
Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134.
Kaneko, Mika K; Yamada, Shinji; Itai, Shunsuke; Chang, Yao-Wen; Nakamura, Takuro; Yanaka, Miyuki; Kato, Yukinari
2018-07-01
The epidermal growth factor receptor (EGFR) is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb), which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7%) to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA), flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375-394 amino acids of EGFR) neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377- RGDSFTHTPP -386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
Transfer factors of 134Cs for olive and orange trees grown on different soils
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.; Papanicolaou, E.
1999-01-01
Transfer factors (TF) of 134 Cs to olive and citrus trees grown on two different soils, were determined for a 3-year greenhouse experiment. Two-year-old trees were transplanted with their entire rootball into large pots containing the contaminated soil (110 kg pot -1 ). The soil was transferred to each pot in layers on the top of which 134 Cs as CsCl was dripped (18.5 MBq pot -1 ). For both evergreen trees, soil type significantly influenced radiocaesium transfer. 134 Cs concentration was lower for the calcareous-heavy soil than for the acid-light soil. Transfer factors of orange trees were higher than those of olive trees in the acid-light soil. Although a significant amount of 134 Cs was measured in olives grown on the acid-light soil, no 134 Cs was detected in the unprocessed olive oil when an oil fraction (5% f.w.) was extracted. On the contrary the edible part of the oranges showed the highest 134 Cs concentration of all plant parts. The relationship between 134 Cs uptake and potassium content in the different plant compartments was also studied when selected trees were cut down. The potassium concentration in the plants was not significantly different between the trees growing in the two types of soil in spite of the big differences in the 134 Cs uptake in the two soils. TF values and potassium content in the different plant compartments of each tree were highly correlated. For both crops transfer factors as well as potassium content were the highest in the developing plant parts (new leaves and branches, flowers). The transfer factors of 134 Cs for the studied trees are in the same order of magnitude as the values of annual crops grown under similar conditions. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
Adsorbate shape selectivity: Separation of the HF/134a azeotrope over carbogenic molecular sieve
Energy Technology Data Exchange (ETDEWEB)
Hong, A.; Mariwala, R.K.; Kane, M.S.; Foley, H.C. [Univ. of Delaware, Nework, DE (United States)
1995-03-01
Experimental evidence is provided for adsorptive shape selectivity in the separation of the azeotrope between HF and 1,1,1,2-tetrafluoroethane (134a) over pyrolyzed poly(furfuryl alcohol)-derived carbogenic molecular sieve (PPFA-CMS). The separation can be accomplished over coconut charcoal or Carbosieve G on the basis of the differences in the extent of equilibrium adsorption of HF and 134a. On these adsorbents 134a is more strongly bound than HF, thus it elutes much more slowly from the bed. The heat of adsorption for 134a in the vicinity of 200 C on Carbosieve G is {approximately}8.8 kcal/mol. In contrast, when the same azeotropic mixture is separated over PPFA-CMS prepared at 500 C, 134a is not adsorbed. As a result 134a elutes from the bed first, followed by HF. The reversal is brought about by the narrower pore size and pore size distribution of the PPFA-CMS versus that for Carbosieve G. Thus the separation over PPFA-CMS is an example of adsorbate shape selectivity and represents a limiting case of kinetic separation.
Directory of Open Access Journals (Sweden)
Om-Murugan Janarthanan
2011-01-01
Full Text Available Polyhydroxyalkanoate (PHA is a biodegradable material with many potential biomedical applications, including medical implants and drug delivery. This study developed a system for screening production strains in order to optimize PHA production in Cupriavidus taiwanensis 184, 185, 186, 187, 204, 208, 209 and Pseudomona oleovorans ATCC 29347. In this study, Sudan black B staining, Infrared (IR and Gas Chromatography (GC analysis indicated that the best strain for PHA synthesis is C. taiwanensis 184, which obtains polyhydroxybutyrate (PHB. Cultivation of C. taiwanensis 184 under a pH of 7.0, at 30 °C, and at an agitation rate of 200 rpm, obtained a PHB content of 10% and PHB production of 0.14 g/L. The carbon and nitrogen types selected for analysis of PHB production by C. taiwanensis 184 were gluconic acid and NH4Cl, respectively. Optimal carbon/nitrogen ratio for PHB production was also determined. This study demonstrated a PHB content of 58.81% and a PHB production of 2.44 g/L when the carbon/nitrogen ratio of 8/1 was selected for C. taiwanensis 184. A two‑stage fermentation strategy significantly enhanced PHB content and PHB production. Under a two-stage fermentation strategy with nutrient‑limited conditions, C. taiwanensis 184 obtained a PHB content of 72% and a PHB concentration of 7 g/L. Finally, experimental results confirmed that optimizing the growth medium and fermentation conditions for cultivating the indigenous C. taiwanensis 184 strain substantially elevated PHB content from 10% to 72% and PHB production from 0.14 g/L to 7 g/L, respectively.
Stage dependent expression and tumor suppressive function of FAM134B (JK1) in colon cancer.
Islam, Farhadul; Gopalan, Vinod; Wahab, Riajul; Smith, Robert A; Qiao, Bin; Lam, Alfred King-Yin
2017-01-01
The aims of the present study are to investigate sub-cellular location, differential expression in different cancer stages and functional role of FAM134B in colon cancer development. FAM134B expression was studied and quantified at protein and mRNA levels in cell lines using immunocytochemistry, Western blot and real-time PCR. In vitro functional assays and an in vivo xenotransplantation mouse models were used to investigate the molecular role of FAM134B in cancer cell biology in response to FAM134B silencing with shRNA lentiviral particles. FAM134B protein was noted in both cytoplasm and nuclei of cancer cells. In cancer cells derived from stage IV colon cancer, FAM134B expression was remarkably reduced when compared to non-cancer colon cells and cancer cells derived from stage II colon cancer. FAM134B knockdown significantly (P colon cancer cells following lentiviral transfection. Furthermore, FAM134B suppression significantly increased (34-52%; P cancer suppressor gene in colon cancer. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
[Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].
Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei
2017-05-01
Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.
Elucidation of the critical epitope of an anti-EGFR monoclonal antibody EMab-134
Directory of Open Access Journals (Sweden)
Mika K. Kaneko
2018-07-01
Full Text Available The epidermal growth factor receptor (EGFR is a type-1 transmembrane receptor tyrosine kinase, which activates the downstream signaling cascades in many tumors, such as oral and lung cancers. We previously developed EMab-134, a novel anti-EGFR monoclonal antibody (mAb, which reacts with endogenous EGFR-expressing cancer cell lines and normal cells independent of glycosylation in Western blotting, flow cytometry, and immunohistochemical analysis. EMab-134 showed very high sensitivity (94.7% to oral squamous cell carcinomas in immunohistochemical analysis. In this study, we performed enzyme-linked immunosorbent assay (ELISA, flow cytometry, and immunohistochemical analysis to determine the epitope of EMab-134. A blocking peptide (375–394 amino acids of EGFR neutralized the EMab-134 reaction against oral cancer cells in flow cytometry and immunohistochemistry. The minimum epitope of EMab-134 was found to be the 377-RGDSFTHTPP−386 sequence. Our findings can be applied for the production of more functional anti-EGFR mAbs that in turn can be used for antitumor treatments.
Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134
International Nuclear Information System (INIS)
Ballestra, S.; Gastaud, J.; Lopez, J.J.; Parsi, P.; Vas, D.
1993-08-01
The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40 K, 60 Co, 137 Cs, and 2 39+240 Pu (Reference date: 1 January 1992). Information values for 90 Sr, 106 Ru, 125 Sb, 134 Cs, 154 Eu, 155 Eu, 210 Pb, 210 Po, 226 Ra, 228 Ra, 228 Th, 230 Th, 232 Th, 234 U, 235 U, 238 U, 238 Pu and 241 Am are also reported. All the following values are expressed in Bq kg -1 (dry weight). (author)
13 CFR 134.711 - Will the Judge permit discovery and oral hearings?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Will the Judge permit discovery and oral hearings? 134.711 Section 134.711 Business Credit and Assistance SMALL BUSINESS...
13 CFR 134.705 - What are the requirements for an appeal petition?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
Structure of a two-CAP-domain protein from the human hookworm parasite Necator americanus
Energy Technology Data Exchange (ETDEWEB)
Asojo, Oluwatoyin A., E-mail: oasojo@unmc.edu [Pathology and Microbiology Department, 986495 Nebraska Medical Center, Omaha, NE 68198-6495 (United States)
2011-05-01
The first structure of a two-CAP-domain protein, Na-ASP-1, from the major human hookworm parasite N. americanus refined to a resolution limit of 2.2 Å is presented. Major proteins secreted by the infective larval stage hookworms upon host entry include Ancylostoma secreted proteins (ASPs), which are characterized by one or two CAP (cysteine-rich secretory protein/antigen 5/pathogenesis related-1) domains. The CAP domain has been reported in diverse phylogenetically unrelated proteins, but has no confirmed function. The first structure of a two-CAP-domain protein, Na-ASP-1, from the major human hookworm parasite Necator americanus was refined to a resolution limit of 2.2 Å. The structure was solved by molecular replacement (MR) using Na-ASP-2, a one-CAP-domain ASP, as the search model. The correct MR solution could only be obtained by truncating the polyalanine model of Na-ASP-2 and removing several loops. The structure reveals two CAP domains linked by an extended loop. Overall, the carboxyl-terminal CAP domain is more similar to Na-ASP-2 than to the amino-terminal CAP domain. A large central cavity extends from the amino-terminal CAP domain to the carboxyl-terminal CAP domain, encompassing the putative CAP-binding cavity. The putative CAP-binding cavity is a characteristic cavity in the carboxyl-terminal CAP domain that contains a His and Glu pair. These residues are conserved in all single-CAP-domain proteins, but are absent in the amino-terminal CAP domain. The conserved His residues are oriented such that they appear to be capable of directly coordinating a zinc ion as observed for CAP proteins from reptile venoms. This first structure of a two-CAP-domain ASP can serve as a template for homology modeling of other two-CAP-domain proteins.
Structure of a two-CAP-domain protein from the human hookworm parasite Necator americanus
International Nuclear Information System (INIS)
Asojo, Oluwatoyin A.
2011-01-01
The first structure of a two-CAP-domain protein, Na-ASP-1, from the major human hookworm parasite N. americanus refined to a resolution limit of 2.2 Å is presented. Major proteins secreted by the infective larval stage hookworms upon host entry include Ancylostoma secreted proteins (ASPs), which are characterized by one or two CAP (cysteine-rich secretory protein/antigen 5/pathogenesis related-1) domains. The CAP domain has been reported in diverse phylogenetically unrelated proteins, but has no confirmed function. The first structure of a two-CAP-domain protein, Na-ASP-1, from the major human hookworm parasite Necator americanus was refined to a resolution limit of 2.2 Å. The structure was solved by molecular replacement (MR) using Na-ASP-2, a one-CAP-domain ASP, as the search model. The correct MR solution could only be obtained by truncating the polyalanine model of Na-ASP-2 and removing several loops. The structure reveals two CAP domains linked by an extended loop. Overall, the carboxyl-terminal CAP domain is more similar to Na-ASP-2 than to the amino-terminal CAP domain. A large central cavity extends from the amino-terminal CAP domain to the carboxyl-terminal CAP domain, encompassing the putative CAP-binding cavity. The putative CAP-binding cavity is a characteristic cavity in the carboxyl-terminal CAP domain that contains a His and Glu pair. These residues are conserved in all single-CAP-domain proteins, but are absent in the amino-terminal CAP domain. The conserved His residues are oriented such that they appear to be capable of directly coordinating a zinc ion as observed for CAP proteins from reptile venoms. This first structure of a two-CAP-domain ASP can serve as a template for homology modeling of other two-CAP-domain proteins
Heat transfer performance during condensation of R-134a inside helicoidal tubes
International Nuclear Information System (INIS)
Al-Hajeri, M.H.; Koluib, A.M.; Mosaad, M.; Al-Kulaib, S.
2007-01-01
This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m 2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant
'Wash-out' of Cs-134 and Cs-137 from river sediment; 'Ispiranja' Cs-134 i Cs-137 iz recnog sedimenta
Energy Technology Data Exchange (ETDEWEB)
Skrbic, Z; Conkic, Lj; Bikit, I; Veskovic, M; Slivka, J; Marinkov, L [Institut za Fiziku, Novi Sad Univ. (Yugoslavia)
1988-07-01
Natural elimination and 'wash out' period of the Cs-134 and Cs-137 from the river sediment has been investigated. Obtained results suggest the possibility to describe these processes by exponential low and determination of the corresponding half lives. (author)
Determination of Cs-134 and Cs-137 rain water samples
International Nuclear Information System (INIS)
Lima, M.F.; Mazzilli, B.
1988-01-01
In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH 4 + , K + and Rb + ) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author) [pt
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Winkler, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz
1993-12-31
In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called `Stagnationsindex`. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [Deutsch] Zur Klaerung der an verschiedenen Orten Europas in den Wintermonaten beobachteten Maxima der Cs-134/137-Aktivitaetskonzentrationen in der bodennahen Luft wurde von Oktober 1991 bis November 1992 ein Messgrogramm mit relativ kurzen Zeitintervallen fuer die Aerosolsammlung (48-72 Stunden) durchgefuehrt. Gleichzeitig wurden lokale meteorologische Parameter miterfasst. Die statistische Auswertung der Messergebnisse lieferte eine hochsignifikante positive Korrelation zwischen der Aktivitaetskonzentration von Cs-137 und dem sog. Stagnationsindex. Auf Grund dieses Zusammenhangs lassen sich die saisonalen Schwankungen der Cs-134/137-Luftkonzentrationen mit dem haeufigen Auftreten von austauscharmen Wetterlagen in den Herbst- und Wintermonaten erklaeren. (orig.)
Resolution of the uncertainties in the radiative forcing of HFC-134a
International Nuclear Information System (INIS)
Forster, Piers M. de F; Burkholder, J.B.; Clerbaux, C.; Coheur, P.F.; Dutta, M.; Gohar, L.K.; Hurley, M.D.; Myhre, G.; Portmann, R.W.; Shine, K.P.; Wallington, T.J.; Wuebbles, D.
2005-01-01
HFC-134a (CF 3 CH 2 F) is the most rapidly growing hydrofluorocarbon in terms of atmospheric abundance. It is currently used in a large number of household refrigerators and air-conditioning systems and its concentration in the atmosphere is forecast to increase substantially over the next 50-100 years. Previous estimates of its radiative forcing per unit concentration have differed significantly ∼25%. This paper uses a two-step approach to resolve this discrepancy. In the first step six independent absorption cross section datasets are analysed. We find that, for the integrated cross section in the spectral bands that contribute most to the radiative forcing, the differences between the various datasets are typically smaller than 5% and that the dependence on pressure and temperature is not significant. A 'recommended' HFC-134a infrared absorption spectrum was obtained based on the average band intensities of the strongest bands. In the second step, the 'recommended' HFC-134a spectrum was used in six different radiative transfer models to calculate the HFC-134a radiative forcing efficiency. The clear-sky instantaneous radiative forcing, using a single global and annual mean profile, differed by 8%, between the 6 models, and the latitudinally-resolved adjusted cloudy sky radiative forcing estimates differed by a similar amount. We calculate that the radiative forcing efficiency of HFC-134a is 0.16+/-0.02Wm -2 ppbv -1
Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134
Energy Technology Data Exchange (ETDEWEB)
Ballestra, S; Gastaud, J; Lopez, J J; Parsi, P; Vas, D
1993-08-01
The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for {sup 40}K, {sup 60}Co, {sup 137}Cs, and 2{sup 39+240}Pu (Reference date: 1 January 1992). Information values for {sup 90}Sr, {sup 106}Ru, {sup 125}Sb, {sup 134}Cs, {sup 154}Eu, {sup 155}Eu, {sup 210}Pb, {sup 210}Po, {sup 226}Ra, {sup 228}Ra, {sup 228}Th, {sup 230}Th, {sup 232}Th, {sup 234}U, {sup 235}U, {sup 238}U, {sup 238}Pu and {sup 241}Am are also reported. All the following values are expressed in Bq kg{sup -1} (dry weight). (author)
Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age
International Nuclear Information System (INIS)
Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.
2004-01-01
In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)
13 CFR 134.714 - When must the Judge issue his or her decision?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must the Judge issue his or her decision? 134.714 Section 134.714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...
Neutron Inelastic Scattering on 134Xe at En = 5 - 8 MeV
Kidd, Mary; Tornow, Werner; Finch, Sean; Krishichayan, Fnu; Bhike, Megha
2017-09-01
Neutrinoless double-beta decay (0 νββ) studies are both the best way to determine the Majorana nature of the neutrino and determine its effective mass. The two main experiments searching for 0 νββ -decay of 136Xe (Q value = 2457.8 keV) are Kamland-Zen and EXO-200. Though both experiments have enriched 136Xe targets, these targets still contain significant quantities of 134Xe. Recently, a new nuclear level was discovered in 134Xe that decays to the ground state emitting a 2485.7 keV gamma ray. The γ-ray production cross section for this branch was found to be on the order of 10 mb for incident neutron energies of 2.5-4.5 MeV. Here, we have extended the investigation of this level to higher incident neutron energies, and further explore the potential neutron-induced backgrounds on both 134Xe and 136Xe for extended neutron energies. We will report our preliminary results for neutron inelastic scattering on 134Xe in applications to 0 νββ decay searches. NSF PHY-1614348, DE-FG02-97ER41033.
Mohtar, M. N.; Nasution, H.; Aziz, A. A.
2015-12-01
The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a
43 CFR 13.4 - Terms of permit.
2010-10-01
... § 13.4 Terms of permit. Every permit shall describe the location of the vending facilities and shall be... Interior bureau or office for each location. The head of the Interior bureau or office may require... efficiency as may be prescribed by the head of the Interior bureau or office. Such standards shall conform...
Adsorption of *sp134*Cs onto two different types of roof materials
International Nuclear Information System (INIS)
Quenild, C.; Tveten, U.
1983-01-01
The report relates to a subproject under a Nordic project called ''Large reactor accidents - consequences and mitigating actions''. Natural decontamination of two types of roof material, typical of Norwegian and Swedish buildings, was examined. The roofs were contaminated with *sp134*Cs. After two days with 7 mm precipitation, the remaining activity on the tar-paper roof was 97% and on the steel roof 29%. After 8 months the remaining activity was 61% on the tar-paper roof and 22% on the steel roof. In spring *sp134*Cs was spread upon an 8 cm thick layer of fresh snow on an additional tar-paper roof. After 3 montsh and 191 mm precipitation the remaining activity was 59%. All results are based upon *sp134*Cs in collected run-off water.(Auth.)
Sumida, Yosuke; Iwai, Sachio; Nishiya, Yoshiaki; Kumagai, Shinya; Yamada, Toshihide; Azuma, Masayuki
2018-03-01
d-Amino acids are important building blocks for various compounds, such as pharmaceuticals and agrochemicals. A more cost-effective enzymatic method for d-amino acid production is needed in the industry. We improved a one-pot enzymatic method for d-amino acid production by the dynamic kinetic resolution of N-succinyl amino acids using two enzymes: d-succinylase (DSA) from Cupriavidus sp. P4-10-C, which hydrolyzes N-succinyl-d-amino acids enantioselectively to their corresponding d-amino acid, and N-succinyl amino acid racemase (NSAR, EC.4.2.1.113) from Geobacillus stearothermophilus NCA1503. In this study, DSA and NSAR were purified and their properties were investigated. The optimum temperature of DSA was 50°C and it was stable up to 55°C. The optimum pH of DSA and NSAR was around 7.5. In d-phenylalanine production, the optical purity of product was improved to 91.6% ee from the examination about enzyme concentration. Moreover, 100 mM N-succinyl-dl-tryptophan was converted to d-tryptophan at 81.8% yield with 94.7% ee. This enzymatic method could be useful for the industrial production of various d-amino acids. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Implementation of R134a Thermophysical Properties for MARS Application
Energy Technology Data Exchange (ETDEWEB)
Son, Gyu Min; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)
2016-05-15
MARS requires 3 files for analysis: executable MARS file, input, and thermodynamic property file (tpf) for target fluids like light water or heavy water. Most experiments and scenarios were interested in behavior of water so original tpfs were sufficient enough for analysis. As MARS application became wider, needs for other fluid properties rose since MARS do not have extra function to interpret foreign materials that does not have tpf. One way of solving this problem is to generate external tpf file and if successfully implemented, this methodology could widen the application of MARS to other fields of engineering. Thus, this study aims for tpf generation of R134a. The reasons for its selection is because R134a is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. Generation methods of tpf were discussed. Conventional tpfh2o utilized Gibbs function to calculate the properties. However, since that method could not be applied to other fluids, fitting equation with temperature and pressure variables were applied from R134a property database. Direct implementation of theses equations simplified the structure of main program.
Effect of red clay on diesel bioremediation and soil bacterial community.
Jung, Jaejoon; Choi, Sungjong; Hong, Hyerim; Sung, Jung-Suk; Park, Woojun
2014-08-01
Red clay is a type of soil, the red color of which results from the presence of iron oxide. It is considered an eco-friendly material, with many industrial, cosmetic, and architectural uses. A patented method was applied to red clay in order to change its chemical composition and mineral bioavailability. The resulting product was designated processed red clay. This study evaluates the novel use of red clay and processed red clay as biostimulation agents in diesel-contaminated soils. Diesel biodegradation was enhanced in the presence of red clay and processed red clay by 4.9- and 6.7-fold, respectively, and the number of culturable bacterial cells was correlated with the amount of diesel biodegradation. The growth of Acinetobacter oleivorans DR1, Pseudomonas putida KT2440, and Cupriavidus necator was promoted by both types of red clays. Culture-independent community analysis determined via barcoded pyrosequencing indicated that Nocardioidaceae, Xanthomonadaceae, Pseudomonadaceae, and Caulobacteraceae were enriched by diesel contamination. Bacterial strain isolation from naphthalene- and liquid paraffin-amended media was affiliated with enriched taxa based on 16S rRNA gene sequence identity. We suggest that the biostimulating mechanism of red clay and processed red clay is able to support bacterial growth without apparent selection for specific bacterial species.
Slaninova, Eva; Sedlacek, Petr; Mravec, Filip; Mullerova, Lucie; Samek, Ota; Koller, Martin; Hesko, Ondrej; Kucera, Dan; Marova, Ivana; Obruca, Stanislav
2018-02-01
Numerous prokaryotes accumulate polyhydroxyalkanoates (PHA) in the form of intracellular granules. The primary function of PHA is the storage of carbon and energy. Nevertheless, there are numerous reports that the presence of PHA granules in microbial cells enhances their stress resistance and fitness when exposed to various stress factors. In this work, we studied the protective mechanism of PHA granules against UV irradiation employing Cupriavidus necator as a model bacterial strain. The PHA-accumulating wild type strain showed substantially higher UV radiation resistance than the PHA non-accumulating mutant. Furthermore, the differences in UV-Vis radiation interactions with both cell types were studied using various spectroscopic approaches (turbidimetry, absorption spectroscopy, and nephelometry). Our results clearly demonstrate that intracellular PHA granules efficiently scatter UV radiation, which provides a substantial UV-protective effect for bacterial cells and, moreover, decreases the intracellular level of reactive oxygen species in UV-challenged cells. The protective properties of the PHA granules are enhanced by the fact that granules specifically bind to DNA, which in turn provides shield-like protection of DNA as the most UV-sensitive molecule. To conclude, the UV-protective action of PHA granules adds considerable value to their primary storage function, which can be beneficial in numerous environments.
Directory of Open Access Journals (Sweden)
Shihui Yang
2018-04-01
Full Text Available The aim of this work was to identify inhibitors in pretreated lignocellulosic slurries, evaluate high-throughput screening strategies, and investigate the impact of inhibitors on potential hydrocarbon-producing microorganisms. Compounds present in slurries that could inhibit microbial growth were identified through a detailed analysis of saccharified slurries by applying a combination of approaches of high-performance liquid chromatography, GC-MS, LC-DAD-MS, and ICP-MS. Several high-throughput assays were then evaluated to generate toxicity profiles. Our results demonstrated that Bioscreen C was useful for analyzing bacterial toxicity but not for yeast. AlamarBlue reduction assay can be a useful high-throughput assay for both bacterial and yeast strains as long as medium components do not interfere with fluorescence measurements. In addition, this work identified two major inhibitors (furfural and ammonium acetate for three potential hydrocarbon-producing bacterial species that include Escherichia coli, Cupriavidus necator, and Rhodococcus opacus PD630, which are also the primary inhibitors for ethanologens. This study was strived to establish a pipeline to quantify inhibitory compounds in biomass slurries and high-throughput approaches to investigate the effect of inhibitors on microbial biocatalysts, which can be applied for various biomass slurries or hydrolyzates generated through different pretreatment and enzymatic hydrolysis processes or different microbial candidates.
Energy Technology Data Exchange (ETDEWEB)
Wang, Wei; Mohagheghi, Ali; Mittal, Ashutosh; Pilath, Heidi; Johnson, David K.
2015-03-22
PHAs are synthesized by many microorganisms to serve as intracellular carbon storage molecules. In some bacterial strains, PHB can account for up to 80% of cell mass. In addition to its application in the packaging sector, PHB also has great potential as an intermediate in the production of hydrocarbon fuels. PHB can be thermally depolymerized and decarboxylated to propene which can be upgraded to hydrocarbon fuels via commercial oligomerization technologies. In recent years a great effort has been made in bacterial production of PHB, yet the production cost of the polymer is still much higher than conventional petrochemical plastics. The high cost of PHB is because the cost of the substrates can account for as much as half of the total product cost in large scale fermentation. Thus searching for cheaper and better substrates is very necessary for PHB production. In this study, we demonstrate production of PHB by Cupriavidus necator from a process relevant lignocellulosic derived sugar stream, i.e., saccharified hydrolysate slurry from pretreated corn stover. Good cell growth was observed on slurry saccharified with advanced enzymes and 40~60% of PHB was accumulated in the cells. The mechanism of inhibition in the toxic hydrolysate generated by pretreatment and saccharification of biomass, will be discussed.
Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)
International Nuclear Information System (INIS)
Norfaizal Mohamed; Nita Salina Abu Bakar; Zal Uyun Wan Mahmood; Nur Hidaya Dmuliany Mohd Sidek; Zaharudin Ahmad
2010-01-01
Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)
All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method
Energy Technology Data Exchange (ETDEWEB)
Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)
2014-12-15
We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.
40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.
2010-07-01
... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...
Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole
International Nuclear Information System (INIS)
Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.
2015-01-01
Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.
International Nuclear Information System (INIS)
Asojo, Oluwatoyin A.; Goud, Gaddam N.; Zhan, Bin; Ordonez, Katherine; Sedlacek, Meghan; Homma, Kohei; Deumic, Vehid; Gupta, Richi; Brelsford, Jill; Price, Merelyn K.; Ngamelue, Michelle N.; Hotez, Peter J.
2010-01-01
The purification, crystallization and preliminary X-ray diffraction analysis of a surface-associated antigen from the major human hookworm N. americanus is presented. Human hookworms are among the most pathogenic soil-transmitted helminths. These parasitic nematodes have co-evolved with the host and are able to maintain a high worm burden for decades without killing the human host. However, it is possible to develop vaccines against laboratory-challenge hookworm infections using either irradiated third-state infective larvae (L3) or enzymes from the adult parasites. In an effort to control hookworm infection globally, the Human Hookworm Vaccine Initiative, a product-development partnership with the Sabin Vaccine Institute to develop new control tools including vaccines, has identified a battery of protein antigens, including surface-associated antigens (SAAs) from L3. SAA proteins are characterized by a 13 kDa conserved domain of unknown function. SAA proteins are found on the surface of infective L3 stages (and some adult stages) of different nematode parasites, suggesting that they may play important roles in these organisms. The atomic structures and function of SAA proteins remain undetermined and in an effort to remedy this situation recombinant Na-SAA-2 from the most prevalent human hookworm parasite Necator americanus has been expressed, purified and crystallized. Useful X-ray data have been collected to 2.3 Å resolution from a crystal that belonged to the monoclinic space group C2 with unit-cell parameters a = 73.88, b = 35.58, c = 42.75 Å, β = 116.1°
Separation of 134Cs and 137Cs from 125I solution for medical applications
International Nuclear Information System (INIS)
Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy
2015-01-01
While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.
Experimental study of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator
International Nuclear Information System (INIS)
Wongwises, Somchai; Chimres, Nares
2005-01-01
This work presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in a domestic refrigerator. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). A refrigerator designed to work with HFC-134a with a gross capacity of 239 l is used in the experiment. The consumed energy, compressor power and refrigerant temperature and pressure at the inlet and outlet of the compressor are recorded and analysed as well as the distributions of temperature at various positions in the refrigerator. The refrigerant mixtures used are divided into three groups: the mixture of three hydrocarbons, the mixture of two hydrocarbons and the mixture of two hydrocarbons and HFC-134a. The experiments are conducted with the refrigerants under the same no load condition at a surrounding temperature of 25 deg. C. The results show that propane/butane 60%/40% is the most appropriate alternative refrigerant to HFC-134a
Meng, Fanjun; Li, Yan; Chi, Wenying; Li, Junfa
2016-07-01
Brain protection by narcotics such as morphine is clinically relevant due to the extensive use of narcotics in the perioperative period. Morphine preconditioning induces neuroprotection in neurons, but it remains uncertain whether microRNA-134 (miR-134) is involved in morphine preconditioning against oxygen-glucose deprivation-induced injuries in primary cortical neurons of mice. The present study examined this issue. After cortical neurons of mice were cultured in vitro for 6 days, the neurons were transfected by respective virus vector, such as lentiviral vector (LV)-miR-control-GFP, LV-pre-miR-134-GFP, LV-pre-miR-134-inhibitor-GFP for 24 hours; after being normally cultured for 3 days again, morphine preconditioning was performed by incubating the transfected primary neurons with morphine (3 μM) for 1 hour, and then neuronal cells were exposed to oxygen-glucose deprivation (OGD) for 1 hour and oxygen-glucose recovery for 12 hours. The neuronal cells survival rate and the amount of apoptotic neurons were determined by MTT assay or TUNEL staining at designated time; and the expression levels of miR-134 were detected using real-time reverse transcription polymerase chain reaction at the same time. The neuronal cell survival rate was significantly higher, and the amount of apoptotic neurons was significantly decreased in neurons preconditioned with morphine before OGD than that of OGD alone. The neuroprotection induced by morphine preconditioning was partially blocked by upregulating miR-134 expression, and was enhanced by downregulating miR-134 expression. The expression of miR-134 was significantly decreased in morphine-preconditioned neurons alone without transfection. By downregulating miR-134 expression, morphine preconditioning protects primary cortical neurons of mice against injuries induced by OGD.
Synthesis of novel 2,5-disubstituted-1,3,4-selenadiazoles from fatty acid hydrazides
Directory of Open Access Journals (Sweden)
Himani Varshney
2018-01-01
Full Text Available A series of novel unsaturated hydroxy and non-hydroxy fatty acid residue substituted 1,3,4-selenadiazoles were described here. These derivatives were synthesized from the reaction of fatty acid hydrazide 1(a–d with acetyl chloride in the presence of anhydrous sodium carbonate in tetrahydrofuran and water at 0 °C, to form N′-acetyl undec-10-enoic hydrazide 2a, N′-acetyl-(9Z-octadec-9-enoic hydrazide 2b, N′-acetyl-(9Z, 12R-12-hydroxy-9-enoic hydrazide 2c, and N′-acetyl-(9R, 12Z-9-hydroxy-12-enoic hydrazide 2d. Then these hydrazines (dicarbonyl compound on reaction with Woollin’s reagent (WR in toluene led to the corresponding 2-(dec-9′-enyl-5-methyl-1,3,4-selenadiazole 3a, 2-[(8′Z-heptadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3b, 2-[(8′Z, 11′R-11′-hydroxy-octadec-8′-enyl]-5-methyl-1,3,4-selenadiazole 3c, and 2-[(8′R, 11′Z-8′-hydroxy-octadec-11′-enyl]-5-methyl-1,3,4-selenadiazole 3d, respectively. These synthesized compounds were characterized on the basis of IR, 1H NMR, 13C NMR, mass spectra and elemental analysis results.
Dynamics of cesium-134 and biomass in treated and untreated turkey oak leaf-litter bags
International Nuclear Information System (INIS)
Croom, J.M.; Ragsdale, H.L.
1978-01-01
Litter bags were prepared from leaves harvested in late fall from turkey oak trees (Quercus laevis) tagged with 134 Cs. Untreated bags and bags treated by soaking in 1000 ppM HgCl 2 were placed in the field on Dec. 7, 1974. Five bags of each treatment were retrieved at 7-, 14-, and 30-day intervals as the experiment progressed. Treated bags remained free of visible fungal hyphae growth for 12 weeks. Untreated bags had lost more weight but less 134 Cs than treated bags after 14 and 56 days, respectively. After 9 months, untreated bags had lost 33% weight and 90% 134 Cs. Although 134 Cs is rapidly leached from litter (ecological half-life approximately equal to 12 weeks), some is retained by fungal hyphae on leaf-litter surfaces. This mechanism of mineral retention in the litter layer could represent adaptation at the ecosystem level for nutrient conservation
Neutron-induced Backgrounds in 134Xe for Large-Scale Neutrinoless Double-Beta Decay Experiments
Moriguchi, Nina; Kidd, Mary; Tornow, Werner
2016-09-01
136Xe is used in large neutrinoless double-beta (0 νββ) decay experiments, such as KamLAND- Zen and EXO 200. Though highly purified, 136Xe still contains a significant amount of 134Xe. Recently, a new nuclear energy level was found in 134Xe. If 134Xe decays from this proposed excited state, it will emit a 2485.7 keV gamma ray. Because this energy lies near the region of interest of 136Xe νββ decay experiments (Q value 2457.8 keV), it could make a significant contribution to the background. A purified gaseous sample of 134Xe will be irradiated with neutrons of an incident energy of 4.0 MeV at Triangle Universities Nuclear Laboratory and monitored with high-purity germanium detectors. The spectra obtained from these detectors will be analyzed for the presence of the 2581 keV gamma ray. We will report on the status of this experiment. Future plans include expanding this measurement to higher initial neutron energies. Tennesse Tech University CISE Grant program.
13 CFR 134.618 - How are awards paid?
2010-01-01
... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... of Financial Operations, SBA, P.O. Box 205, Denver, CO 80201-0205. SBA will pay you the amount awarded within 60 days of receipt of your request unless it is notified that you or another party has...
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)
1996-03-01
Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.
International Nuclear Information System (INIS)
Fatouh, M.; El Kafafy, M.
2006-01-01
The possibility of using hydrocarbon mixtures as working fluids to replace R134a in domestic refrigerators has been evaluated through a simulation analysis in the present work. The performance characteristics of domestic refrigerators were predicted over a wide range of evaporation temperatures (-35 to -10 o C) and condensation temperatures (40-60 deg. C) for various working fluids such as R134a, propane, commercial butane and propane/iso-butane/n-butane mixtures with various propane mass fractions. The performance characteristics of the considered domestic refrigerator were identified by the coefficient of performance (COP), volumetric cooling capacity, cooling capacity, condenser capacity, input power to compressor, discharge temperature, pressure ratio and refrigerant mass flow rate. The results showed that pure propane could not be used as a drop in replacement for R134a in domestic refrigerators because of its high operating pressures and low COP. Commercial butane yields many desirable characteristics but requires a compressor change. The coefficient of performance of the domestic refrigerator using a ternary hydrocarbon mixture with propane mass fractions from 0.5 to 0.7 is higher than that of R134a. Comparison among the considered working fluids confirmed that the average refrigerant mass flow rate of the propoane/commercial butane mixture is 50% lower than that of R134a. Also, the results indicated that R134a and the propoane/commercial butane mixture with 60% propane mass concentration have approximately the same values of saturation pressure, compressor discharge temperature, condenser heat load, input power, cooling capacity and volumetric cooling capacity. However, the pressure ratio of the hydrocarbon mixture with 60% propane is lower than that of R134a by about 11.1%. Finally, the reported results confirmed that the propane/iso-butane/n-butane mixture with 60% propane is the best drop in replacement for R134a in domestic refrigerators under normal
An experimental evaluation of the greenhouse effect in the substitution of R134a with CO2
International Nuclear Information System (INIS)
Aprea, C.; Greco, A.; Maiorino, A.
2012-01-01
This paper addresses the problem of R314a substitution with a natural refrigerant fluid. Attention is devoted to the evaluation of the environmental impact, in terms of greenhouse effect. R134a and R744 (CO 2 ) are compared to one another. The hydrofluorocarbon R134a has a large direct warming impact (GWP), whereas the R744 contribution is negligible. The greenhouse effect is determined by the experimental evaluation of the TEWI index (Total Equivalent Warming Impact) that takes into account both direct and indirect contributions to global warming. This paper compares a commercial R134a refrigeration plant and a prototype R744 system working in a trans-critical cycle. The experimental results clearly show that the latter has a larger TEWI than the system operating with R134a. The indirect contribution to global warming provided by R744 is always greater than that of R134a. This contribution prevails in most cases. Only few operating conditions corresponding to a refrigerating plant working as a classical split system benefits, in terms of greenhouse effect, of the substitution of R134a with R744. -- Highlights: ► A comparison between a classical vapour compression plant and a trans-critical cycle. ► Evaluation of the greenhouse effect in R134a substitution with R744. ► Evaluation of direct and indirect contribution to global warming. ► Minimization of the global warming impact of a R744 transcritical cycle.
Concentration of 134Cs and 137Cs in Malaysian palm products
International Nuclear Information System (INIS)
Yii Mei Wo; Nor Aza Hassan; Narizan Sanusi
2008-08-01
Until today, countries importing food products from Malaysia, in region such as Indian Continental, Middle East, Central Europe and Central America still require the products to be tested for the radioactive contamination particularly for 134 Cs and 137 Cs. Information extracted from 3371 analytical results observed on isotopic concentration for 134 Cs and 137 Cs in the exported Malaysia origins palm products between years 2002 until 2007 had been summarized and reported in this work. Data shown that the concentration level of the concerned radio nuclides are below the minimum detectable activity and also well below maximum permissible limits adopted by Malaysian Government and also the international bodies. (Author)
Directory of Open Access Journals (Sweden)
Hua Wang
Full Text Available Osteoporosis is a common disorder characterized by compromised bone strength that predisposes patients to increased fracture risk. Parathyroid hormone related protein (PTHrP is one of the candidates for clinical osteoporosis treatment. In this study, GST Gene Fusion System was used to express recombinant human PTHrP (hPTHrP 1-34 and 1-84. To determine whether the recombinant hPTHrP1-34 and 1-84 can enhance renal calcium reabsorption and promote bone formation, we examined effects of recombinant hPTHrP1-34 and 1-84 on osteogenic lineage commitment in a primary bone marrow cell culture system and on osteoporosis treatment. Results revealed that both of recombinant hPTHrP1-34 and 1-84 increased colony formation and osteogenic cell differentiation and mineralization in vitro; however, the effect of recombinant hPTHrP1-84 is a little stronger than that of hPTHrP1-34. Next, ovariectomy was used to construct osteoporosis animal model (OVX to test activities of these two recombinants in vivo. HPTHrP1-84 administration elevated serum calcium by up-regulating the expression of renal calcium transporters, which resulted in stimulation of osteoblastic bone formation. These factors contributed to augmented bone mass in hPTHrP1-84 treated OVX mice but did not affect bone resorption. There was no obvious bone mass alteration in hPTHrP1-34 treated OVX mice, which may be, at least partly, associated with shorter half-life of hPTHrP1-34 compared to hPTHrP1-84 in vivo. This study implies that recombinant hPTHrP1-84 is more effective than hPTHrP1-34 to enhance renal calcium reabsorption and to stimulate bone formation in vivo.
International Nuclear Information System (INIS)
Haggard, D.L.; Tanner, J.E.
1997-06-01
Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure 134/137 Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. 134/137 Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from 134 Cs and the 662 keV peak from 137 Cs/ 137m Ba. Assembly No. 2 134/137 Cs ratio measured on 4-15-92 was 0.19. The measured 134/137 Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of 134 Cs and 137 Cs. The measured 134/137 Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of 134 Cs and 8620--11646 curies of 137 Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies 134 Cs and 8973 curies 137 Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured 134 Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured 137 Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material
Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece
International Nuclear Information System (INIS)
Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.
1994-01-01
The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)
Soil to plant transfer of 134Cs for olive and orange trees after four years' experimentation
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Haidouti, C.
1998-01-01
The transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) were calculated within a long-term glass-house pot experiment which was started in 1994. The effect of the soil characteristics on 134 Cs uptake was also studied using two soils with different physical and chemical properties. Both evergreen trees exhibited a similar behavior in the two soils, showing that a higher or lower uptake is not crop specific. The capacity of the trees for 134 Cs absorption through the roots seems to be significantly influenced by the soil type. The transfer factors were very low in the calcareous heavy soil and much higher in the acid light soil (up to 10 times for olives and 40 for the edible part of oranges). The difference in the TFs is higher between the two soils than between the two tree species. 134 Cs concentration kept increasing in the orange trees up to the 4th year of growth, while it seems to reach an equilibrium, with no further increase, in the olive trees. Although the behavior of the two tree species is similar, the difference in the final processed product is extreme. A significant amount of 134 Cs was observed in olives grown in the light-acid soil whereas no transfer to the olive oil was detected. On the other hand, the edible part of the oranges showed the highest 134 Cs of nearly all the plant parts
International Nuclear Information System (INIS)
Bengtsson, G.B.
1992-01-01
The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)
International Nuclear Information System (INIS)
Zheng Jiemin; Li Hongyan; Niu Tianxin; Chen Ziyuan; Tang Shirong
2009-01-01
Pot experiment was conducted to investigate the accumulation dynamics of 134 Cs in shoots of Rumex acetosa, Rumex hastatus and Helianthus annuus grown in 134 Cs contaminated soil under greenhouse condition. Results showed that shoot biomass of H. annuus was significantly higher than that of R. acetosa and R. hastatus; among 3 plant species, 13 '4Cs specific activity in shoots was the highest in H. annuus after treatment for 50 days, however after treatment for 70 days, that in R. acetosa was the highest. Bioaccumulation ratio reached 1.5, 1.4 and 1.3 in R. acetosa, R. hastatus and H. annuus at the end of experiment, respectively, and the former two plants kept with trend of continuously increasing during the experiment period. Three plants were tolerant to 134 Cs contaminated slil and capable to translocate 134 Cs from soil to plants. Among them, H. annuus removed greatest 134 Cs amount in the above ground part, and R. acetosa, R. hastatus showed higher tranclocation factor of Cs than H. annuus. Three plants are promising for phytoremediation of soil contaminated with radiocesium, and also could be used for phytoremediation of radiocesium and heavy metals complex contamination, potentially. (authors)
10 CFR 63.134 - Monitoring and testing waste packages.
2010-01-01
....134 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A... geologic repository operations area, the environment of the waste packages selected for the waste package monitoring program must be representative of the environment in which the wastes are to be emplaced. (c) The...
Calibration of the SH134-20 Standard Gain Horn
DEFF Research Database (Denmark)
Pivnenko, Sergey; Breinbjerg, Olav
This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DTU...
Global emissions of refrigerants HCFC-22 and HFC-134a: Unforeseen seasonal contributions
Xiang, Bin; Montzka, Stephen A.; Miller, Scot M.; Elkins, James W.; Moore, Fred L.; Atlas, Elliot L.; Miller, Ben R.; Weiss, Ray F.; Prinn, Ronald G.; Wofsy, Steven C.
2014-01-01
HCFC-22 (CHClF2) and HFC-134a (CH2FCF3) are two major gases currently used worldwide in domestic and commercial refrigeration and air conditioning. HCFC-22 contributes to stratospheric ozone depletion, and both species are potent greenhouse gases. In this work, we study in situ observations of HCFC-22 and HFC-134a taken from research aircraft over the Pacific Ocean in a 3-y span [HIaper-Pole-to-Pole Observations (HIPPO) 2009–2011] and combine these data with long-term ground observations from global surface sites [National Oceanic and Atmospheric Administration (NOAA) and Advanced Global Atmospheric Gases Experiment (AGAGE) networks]. We find the global annual emissions of HCFC-22 and HFC-134a have increased substantially over the past two decades. Emissions of HFC-134a are consistently higher compared with the United Nations Framework Convention on Climate Change (UNFCCC) inventory since 2000, by 60% more in recent years (2009–2012). Apart from these decadal emission constraints, we also quantify recent seasonal emission patterns showing that summertime emissions of HCFC-22 and HFC-134a are two to three times higher than wintertime emissions. This unforeseen large seasonal variation indicates that unaccounted mechanisms controlling refrigerant gas emissions are missing in the existing inventory estimates. Possible mechanisms enhancing refrigerant losses in summer are (i) higher vapor pressure in the sealed compartment of the system at summer high temperatures and (ii) more frequent use and service of refrigerators and air conditioners in summer months. Our results suggest that engineering (e.g., better temperature/vibration-resistant system sealing and new system design of more compact/efficient components) and regulatory (e.g., reinforcing system service regulations) steps to improve containment of these gases from working devices could effectively reduce their release to the atmosphere. PMID:25422438
STS-134 Re-Rendezvous Design History
Stuit, Timothy D.
2011-01-01
In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.
R134a Flow Boiling Analysis with Modified Thermodynamic Property File of MARS Code
Energy Technology Data Exchange (ETDEWEB)
Son, Gyumin; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)
2016-10-15
Previous study showed application of RELAP5 code to solar energy facility with molten salt (60% NaNO3 and 40% KNO3) as working fluid. Based on external experimental correlations, thermodynamic properties of molten salt were evaluated as a function of pressure and temperature and those equations were used to generate tpf. To validate external tpf, experimental values were compared with RELAP5 analysis. In nuclear field, utilization of other fluid is also important since many thermal-hydraulic experiments used various fluids such as FC-72, R123, and R134a. Theses refrigerants have been used to simulate the high pressure environment of nuclear power plants due to their low boiling point, and density ratio between vapor and liquid. Thus, this study aims for tpf generation of R134a and verification by analyzing real case. R134a is selected as a fluid to be implemented and analyzed because it is currently used in refrigerator and frequently used in flow boiling experiment related with heat transfer coefficient and CHF measurement. R134a property file were generated with fitted equation using temperature and pressure as variables, originated from external data source. For validation, flow boiling experiment case were made into simplified input. Analysis with tpfr134a showed that application of Gnielinksi correlation could enhance single phase flow accuracy. Large error of HTC from two phase analysis requires parameter study. Future work aims for more specified experimental case comparison and correlation enhancement for two phase analysis.
Directory of Open Access Journals (Sweden)
Paula E. Brentlinger
2003-04-01
Full Text Available OBJECTIVE: To describe associations between anemia and hookworm (Necator americanus infection in hospitalized women in rural Chiapas, Mexico. MATERIAL AND METHODS: We retrospectively reviewed the hospital records of 68 anemic women (defined as having a hemoglobin level OBJETIVO: Describir la asociación entre anemia severa e infección con Necator americanus en una población de mujeres hospitalizadas en el estado de Chiapas, México. MATERIAL Y MÉTODOS: En el registro de ingresos del año 1999 de un hospital rural en Altamirano, Chiapas, se identificaron a las pacientes con diagnósticos de egreso de anemia (definida como hemoglobina<10mg/dl y/o parasitosis intestinal. También se revisó el registro de transfusiones para identificar a las mujeres mayores de 14 años de edad que recibieron sangre. La revisión de expedientes y el análisis de datos se llevó a cabo en el año 2000. Las comparaciones de las características de las pacientes se hicieron con la prueba t de Student (para variables continuas y la prueba ji2 (para variables categóricas. La significancia estadística se estableció con un valor de p< 0.01. RESULTADOS: En las mujeres en quienes se realizó examen coproscópico, 50% tuvieron N. americanus. La presencia de N. americanus no excluyó la presencia de otro factor de riesgo para anemia, por ejemplo embarazo o hemorragia. Los niveles de hemoglobina de las mujeres infectadas con N. americanus fueron significativamente más bajos (promedio 4.1 g/dl que los de las demás mujeres anémicas (promedio 7.0 gm/dl, y la prevalencia de N. americanus en mujeres anémicas fue más alta (50.0% que en la población atendida por el hospital (1.9%. CONCLUSIONES: Aunque la prevalencia de infección con N. americanus no se considera alta en la población general mexicana, fue importante en las mujeres anémicas que se sometieron a coproscopía en nuestro estudio. Las mujeres anémicas ameritan coproscopía donde existe N. americanus, y pueden
Bent Shaped 1,3,4-Oxadiazole/Thiadiazole heterocyclic rings ...
Indian Academy of Sciences (India)
Two series of bent shaped 1,3,4-oxadiazole/thiadiazole heterocyclic ring containing liquid crystalline (LC) compounds were synthesized and characterized by FT-IR, 1H, 13C-NMR and ESI-Mass spectro-scopic techniques. Liquid crystal properties were investigated by polarized optical microscopy and differential scanning ...
International Nuclear Information System (INIS)
Chen, Tianjun; Gao, Fei; Feng, Sifang; Yang, Tian; Chen, Mingwei
2015-01-01
MicroRNAs have been shown to act as crucial modulators during carcinogenesis. Recent studies have implied that miR-134 expression associated with epithelial-to-mesenchymal transition phenotype and invasive potential of NSCLC cells. Our study investigated the pathogenic implications of miR-134 in small cell lung cancer (SCLC). Overexpression or inhibition MiR-134 expression by miR-134 mimics or miR-134 inhibitors (anti-miR-134) in SCLC cell lines was detected using qRT-PCR. Lactate dehydrogenase (LDH) assay, MTT assays and flow cytometry were performed in order to clarify the growth and apoptosis of SCLC cells which had been transfected with miR-134 mimics or anti-miR-134. WWOX expression in H69 cells was detected by qRT-PCR and western blot, respectively. The results showed that overexpression miR-134 was significantly promoting SCLC cells growth and inhibit its apoptosis. In addition, reduced miR-134 expression was significantly correlated with cell growth inhibition and apoptosis promotion. Furthermore, transfection of miR-134 mimics into the SCLC cells markedly down-regulated the level of WWOX, whereas, anti-miR-134 up-regulated WWOX expression. We also found that overexpression WWOX attenuate miR-134 induced H69 cells growth, and promote cell apoptosis. Moreover, miR-134 promoted cell proliferation and inhibit apoptosis via the activation of ERK1/2 pathway. These findings suggest that miR-134 may be an ideal diagnostic and prognostic marker, and may be attributed to the molecular therapy of SCLC. - Highlights: • MiR-134 play roles in small cell lung cancer cell growth and apoptosis. • MiR-134 negative regulated the level of WWOX in H69 cells. • WWOX overexpression attenuate miR-134 induced H69 cells growth. • MiR-134 promotes cell growth via the activation of ERK1/2 pathway
EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER
Bhatkar, V. W.
2018-01-01
An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...
MicroRNA hsa-miR-134 is a circulating biomarker for mesial temporal lobe epilepsy.
Directory of Open Access Journals (Sweden)
Simoni H Avansini
Full Text Available Epilepsy is misdiagnosed in up to 25% of patients, leading to serious and long-lasting consequences. Recently, circulating microRNAs have emerged as potential biomarkers in a number of clinical scenarios. The purpose of this study was to identify and to validate circulating microRNAs that could be used as biomarkers in the diagnosis of epilepsy. Quantitative real-time PCR was used to measure plasma levels of three candidate microRNAs in two phases of study: an initial discovery phase with 14 patients with mesial temporal lobe epilepsy (MTLE, 13 with focal cortical dysplasia (FCD and 16 controls; and a validation cohort constituted of an independent cohort of 65 patients with MTLE and 83 controls. We found hsa-miR-134 downregulated in patients with MTLE (p = 0.018 but not in patients with FCD, when compared to controls. Furthermore, hsa-miR-134 expression could be used to discriminate MTLE patients with an area under the curve (AUC of 0.75. To further assess the robustness of hsa-miR-134 as a biomarker for MTLE, we studied an independent cohort of 65 patients with MTLE, 27 of whom MTLE patients were responsive to pharmacotherapy, and 38 patients were pharmacoresistant and 83 controls. We confirmed that hsa-miR-134 was significantly downregulated in the plasma of patients with MTLE when compared with controls (p < 0.001. In addition, hsa-miR-134 identified patients with MTLE regardless of their response to pharmacotherapy or the presence of MRI signs of hippocampal sclerosis. We revealed that decreased expression of hsa-miR-134 could be a potential non-invasive biomarker to support the diagnosis of patients with MTLE.
Environmentally benign synthesis of sydnone containing 1,3,4 ...
Indian Academy of Sciences (India)
TECS
lop benign synthetic methods for sydnone deriva- tives,. 9 we report here a new series of sydnone containing 1,3,4-thiadiazines by microwave irradia- tion under solvent-free conditions. 2. Experimental. 2.1 General remarks. Melting points were determined by open capillary method and are uncorrected. All compounds were.
Accumulation, distribution and excretion of 134Cs and 65Zn by the green mussels (Perna Viridis)
International Nuclear Information System (INIS)
Chen Shunhua; Zhong Chuangguang; Yan Yuanyi; Zhao Xiaokui; Peng Yefang; Shi Qiong
1997-10-01
Two important radionuclides 134 Cs and 65 Zn were applied to study the accumulation, distribution and excretion of radioactive nuclides in organs and tissues of green mussel Perna Viridis. the results showed that the uptake rate of 134 Cs by green mussels was very low and the concentration factor (CF) for 134 Cs in the byssus approximated to 1. This CF value was lower than that of other tissues and organs of mussels, but its excretion rate was much higher than that of soft tissues. It was also found that the byssus of mussels had a special ability to accumulate 65 Zn. Concentration factor (CF) for 65 Zn in the byssus could reach as high as 900, which was much higher than that of any other tissues. However, its excretion rate was lower than that of other tissues and organs. The uptake rate of 65 Zn by soft tissues was markedly higher than that of 134 Cs. The mussels could also highly concentrate the low level 65 Zn even if specific activity of 65 Zn was very low in the environmental seawater. Results of radioactive trace experiments showed that the absorption of 134 Cs and 65 Zn by Perna Viridis was selective
A simple method for the deconvolution of 134 Cs/137 Cs peaks in gamma-ray scintillation spectrometry
International Nuclear Information System (INIS)
Darko, E.O.; Osae, E.K.; Schandorf, C.
1998-01-01
A simple method for the deconvolution of 134 Cs / 137 Cs peaks in a given mixture of 134 Cs and 137 Cs using Nal(TI) gamma-ray scintillation spectrometry is described. In this method the 795 keV energy of 134 Cs is used as a reference peak to calculate the activity of the 137 Cs directly from the measured peaks. Certified reference materials were measured using the method and compared with a high resolution gamma-ray spectrometry measurements. The results showed good agreement with the certified values. The method is very simple and does not need any complicated mathematics and computer programme to de- convolute the overlapping 604.7 keV and 661.6 keV peaks of 134 Cs and 137 Cs respectively. (author). 14 refs.; 1 tab., 2 figs
Energy Technology Data Exchange (ETDEWEB)
Haggard, D.L.; Tanner, J.E.
1997-06-01
Nondestructive assay (NDA) gamma spectroscopy techniques were used to measure {sup 134/137}Cs ratios on nine PuAl Mark 42 fuel assemblies. The purpose of the ratio measurement was to confirm theoretical burnup calculations. {sup 134/137}Cs ratios were determined from the measured activity based on corrected net peak area counts for the 605 keV peak from {sup 134}Cs and the 662 keV peak from {sup 137}Cs/{sup 137m}Ba. Assembly No. 2 {sup 134/137}Cs ratio measured on 4-15-92 was 0.19. The measured {sup 134/137}Cs ratio was decay corrected to be 2.11 on 8-1-84 based on the half lives of {sup 134}Cs and {sup 137}Cs. The measured {sup 134/137}Cs ratio range was 1.90--2.14 for all nine assemblies. These measured values compare to a theoretical ratio of 1.7 on 8-1-84 determined by burnup calculations. Total cesium curie content was also requested and determined using the NDA direct measurements. Gamma spectral data were measured on the nine sectioned Mark 42 fuel assemblies. Measured cesium curie content, decay corrected to 8-1-84, ranged from 18170--24480 curies of {sup 134}Cs and 8620--11646 curies of {sup 137}Cs. Theoretical cesium curie content of 8-1-84 was 15200 curies {sup 134}Cs and 8973 curies {sup 137}Cs. Direct assay cesium ratio is 12% to 26% higher than the predicted ratio of 1.7. The measured {sup 134}Cs data indicate between 20%--61% more activity than that predicted by the burnup code, whereas the measured {sup 137}Cs activity is between 4% less to 30% more than the predicted activity. This information may be used to address issues concerning criticality safety, storage, and shipping of this type of material.
International Nuclear Information System (INIS)
Massas, I.; Skarlou, C.; Anoussis, J.; Haidouti, C.; Arapis, G.
1999-01-01
The effect of soil pH on 134 Cs TFs as well as the fate of 134 Cs in the extracted oil was studied in a greenhouse experiment with soybean and sunflower plants. A soil with pH 4.2 was used as a basis and its pH value has increased to 5.7, 6.5 and 7.6 (by the addition of different amounts of Ca(OH) 2 ). The lowest TF value was observed in the calcareous soil (pH 7.6), while the highest in the lowest pH (4.2) for the vegetative part and in the pH 6.5 for the edible part for both studied plants. TFs were practically the same for soya plants grown on the three lowest soil pH and reduced significantly only at pH 7.6 for either pods or other plant material. However, the lowest/highest TF was ∼ 4 for pods and ∼ 6 for the other plant material. For the sunflower plants while TFs for other plant material reduced from lowest to highest soil pH by only a factor of 2, for the seeds TFs remained rather constant. The difference in TF between the two studied species in each soil pH was in some cases higher than the difference due to pH effect. When an oil fraction (∼ 20 %) was extracted from seeds of both plants, no 134 Cs was detected. Refs. 4 (author)
Apitanyasai, Kantamas; Amparyup, Piti; Charoensapsri, Walaiporn; Sangsuriya, Pakkakul; Tassanakajon, Anchalee
2018-05-01
Hemocyte homeostasis-associated protein (PmHHAP) was first identified as a viral-responsive gene, due to a high upregulation in transcription following white spot syndrome virus (WSSV) infection. Functional studies using RNA interference have suggested that PmHHAP is involved in hemocyte homeostasis by controlling apoptosis during WSSV infection. In this study, the role of PmHHAP in host-viral interactions was further investigated. Yeast two-hybrid assay and co-immunoprecipitation revealed that PmHHAP binds to an anti-apoptosis protein, WSSV134. The viral protein WSSV134 is a late protein of WSSV, expressed 24 h post infection (hpi). Gene silencing of WSSV134 in WSSV-infected shrimp resulted in a reduction of the expression level of the viral replication marker genes VP28, wsv477, and ie-1, which suggests that WSSV134 is likely involved in viral propagation. However, co-silencing of PmHHAP and WSSV134 counteracted the effects on WSSV infection, which implies the importance of the host-pathogen interaction between PmHHAP and WSSV134 in WSSV infection. In addition, caspase 3/7 activity was noticeably induced in the PmHHAP and WSSV134 co-silenced shrimp upon WSSV infection. Moreover, PmHHAP and WSSV134 inhibited caspase-induced activation of PmCasp in vitro in a non-competitive manner. Taken together, these results suggest that PmHHAP and WSSV134 play a role in the host-pathogen interaction and work concordantly to control apoptosis in WSSV infection. Copyright © 2018 Elsevier Ltd. All rights reserved.
Gill, Jatinder; Singh, Jagdev
2017-11-01
In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.
Gill, Jatinder; Singh, Jagdev
2018-05-01
In this work, the experimental examination was carried out using a mixture of R134a and LPG refrigerant (consisting of R134a and LPG in a proportion of 28:72 by weight) as a replacement for R134a in a vapor compression refrigeration system. Exergy and energy tests were carried out at different evaporator and condenser temperatures with controlled environmental conditions. The results showed that the exergy destruction in the compressor, condenser, evaporator, and a capillary tube of the R134a / LPG refrigeration system was found lower by approximately 11.13-3.41%, 2.24-3.43%, 12.02-13.47% and 1.54-5.61% respectively. The compressor exhibits the highest level of destruction, accompanied by a condenser, an evaporator and a capillary tube in refrigeration systems. The refrigeration capacity, COP and power consumption of the compressor of the R134a /LPG refrigeration system were detected higher and lower compared to the R134a refrigeration system by about 7.04-11.41%, 15.1-17.82%, and 3.83-8.08% respectively. Also, the miscibility of R134a and LPG blend with mineral oil discovered good. The R134a and LPG refrigerant mixture proposed in this study perform superior to R134a from component-wise exergy and energy analyses under similar experimental conditions.
USING TURKISH OF NECATİ BEY NECATÎ BEY’İN TÜRKÇESİ
Directory of Open Access Journals (Sweden)
Şerif Ali BOZKAPLAN
2011-01-01
Full Text Available Necatî who have studies with old Anatolian Turkish, is known and gets attention as a man who speaks and uses Turkish very perfectly. It should be mentioned that idioms, proverbs, reduplications, mottos etc. Which are main stones of Turkish are take parts in poetry of Necatî. In addition to these Poet Necatî applies some structures spoken languages into literal language.Therefore, it is possible to see some archaic words aren’t used anymore in actual Turkish in Necatî’s poetry.In conclusion Necatî connects yesterday of Turkish and today of Turkish by using some features of history of Turkish. Eski Anadolu Türkçesi ile eser vermiş olan Necatî, Türkçeyi gayet iyi konuşan ve kullanan biri olarak dikkat çekmektedir. Türkçenin anlatım vasıtalarından olan deyimler, atasözleri, ikilemeler, kalıp sözler, özlü sözler, vb. gibi yapı taşlarının Necatî ‘nin şiirinde hayli yer bulduğunu belirtmek gerekir. Bunlara ilaveten Şair Necatî, konuşma dilinin bazı kalıplarını da şiir diline dahil etmiştir.Öte yandan bugünkü Türkçede kullanımdan düşmüş bazı arkaik sözlere Necatî’nin şiirinde rastlamak mümkündür.Görüldüğü üzere Necatî geçmişin bazı unsurlarını kullanarak Türkçenin geçmişi ile o günü dolayısıyla da bugünün arasında bağ kurmuştur.
International Nuclear Information System (INIS)
Ishizu, H.; Yamada, T.
2013-01-01
A certified reference material using activated alumina powder certified for activity of 134 Cs and 137 Cs was developed. The results of the verification and the certification are described. The certified reference material can be used for quality assurance of screening activity measurements of 134 Cs and 137 Cs in food/foodstuffs. Commercially available equipments were experimentally tested using the CRM and another CRM including 40 K. The results of these tests are also shown. - Highlights: • CRM of 134 Cs and 137 Cs using activated alumina was developed. • CRM including 134 Cs, 137 Cs and 40 K was also developed. • Results of experimental performance test of commercial inspection equipments using CRMs were shown
17 CFR 1.34 - Monthly record, “point balance”.
2010-04-01
... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Recordkeeping § 1.34 Monthly record, “point balance”. (a) Each... statement commonly known as a “point balance,” which accrues or brings to the official closing price, or... contracts long and short in the customers' accounts are in balance with those in the carrying futures...
19 CFR 134.35 - Articles substantially changed by manufacture.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134... substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in the United States in manufacture which results in an article having a name, character, or use differing from...
[Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].
Betschart; Hässig; Spiess
2014-03-01
This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).
12 CFR 204.134 - Linked time deposits and transaction accounts.
2010-01-01
... RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.134...) establishes general reserve requirements on transaction accounts and nonpersonal time deposits. Under section... other than to allow the payment of higher interest through the avoidance of reserve requirements. As the...
Energy Technology Data Exchange (ETDEWEB)
Slaveykova, Vera I., E-mail: vera.slaveykova@unige.ch [Environmental Biogeochemistry and Ecotoxicology, Institute F.-A. Forel, Earth and Environment Science, Faculty of Sciences, University of Geneva, 10, route de Suisse, 1290 Versoix (Switzerland); Pinheiro, José Paulo [IBB/CBME, Department of Chemistry and Biochemistry, University of the Algarve, Gambelas Campus, 8005-139 Faro (Portugal); Floriani, Magali [IRSN/DEI/SECRE/LRE CEA Cadarache, 13115 Saint-Paul-Lez-Durance (France); Garcia, Miguel [School of Life Sciences, Swiss Federal Institute of Technology (EPFL), Station 15, CH-1015 Lausanne (Switzerland)
2013-10-15
Highlights: • QDs associate with C. metallidurans in time and concentration dependent manner. • 12.9 nm size QDs adhere to the bacterial surface and enter the periplasmic space. • QDs bound significantly Cu and Pb. • QDs increase Cu and Pb content in C. metallidurans during short term exposure. -- Abstract: In the present study we address the interactions of carboxyl-CdSe/ZnS core/shell quantum dots (QDs), as a model of water dispersible engineered nanoparticles, and metal resistant bacteria Cupriavidus metallidurans, largely used in metal decontamination. The results demonstrate that QDs with average hydrodynamic size of 12.9 nm adhere to C. metallidurans. The percentage of bacterial cells displaying QD-fluorescence increased proportionally with contact time and QD concentration in bacterial medium demonstrating the association of QDs with the metal resistant bacteria. No evidence of QD internalization into bacterial cytoplasm was found by transmission electron microscopy with energy dispersive X-ray spectrometry, however QD clusters of sizes between 20 and 50 nm were observed on the bacterial surface and in the bacterial periplasmic compartment; observations consistent with the losses of membrane integrity induced by QDs. The presence of 20 nM QDs induced about 2-fold increase in Cu and Pb uptake fluxes by C. metallidurans exposed to 500 nM Pb or Cu, respectively. Overall, the results of this work suggest that when present in mixture with Cu and Pb, low levels of QDs originating from possible incidental release or QD disposal could increase metal accumulation in metal resistant bacterium.
13 CFR 134.704 - What are the effects of the appeal on the procurement at issue?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the effects of the appeal on the procurement at issue? 134.704 Section 134.704 Business Credit and Assistance SMALL BUSINESS...
13 CFR 134.707 - When does the D/GC transmit the protest file and to whom?
2010-01-01
... Appeals From Women-Owned Small Business Concern (WOSB) and Economically Disadvantaged WOSB Concern (EDWOSB... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When does the D/GC transmit the protest file and to whom? 134.707 Section 134.707 Business Credit and Assistance SMALL BUSINESS...
Direct Production of Propene from the Thermolysis of Poly(..beta..-hydroxybutyrate)
Energy Technology Data Exchange (ETDEWEB)
Mittal, Ashutosh; Pilath, Heidi M.; Johnson, David K.
2015-03-22
To transform biomass components into hydrocarbon fuels it is clear that there are two main transformations that need to occur, i.e., deoxygenation and carbon chain extension. The potential routes for decreasing the oxygen content of biomass intermediates include dehydration, hydrodeoxygenation and decarboxylation. One route that is examined here is the conversion of polyhydroxyalkanoates (PHA) to alkenes that would be intermediates to hydrocarbon fuels.Thermal breakdown of PHA proceeds via an intermediate carboxylic acid, which can then be decarboxylated to an alkene. Oligomerization of alkenes by well-known commercial technologies would permit production of a range of hydrocarbon fuels from a carbohydrate derived intermediate. Moreover, polyhydroxybutyrate (PHB) can be produced in Cupriavidus necator (formerly known as Ralstonia eutropha) and Alcaligenes eutrophus on a variety of carbon sources including glucose, fructose and glycerol with PHB accumulation reaching 75 percent of dry cell mass. We conducted thermal conversion of PHB and pure crotonic acid (CA), the intermediate carboxylic acid produced by thermal depolymerization of PHB, in a flow-through reactor. The results of initial experiments on the thermal conversion of CA showed that up to 75 mole percent yields of propene could be achieved by optimizing the residence time and temperature of the reactor. Further experiments are being investigated to optimize the reactor parameters and enhance propene yields via thermal conversion of PHB.
Ismail, Iszatty; Gurusamy, Tana Poorani; Ramachandran, Hema; Al-Ashraf Amirul, Abdullah
2017-04-21
Antibiofilm polymers have the ability to inhibit bacterial biofilm formation, which is known to occur ubiquitously in the environment and pose risks of infection. In this study, production of P(3HB-co-4HB) copolymer and antimicrobial yellow pigment from Cupriavidus sp. USMAHM13 are enhanced through medium optimization. Before the improvement of yellow pigment production, screening for the best additional supplement was performed resulting in high-yield yellow pigmentation using yeast extract with optimum concentration of 2 g/L. Effects of different concentrations of 1,4-butanediol, ammonium acetate, and yeast extract were studied using central composite design. Under optimal conditions, 53 wt% of polyhydroxyalkanoate (PHA) content, 0.35 g/L of pigment concentration, and 5.87 g/L of residual biomass were achieved at 0.56 wt% C of 1,4-butanediol, 1.14 g/L of ammonium acetate, and 2 g/L of yeast extract. Antibiofilm tests revealed that the yellow pigment coated on P(3HB-co-4HB) copolymer had significant effect on the inhibition of bacteria proliferation and colonization from 6 hr onward reaching 100% inhibition by 12 hr, hence effectively inhibiting the biofilm formation.
Directory of Open Access Journals (Sweden)
Fanggang Bi
Full Text Available We examined whether intermittent administration of parathyroid hormone [1-34] (PTH[1-34]; 60 μg/kg/day can prevent the negative effects of titanium (Ti particles on implant fixation and periprosthetic osteolysis in a rat model. Eighteen adult male rats (12 weeks old, bones still growing received intramedullary Ti implants in their bilateral femurs; 6 rats from the blank group received vehicle injections, and 12 rats from the control group and PTH treatment group received Ti particle injections at the time of operation and intra-articular injections 2 and 4 weeks postoperatively. Six of the rats that received Ti particles from the PTH group also received PTH[1-34] treatment. Six weeks postoperatively, all specimens were collected for assessment by X-ray, micro-CT, biomechanical, scanning electron microscopy (SEM, and dynamic histomorphometry. A lower BMD, BV/TV, Tb.N, maximal fixation strength, and mineral apposition rate were observed in the control group compared to the blank group, demonstrating that a periprosthetic osteolysis model had been successfully established. Administration of PTH[1-34] significantly increased the bone mineral density of the distal femur, BV/TV, Tb.N, Tb.Th, Tb.Sp, Con.D, SMI, and maximal fixation strength in the PTH group compared to that in the control group. SEM revealed higher bone-implant contact, thicker lamellar bone, and larger trabecular bone area in the PTH group than in the control group. A higher mineral apposition rate was observed in the PTH group compared to both the blank and control groups. These findings imply that intermittent administration of PTH[1-34] prevents periprosthetic osteolysis by promoting bone formation. The effects of PTH[1-34] were evaluated at a suprapharmacological dosage to the human equivalent in rats; therefore, additional studies are required to demonstrate its therapeutic potential in periprosthetic osteolysis.
Predicting heat transfer in long, R-134a filled thermosyphons
Grooten, M.H.M.; Geld, van der C.W.M.
2008-01-01
When traditional air-to-air cooling is too voluminous, heat exchangers with long thermosyphons offer a good alternative. Experiments with a single thermosyphon with a large length-to-diameter ratio (188) and filled with R-134a are presented and analyzed. Saturation temperatures, filling ratios, and
Uptake and loss of Cesium - 134 by the snail Biomphalaria glabrata (Say, 1818)
International Nuclear Information System (INIS)
Kikuchi, O.K.; Mastro, N.L. del.
1988-07-01
The uptake and loss of Cs-134 produced in IEA-R1 reactor of IPEN was observed in fresh water adult snails. Two activites were employed: 3.700 and 18.500 Bq/1. A monochannel analyses was used for radiactivity couting and the number of egg-laying and embryo were registered. Maximum uptake occured approximately at 8 th day and the biological half-life was about 6 days. Although the egg-laying and embryo number were diminished with Cs-134 presence, it is not possible to affirm that result due to the small number of animals used. (author) [pt
R-134a (1,1,1,2-Tetrafluoroethane) Inhalation Induced Reactive Airways Dysfunction Syndrome.
Doshi, Viral; Kham, Nang; Kulkarni, Shreedhar; Kapitan, Kent; Henkle, Joseph; White, Peter
2016-01-01
R-134a (1,1,1,2-tetrafluoroethane) is widely used as a refrigerant and as an aerosol propellant. Inhalation of R-134a can lead to asphyxia, transient confusion, and cardiac arrhythmias. We report a case of reactive airways dysfunction syndrome secondary to R-134a inhalation. A 60-year-old nonsmoking man without a history of lung disease was exposed to an air conditioner refrigerant spill while performing repairs beneath a school bus. Afterward, he experienced worsening shortness of breath with minimal exertion, a productive cough, and wheezing. He was also hypoxic. He was admitted to the hospital for further evaluation. Spirometry showed airflow obstruction with an FEV1 1.97 L (45% predicted). His respiratory status improved with bronchodilators and oral steroids. A repeat spirometry 2 weeks later showed improvement with an FEV1 2.5 L (60% predicted). Six months after the incident, his symptoms had improved, but he was still having shortness of breath on exertion and occasional cough.
Physical properties of 134 soils in six northeastern states
A. R. Eschner; B. O. Jones; R. C. Moyle
1957-01-01
From June 1954 to July 1955 the Vicksburg Infiltration Project collected and analyzed samples from 134 sites in six Northeastern States; the samples included 79 soil series and 114 soil types. This work was done to supply the U. S. Army with information needed for specialized research on military traffic ability. The basic data are herein presented because of their...
28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.
2010-07-01
... SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General... Special Nuclear Materials Rewards Act, the Attorney General shall: (a) Refer such submission for review to... whether that alien and members of his immediate family may receive immigrant visas and be admitted to the...
Soil to plant transfer of 134Cs for olive and orange trees: preliminary results
International Nuclear Information System (INIS)
Skarlou, V.; Nobeli, C.; Anoussis, J.; Papanicolaou, E.; Haidouti, C.
1995-01-01
The objective of this research programme was to calculate values of transfer parameters of 134 Cs from soil to tree crops (olive and orange trees) in a long term glasshouse pot experiment, started in 1994. Radiocaesium contamination in the different tree parts as well as the importance of the storage or cycling of 134 Cs will also be examined. The experiment was conducted in large pots filled with a calcareous, heavy soil (115 kg/pot) where olive and orange trees, two years after grafting were transplanted. The soil was added to the pot in layers ca. 2 cm thick on the top of which the radioactive solution was added in small drops. Caesium-134 as CsCl (0.5 mCi) was added to each pot. The soil in the pots was watered to field capacity and left to stand for eight weeks for the 134 Cs to reach equilibrium. Plant samples were taken at fruit maturity, eight months after transplanting. It is noticed that the length of experimentation is rather short for tree crops and the data should be considered as preliminary ones with indicative tendencies. Under these conditions plant contamination was generally very low in both plant species studied. The concentration ratios (CR) of 134 Cs for the studied crops did not differ much and they ranged from 0.0007 to 0.002 for olive trees and from 0.0006 to 0.001 for orange trees. Leaves compared to other plant parts showed the highest CR value in both crops. Furthermore new leaves and branches of the olive trees showed higher CR values than the old ones by approximately a factor of two. Potassium content of the different plant parts showed significant differences and they were higher in leaves and fruits. There is no correlation between K content and transfer factors of Cs in the different plant parts of both crops. To study the effect of soil type on CRs of 134 Cs for olive and orange trees a similar experiment was established two months later, using a sandy and acid soil. Based on first results, higher values of transfer factors of 134
Investigating the Limitations of Advanced Design Methods through Real World Application
2016-03-31
36 War Room Laptop Display ( MySQL , JMP 9 Pro, 64-bit Windows) Georgia Tech Secure Collaborative Visualization Environment ( MySQL , JMP 9 Pro...investigate expanding the EA for VC3ATS • Would like to consider both an expansion of the use of current Java -based BPM approach and other potential EA
Synthesis and Biological Activity of 2,5-Bisubstituted Derivatives of 1,3,4-Thiadiazol-2,5-dithiol
Directory of Open Access Journals (Sweden)
T. S. Zhivotova
2013-01-01
Full Text Available By reaction of 1,3,4-thiadiazol-2,5-dithiol with different organohalogens, chlorides of carboxylic acids, acrylic acid derivatives, alkaloids, and secondary amines, various derivatives of 2,5-bi-substituted 1,3,4-thiadiazole were synthesized, and biological properties of some of them were studied.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions of Very Small Aperture Terminal (VSAT) and C-band Small Aperture Terminal (CSAT) networks. 25.134 Section 25.134 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...
International Nuclear Information System (INIS)
Ramzaev, V.; Barkovsky, A.; Gromov, A.; Ivanov, S.; Kaduka, M.
2014-01-01
In 2011–2013, sampling of epiphytic fruticose lichens of the genera Usnea, Bryoria and Alectoria was carried out on Sakhalin and Kuril Islands (the Sakhalin region, Russia) to investigate contamination of these organisms with the Fukushima-derived 134 Cs and 137 Cs. Activities of the radionuclides were determined in all 56 samples of lichens taken for the analysis. After correction for radioactive decay (on 15 March 2011), the activity concentrations ranged from 2.1 Bq kg −1 (d.w.) to 52 Bq kg −1 for 134 Cs and from 2.3 Bq kg −1 to 52 Bq kg −1 for 137 Cs. Cesium-134 and 137 Cs activities for the whole set of lichens (n = 56) were strongly positively correlated; Spearman's rank correlation coefficient was calculated as 0.991 (P < 0.01). The activity concentrations of 134 Cs and 137 Cs in Usnea lichens from the Sakhalin and Kunashir islands declined with a factor of three in the period from 2011 to 2013. The average biological half-time for both cesium radionuclides in lichens of the genus Usnea is estimated as 1.3 y. The mean of 0.99 ± 0.10 and median of 0.99 were calculated for the decay corrected 134 Cs/ 137 Cs activities ratios in the lichens (n = 56). The radionuclides ratio in the lichens did not depend on location of sampling site, species and the time that had passed after the Fukushima accident. The regression analysis has shown the background pre-Fukushima level of 137 Cs of 0.4 ± 0.3 Bq kg −1 , whereas the ratio between the Fukushima-borne 134 Cs and 137 Cs in the lichens was estimated as 1.04. The 134 Cs/ 137 Cs activities ratio in lichens from the Sakhalin region is consistent with the ratios reported by others for the heavy contaminated areas on Honshu Island in Japan following the Fukushima accident. The activity concentrations of natural 7 Be in lichens from the Sakhalin region varied between 100 Bq kg −1 and 600 Bq kg −1 ; the activity concentrations did not exhibit temporal variations during a 2y-period of observations. The
Energy Technology Data Exchange (ETDEWEB)
Higashi, Y.
1999-09-01
The plane of vapor-liquid criticality for ternary refrigerant mixtures of difluoromethane (R-32) + pentafluoroethane (R-125) + 1,1,1,2-tetrafluoroethane (R-134a) was determined from data on the vapor-liquid coexistence curve near the mixture critical points. The composition (mass percentage) of the mixtures studied were 23% R-32 + 25% R-125 + 52% R-134a (R-407C). 25% R-32 + 15% R-125 + 60% R-134a (R-407E), and 20% R-32 + 40% R-125 + 40% R-134a (R-407A). The critical temperature of each mixture was determined by observation of the disappearance of the meniscus. The critical density of each mixture was determined on the basis of meniscus disappearance level and the intensity of the critical opalescence. The uncertainties of the temperature, density, and composition measurements are estimated as {+-}10mK, {+-}5kg{center_dot}m{sup {minus}3}, and {+-}0.05%, respectively. In addition, predictive methods for the critical parameters of R-32/125/134a mixtures are discussed.
Johnson, Jennifer L; He, Jing; Ramadass, Mahalakshmi; Pestonjamasp, Kersi; Kiosses, William B; Zhang, Jinzhong; Catz, Sergio D
2016-02-12
The small GTPase Rab11 and its effectors control trafficking of recycling endosomes, receptor replenishment and the up-regulation of adhesion and adaptor molecules at the plasma membrane. Despite recent advances in the understanding of Rab11-regulated mechanisms, the final steps mediating docking and fusion of Rab11-positive vesicles at the plasma membrane are not fully understood. Munc13-4 is a docking factor proposed to regulate fusion through interactions with SNAREs. In hematopoietic cells, including neutrophils, Munc13-4 regulates exocytosis in a Rab27a-dependent manner, but its possible regulation of other GTPases has not been explored in detail. Here, we show that Munc13-4 binds to Rab11 and regulates the trafficking of Rab11-containing vesicles. Using a novel Time-resolved Fluorescence Resonance Energy Transfer (TR-FRET) assay, we demonstrate that Munc13-4 binds to Rab11a but not to dominant negative Rab11a. Immunoprecipitation analysis confirmed the specificity of the interaction between Munc13-4 and Rab11, and super-resolution microscopy studies support the interaction of endogenous Munc13-4 with Rab11 at the single molecule level in neutrophils. Vesicular dynamic analysis shows the common spatio-temporal distribution of Munc13-4 and Rab11, while expression of a calcium binding-deficient mutant of Munc13-4 significantly affected Rab11 trafficking. Munc13-4-deficient neutrophils showed normal endocytosis, but the trafficking, up-regulation, and retention of Rab11-positive vesicles at the plasma membrane was significantly impaired. This correlated with deficient NADPH oxidase activation at the plasma membrane in response to Rab11 interference. Our data demonstrate that Munc13-4 is a Rab11-binding partner that regulates the final steps of Rab11-positive vesicle docking at the plasma membrane. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Microscopic structure of liquid 1-1-1-2-tetrafluoroethane (R134a) from Monte Carlo simulation.
Do, Hainam; Wheatley, Richard J; Hirst, Jonathan D
2010-10-28
1-1-1-2-tetrafluoroethane (R134a) is one of the most commonly used refrigerants. Its thermophysical properties are important for evaluating the performance of refrigeration cycles. These can be obtained via computer simulation, with an insight into the microscopic structure of the liquid, which is not accessible to experiment. In this paper, vapour-liquid equilibrium properties of R134a and its liquid microscopic structure are investigated using coupled-decoupled configurational-bias Monte Carlo simulation in the Gibbs ensemble, with a recent potential [J. Phys. Chem. B 2009, 113, 178]. We find that the simulations agree well with the experimental data, except at the vicinity of the critical region. Liquid R134a packs like liquid argon, with a coordination number in the first solvation shell of 12 at 260 K. The nearest neighbours prefer to be localized in three different spaces around the central molecule, in such a manner that the dipole moments are in a parallel alignment. Analysis of the pair interaction energy shows clear association of R134a molecules, but no evidence for C-HF type hydrogen bonding is found. The above findings should be of relevance to a broad range of fluoroalkanes.
N-(5-Benzylsulfanyl-1,3,4-thiadiazol-2-yl-2-(piperidin-1-ylacetamide
Directory of Open Access Journals (Sweden)
D. S. Ismailova
2014-03-01
Full Text Available The title compound, C16H20N4OS2, was synthesized by the reaction of 2-benzylsulfanyl-5-chloroacetamido-1,3,4-thiadiazole and piperidine in a 1:2 ratio. The planes of the acetamide and 1,3,4-thiadiazole units are twisted by 10.8 (4°. The thiadiazole S atom and the acetamide O atom are syn-oriented due to a hypervalent S...O interaction of 2.628 (4 Å. In the crystal, molecules form centrosymmetric dimers via N—H...N hydrogen bonds. These dimers are further connected by C—H...O interactions into (100 layers.
Causes of seasonal variations of Cs-134/137 activity concentrations in surface air
International Nuclear Information System (INIS)
Hoetzl, H.; Winkler, R.
1993-01-01
In winter months maxima of Cs-134/137 activity concentrations in air are observed at several locations in Europe. To clarify this phenomenon, from October 1991 to November 1992 we performed a program for aerosol collection on a short-term scale based on collecting intervals of 48-72 hours. The local meteorological parameters were determined simultaneously. Statistical analysis of these observations reveiled a highly significant positive correlation between Cs-137 activity concentration and the so-called 'Stagnationsindex'. Based on this relationship the seasonal variations of Cs-134/137 concentrations in ground-level air can be explained by atmospheric inversion conditions frequently occurring during fall- and wintermonths. (orig.) [de
Williams, Allan J.; Jordan, Faron; King, Gareth; Lewis, Andrew L.; Illum, Lisbeth; Masud, Tahir; Perkins, Alan C.; Pearson, Richard G.
2017-01-01
Osteoporosis treatment with PTH 1-34 injections significantly reduces the incidence of bone fracture. Potential further reductions in fracture rate should be observed through nasal spray delivery to address the poor compliance associated with patient dislike of repeated PTH 1-34 subcutaneous injections. In vitro human osteoblast-like Saos-2 cell intracellular cAMP levels were used to define PTH 1-34 nasal spray formulation bioactivity. The chemically synthesised PTH 1-34 had an EC50 of 0.76nM...
EXPERIMENTAL INVESTIGATION OF R-134a AND R-600a ...
African Journals Online (AJOL)
Preet khandelwal
performance of blends of two existing refrigerant, R-134a and R-600a, blended together at ratios of 11%/89%, ... blending ratios, estimated GWPs ≤ 150 using Ali's model. .... series are less flammable among other HCs and its .... Figure 2: Variation of Evaporator Temperature with Time at an Ambient Temperature of 37oC.
2010-01-01
... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This... consumption, but instead calculate the energy use rate (kWh/100 lbs Ice) by dividing the energy consumed...
Measurement of the effective thermal cross section of {sup 134}Cs by triple neutron capture reaction
Energy Technology Data Exchange (ETDEWEB)
Nakamura, Shoji; Harada, Hideo; Katoh, Toshio [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro; Kobayashi, Katsutoshi; Motoishi, Shoji; Tanase, Masakazu
1998-03-01
The effective thermal cross section ({sigma}{sub eff}) of the {sup 134}Cs(n,{gamma}){sup 135}Cs reaction was measured by the activation method and the {gamma}-ray spectroscopic method in order to obtain fundamental data for research on the transmutation of nuclear wastes. The effective thermal cross section of the reaction {sup 134}Cs(n,{gamma}){sup 135}Cs was found to be 140.6{+-}8.5 barns. (author)
Inoue, Yoshinori; Sugano, Norihide; Jibiki, Masatoshi; Kudo, Toshifumi; Iwai, Takehisa
2008-01-01
Problems associated with prosthetic graft replacement are stenosis at the anastomosis site and thrombus formation on the inner surface. Cilostazol is known to have antiplatelet activity and inhibit vascular smooth muscle cell proliferation and neointima thickening. A cilostazol derivative, (-)-6-[3-[3-cyclopropyl-3-[(1R,2R)-2-hydroxycyclohexyl]ureido]-propoxy]-2-(1H)-quinolinone (K-134), has more potent anti-platelet activity and anti-neointimal thickening activity than cilostazol in the in-vitro platelet aggregation and in-vivo anti-hyperplastic activity assay. The aim of this study was to investigate effects of cilostazol and K-134 on thrombus formation and neointimal thickening at the site of prosthetic graft replacement. Beagle dogs underwent infrarenal abdominal aortic resection with straight Dacron graft replacement, which were allocated to the control, cilostazol, and K-134 groups. Two dogs were dead without confirming the cause of death. After 6 months, all dogs were necropsied. All prosthetic grafts were patent in each group. Ratios of red thrombus to prosthetic graft area were 0.3+/-6.4%, and 3.3+/-4.5% in the cilostazol and K-134 groups, respectively, which were significant different from that in the control group (24.4+/-16.8%). However, no clear difference was seen among the 3 groups with respect to neointimal thickness (control group, 0.70+/-0.13 mm; cilostazol group, 0.59+/-0.14 mm; K-134 group, 0.67+/-0.14 mm). Cilostazol and K-134 significantly inhibited thrombus formation on the inner surface of the prosthetic graft at 6 months after graft replacement. Neointimal thickening on the inner surface was slight even in control-group animals, and the effects of cilostazol and K-134 on such thickening were unclear.
International Nuclear Information System (INIS)
Zhu Shoupeng; Xia Fen; Yang Weidong
1993-05-01
A fitted equation to describe the retention of 134 Cs in whole body is obtained by a whole body counter. The equation consists of two half-life components, the fast component is T 1/2 = 0.07 d and the slow component is T 1/2 = 16.14 d. Two fitted equations describing the retention of 134 Cs in skeleton and testes are also introduced. The T 1/2 in skeleton is 5.73 d and in testes is 5.21 d. The results of investigating radioimmunotoxicological effect induced by 134 Cs show that the inhibition of thymus cells is higher than bone marrow cells, the spleen T-lymphocytes is more sensitive to 134 Cs than B-lymphocytes and lymphocytes of peripheral immune organ are more sensitive to radiation than central immune cells and thymus cells. The study of radiogenotoxicological effect induced by 134 Cs shows that the chromosome aberration frequencies and PCE micronucleus formation in bone marrow cells are significantly high, it can induce chromosome aberrations of spermatogonia and increases the abnormality of sperm. The relations between injected dose and abnormalities can be expressed by power functions
Energy Technology Data Exchange (ETDEWEB)
Avoscan, L
2007-06-15
Selenium is an essential trace element for the living organisms but it is very toxic at high concentration. Selenite and selenate oxides, soluble forms, highly toxic and bio-assimilable, are the most prevalent forms in the environment. Some soil micro-organisms play a dominant role and contribute to the natural cycle of selenium. Our study model, Cupriavidus (formerly Ralstonia) metallidurans CH34, a telluric bacterium characteristic of metal-contaminated biotopes, is known to resist selenite by reducing it into elemental selenium, an insoluble and less toxic form of selenium. In order to better understand the mechanisms of selenium reduction in the bacteria, three methods of speciation were combined (XAS (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGEPIXE). They were completed by the direct quantification of selenium accumulated in the bacteria. Speciation analyses highlighted the existence of two mechanisms of reduction of selenium oxides in C. metallidurans CH34. Assimilation transforms selenite and selenate into organic selenium, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental selenium. This way of detoxication is not set up after an exposure to selenate although it is nevertheless possible to detect elemental selenium but in very small amount compared to the exposure of selenite. Seleno-diglutathion is detected in bacteria stressed by an exposure to selenate in medium limited in sulphate. Bacteria exposed to selenite accumulate 25 times more selenium than when they are exposed to selenate. The study of mutants resistant to selenite, which do not express the membrane protein DedA, showed that the accumulation of selenium after exposure to selenite is decreased compared with the wild strain meaning probable link between the transport of selenite and the DedA protein. Finally, selenate would use the sulphate permease
NCBI nr-aa BLAST: CBRC-MLUC-01-0418 [SEVENS
Lifescience Database Archive (English)
Full Text Available ol deshydrogenase (AdhA) [Cupriavidus taiwanensis] emb|CAQ69467.1| putative three-component membrane-bound a...lcohol deshydrogenase (AdhA) [Cupriavidus taiwanensis] YP_002005534.1 0.34 27% ...
13 CFR 134.703 - When must a person file an appeal from an WOSB or EDWOSB protest determination?
2010-01-01
... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false When must a person file an appeal from an WOSB or EDWOSB protest determination? 134.703 Section 134.703 Business Credit and Assistance...
International Nuclear Information System (INIS)
Endo, T.; Sato, S.; Yamamoto, A.
2012-01-01
Average burnup of damaged fuels loaded in Fukushima Dai-ichi reactors is estimated, using the 134 Cs/ 137 Cs ratio method for measured radioactivities of 134 Cs and 137 Cs in contaminated soils within the range of 100 km from the Fukushima Dai-ichi nuclear power plants. As a result, the measured 134 Cs/ 137 Cs ratio from the contaminated soil is 0.996±0.07 as of March 11, 2011. Based on the 134 Cs/ 137 Cs ratio method, the estimated burnup of damaged fuels is approximately 17.2±1.5 [GWd/tHM]. It is noted that the numerical results of various calculation codes (SRAC2006/PIJ, SCALE6.0/TRITON, and MVP-BURN) are almost the same evaluation values of 134 Cs/ 137 Cs ratio with same evaluated nuclear data library (ENDF-B/VII.0). The void fraction effect in depletion calculation has a major impact on 134 Cs/ 137 Cs ratio compared with the differences between JENDL-4.0 and ENDF-B/VII.0. (authors)
27 CFR 478.134 - Sale of firearms to law enforcement officers.
2010-04-01
... AMMUNITION Records § 478.134 Sale of firearms to law enforcement officers. (a) Law enforcement officers... complete Form 4473 or Form 5300.35. The law enforcement officer purchasing the firearm may purchase a...) In Federal law enforcement offices, the supervisor in charge of the office to which the Federal...
Effect of waste mica on transfer factors of 134Cs to spinach and lettuce
International Nuclear Information System (INIS)
Sreenivasa Chari, M.; Manjaiah, K.M.; Sachdev, P.; Sachdev, M.S.
2011-01-01
A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg -1 ) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in 134 Cs-contaminated (at 37 k Bq kg -1 soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average 134 Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg -1 soil. There exists an inverse relationship between the 134 Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)
Clinical, ultrasonographic, and roentgenographic study in 134 asymptomatic gallstone carriers
International Nuclear Information System (INIS)
Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L.
1993-01-01
The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs
Chiramel, Abhilash I; Dougherty, Jonathan D; Nair, Vinod; Robertson, Shelly J; Best, Sonja M
2016-10-15
Selective autophagy of the endoplasmic reticulum (termed ER-phagy) is controlled by members of the FAM134 reticulon protein family. Here we used mouse embryonic fibroblasts from mice deficient in FAM134B to examine the role of the ER in replication of historic (Mayinga) or contemporary (Makona GCO7) strains of Ebola virus (EBOV). Loss of FAM134B resulted in 1-2 log 10 higher production of infectious EBOV, which was associated with increased production of viral proteins GP and VP40 and greater accumulation of nucleocaspid lattices. In addition, only 10% of wild-type cells contained detectable nucleoprotein, whereas knockout of FAM134B resulted in 80% of cells positive for nucleoprotein. Together, these data suggest that FAM134B-dependent ER-phagy is an important limiting event in EBOV replication in mouse cells and may have implications for further development of antiviral therapeutics and murine models of infection. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.
MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism
Directory of Open Access Journals (Sweden)
Liu Yi
2011-09-01
Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.
Lifescience Database Archive (English)
Full Text Available 775_CUPTR Putative PROPIONYL-COA CARBOXYLASE (BETA SUBUNIT) PROTEIN OS=Cupriavidus taiwan...TA SUBUNIT) PROTEIN OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A2850 PE=4 SV=1 Length = 533
Bütof, Lucy; Schmidt-Vogler, Christopher; Herzberg, Martin; Große, Cornelia; Nies, Dietrich H
2017-08-14
Zinc is an essential trace element and at the same time it is toxic at high concentrations. In the beta-proteobacterium Cupriavidus metallidurans the highly efficient removal of surplus zinc from the periplasm is responsible for its outstanding metal resistance. Rather than having a typical Zur-dependent, high-affinity ATP-binding cassette transporter of the ABC protein superfamily for zinc uptake at low concentrations, C. metallidurans instead has the secondary zinc importer ZupT of the ZRT/IRT (ZIP) family. It is important to understand, therefore, how this zinc-resistant bacterium copes when it is exposed to low zinc concentrations. Members of the Zur regulon in C. metallidurans were identified by comparing the transcriptomes of a Δ zur mutant and its parent strain. The consensus sequence of the Zur-binding box was derived for the zupTp promoter-regulatory region using a truncation assay. The motif was used to predict possible Zur-boxes upstream of Zur regulon members. Binding of Zur to these boxes was confirmed. Two Zur-boxes upstream of the cobW 1 gene, encoding a putative zinc chaperone, proved to be required for complete repression of cobW 1 and its downstream genes in cells cultivated in mineral salts medium. A Zur box upstream of each of zur-cobW 2 , cobW 3 and zupT permitted low-expression level of these genes plus their up-regulation under zinc starvation conditions. This demonstrates a compartmentalization of zinc homeostasis in C. metallidurans with the periplasm being responsible for removal of surplus zinc and cytoplasmic components for management of zinc as an essential co-factor, with both compartments connected by ZupT. Importance Elucidating zinc homeostasis is necessary to understand both host-pathogen interactions and performance of free-living bacteria in their natural environment. Escherichia coli acquires zinc under low zinc concentrations by the Zur-controlled ZnuABC importer of the ABC superfamily, and this was also the paradigm for other
Williams, Allan J; Jordan, Faron; King, Gareth; Lewis, Andrew L; Illum, Lisbeth; Masud, Tahir; Perkins, Alan C; Pearson, Richard G
2018-01-15
Osteoporosis treatment with PTH 1-34 injections significantly reduces the incidence of bone fracture. Potential further reductions in fracture rate should be observed through nasal spray delivery to address the poor compliance associated with patient dislike of repeated PTH 1-34 subcutaneous injections. In vitro human osteoblast-like Saos-2 cell intracellular cAMP levels were used to define PTH 1-34 nasal spray formulation bioactivity. The chemically synthesised PTH 1-34 had an EC 50 of 0.76nM. Absorption enhancers polyethylene glycol (15)-hydroxystearate (Solutol ® HS15), poloxamer 407, chitosan or sodium hyaluronate did not diminish the bioactivity of PTH 1-34 within an in vitro cell culture model (p >0.05). We also demonstrated the effectiveness of the transmucosal absorption enhancer Solutol ® HS15 in a nasal spray formulation using a preclinical pharmacokinetic model. In Sprague-Dawley rats without the absorption enhancer the uptake of PTH 1-34 into the blood via intranasal delivery produced a Cmax of 2.1±0.5ng/ml compared to 13.7±1.6ng/ml with Solutol ® HS15 enhancer (p=0.016) and a Cmax14.8±8ng/ml in subcutaneous injections. Together these data illustrate that the nasal spray formulation bioactivity in vitro is not affected by the nasal spray absorption enhancers investigated, and the Solutol ® HS15 nasal spray formulation had an equivalent pharmacokinetic profile to subcutaneous injection in the rat model. The Solutol ® HS15 formulation therefore demonstrated potential as a PTH 1-34 nasal spray formulation for the treatment of osteoporosis. Copyright © 2017. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Hsei-Wei Wang
Full Text Available Diabetes mellitus (DM is a metabolic disease that is increasing worldwide. Furthermore, it is associated with the deregulation of vascular-related functions, which can develop into major complications among DM patients. Endothelial colony forming cells (ECFCs have the potential to bring about medical repairs because of their post-natal angiogenic activities; however, such activities are impaired by high glucose- (HG and the DM-associated conditions. Far-infrared radiation (FIR transfers energy as heat that is perceived by the thermoreceptors in human skin. Several studies have revealed that FIR improves vascular endothelial functioning and boost angiogenesis. FIR has been used as anti-inflammatory therapy and as a clinical treatment for peripheral circulation improvement. In addition to vascular repair, there is increasing evidence to show that FIR can be applied to a variety of diseases, including cardiovascular disorders, hypertension and arthritis. Yet mechanism of action of FIR and the biomarkers that indicate FIR effects remain unclear. MicroRNA-134 (miR-134-5p was identified by small RNA sequencing as being increased in high glucose (HG treated dfECFCs (HG-dfECFCs. Highly expressed miR-134 was also validated in dmECFCs by RT-qPCR and it is associated with impaired angiogenic activities of ECFCs. The functioning of ECFCs is improved by FIR treatment and this occurs via a reduction in the level of miR-134 and an increase in the NRIP1 transcript, a direct target of miR-134. Using a mouse ischemic hindlimb model, the recovery of impaired blood flow in the presence of HG-dfECFCs was improved by FIR pretreatment and this enhanced functionality was decreased when there was miR-134 overexpression in the FIR pretreated HG-dfECFCs. In conclusion, our results reveal that the deregulation of miR-134 is involved in angiogenic defects found in DM patients. FIR treatment improves the angiogenic activity of HG-dfECFCs and dmECFCs and FIR has potential as
Lifescience Database Archive (English)
Full Text Available 016 |pid:none) Xenopus tropicalis methylcrotonoyl... 324 2e-87 CU633749_120( CU633749 |pid:none) Cupriavidus taiwan... 2e-87 CU633749_1505( CU633749 |pid:none) Cupriavidus taiwanensis str. LM... 323
Isotope ratios and chemical fractionation of CO in Lynds 134
International Nuclear Information System (INIS)
Dickman, R.L.; Langer, W.D.
1977-01-01
Mahoney, McCutcheon and Shuter (1976) reported observations of the J = 1 → 0 transition of three isotopes of CO in the dust cloud Lynds 134 using the 4.6 m telescope at Aerospace Corporation. In this paper a new observation of 12 C 17 O is discussed and the question of the ratio 13 C 16 O/ 12 C 18 O across the dust cloud is considered further. (Auth.)
Nagamata, Satoshi; Nagasaka, Miwako; Kawabata, Akiko; Kishimoto, Kenji; Hasegawa, Daiichiro; Kosaka, Yoshiyuki; Mori, Takeshi; Morioka, Ichiro; Nishimura, Noriyuki; Iijima, Kazumoto; Yamada, Hideto; Kawamoto, Shinichiro; Yakushijin, Kimikazu; Matsuoka, Hiroshi; Mori, Yasuko
2018-05-01
CD134 (OX40), which is a cellular receptor for human herpesvirus-6B (HHV-6B) and expresses on activated T cells, may play a key role for HHV-6B replication after allogeneic hematopoietic stem cell transplantation (allo-HSCT). Therefore, we examined the CD134 expression on T cells and HHV-6B replication after allo-HSCT, and analyzed the correlation between them. Twenty-three patients after allo-HSCT were enrolled. The percentages of CD134-positive cells within the CD4 + and CD8 + cell populations were measured by flow cytometry, and the viral copy number of HHV-6B was simultaneously quantified by real-time PCR. The correlation between CD134 and HHV-6B viral load was then statistically analyzed. HHV-6B reactivation occurred in 11 of 23 patients (47.8%). CD134 expression was seen on T cells and was coincident with the time of peak viral load. The percentage of CD134-positive cells decreased significantly when HHV-6B DNA disappeared (p = .005 in CD4 + T cells, p = .02 in CD8 + T cells). In the 4 patients who underwent umbilical cord blood transplantation (UCBT), the viral load varied with the percentage of CD134-positive cells. In the comparison between the HHV-6B reactivation group and non-reactivation group, maximum percentages of CD134-positive cells among CD4 + T cells in reactivation group were significantly higher than those in non-reactivation group (p = .04). This is the first study to show that a correlation of CD134 expression on T cells with HHV-6B replication after allo-HSCT, especially in UCBT. The results possibly indicate that CD134 on T cells plays a key role for HHV-6B replication after allo-HSCT. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Lee, Hae Seung; Jeon, Dong Soon; Kim, Young Lyoul; Kim, Seon Chang
2010-01-01
Experimental investigations have been carried out to examine the evaporative heat transfer characteristics of R-134a with the channel-bending angle (CBA) in microchannel heat exchangers. In this study, we examined the effects of evaporation temperature and Reynolds number of R-134a on the evaporative heat transfer characteristics of R-134a in microchannel heat exchangers with CBAs of 120 .deg. , 150 .deg. , and 180 .deg. under counterflow conditions. Experimental results show that the evaporative heat transfer rate and evaporative heat transfer coefficient increased with an increase in the Reynolds number of R-134a. Further, the evaporative heat transfer rate corresponding to CBAs of 120 .deg. and 150 .deg. increased to values greater than the evaporative heat transfer rate corresponding to 180 .deg. by approximately 17.1% and 13.3%, respectively, for evaporating temperatures in the range 4.9-14.9 .deg. C. The evaporative heat transfer coefficient was affected by the channel angle with increasing evaporative heat transfer coefficient at small channel bending angle
International Nuclear Information System (INIS)
Salar, U.; Khan, K. M.; Naz, F.; Siddiqui, N. I.
2015-01-01
Novel 2-thio substituted 1,3,4-oxadiazole derivatives of santonic acid (13-18) were synthesized. The synthesis of these derivatives was comprised of six steps which start from the basic hydrolysis of santonin 1 to the santoninic acid 2 followed by in situ rearrangement of 2 into santonic acid 3. Santonic acid 3 was then converted into its acyl imidazole derivative 4 followed by hydrazinolysis to give santonic carbohydrazide 5 which was further converted into santonic-1,3,4-oxadiazole-2-thiol 6. Santonic-1,3,4-oxadiazole-2-thiol 6 was alkylated to afford 2-thio substituted 1,3,4-oxadiazole derivatives of santonic acid (13-18). All the synthetic steps were carried out under microwave irradiation in controlled parameters. Compounds 13-18 along with intervening intermediates 5 and 6 were evaluated for their antimicrobial potential. Compound 14 showed appreciably good activity against Staphylococcus epidermidis. On the other hand compounds 6 and 17 demonstrated good activity against Escherichia coli and Shigella flexeneri, respectively. Compound 6 showed good antifungal activity. The synthesized compounds were characterized by different spectroscopy techniques. (author)
Lifescience Database Archive (English)
Full Text Available UPTR Putative uncharacterized protein OS=Cupriavidus taiwanensis (strain R1 / LMG...Cupri... 33 9.9 >tr|B3R9M4|B3R9M4_CUPTR Putative uncharacterized protein OS=Cupriavidus taiwanensis (strain
Directory of Open Access Journals (Sweden)
Vinayak Mahadev Adimule
2014-12-01
Full Text Available In the present work a series of novel derivatives of 8-hydroxy quinolone substituted 1,3,4-oxadiazole compounds were synthesized by convergent synthetic method and studied for their antibacterial and anticancer properties. The cell lines used for cytotoxic evaluation were HeLa, Caco-2 and MCF7. The synthetic chemistry involved conversion of various substituted aromatic acids into ethyl ester 2a-e. The ethyl ester was converted into corresponding carbohydrazide 3a-e. Carbohydrazides are reacted with chloroacetic acid, phosphorous oxytrichloride and irradiated with microwave in order to obtain the various key intermediates 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole 4a-e. The 2-(chloromethyl-5-(substituted phenyl-1,3,4-oxadiazole was reacted with 8-hydroxy quinolone in presence of sodium hydride and obtained a series of 8-hydroxy quinoline substituted 1,3,4-oxadiazoles 5a-e. Among the synthesised compounds, the cytotoxicity of the compound 5b i.e. 8-{[5-(2,4-dichlorophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline against MCF7 with IC50 of 5.3µM and the compound 5e i.e. 8-{[5-(4-bromophenyl-1,3,4-oxadiazol-2-yl]methoxy}quinoline showed MIC of < 6.25µg/mL against Staphylococcus aureus which is comparable with the known standards. The standards used for cytotoxic evaluation was 5-fluorouracil and for antibacterial was nitrofurazone
13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?
2010-01-01
... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a final...
Haase, Karl B.; Busenberg, Eurybiades; Plummer, Niel; Casile, Gerolamo; Sanford, Ward E.
2014-01-01
A new analytical method using gas chromatography with an atomic emission detector (GC–AED) was developed for measurement of ambient concentrations of hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) in soil, air, and groundwater, with the goal of determining their utility as groundwater age tracers. The analytical detection limits of HCFC-22 (difluorochloromethane, CHClF2) and HFC-134a (1,2,2,2-tetrafluoroethane, C2H2F4) in 1 L groundwater samples are 4.3 × 10− 1 and 2.1 × 10− 1 pmol kg− 1, respectively, corresponding to equilibrium gas-phase mixing ratios of approximately 5–6 parts per trillion by volume (pptv). Under optimal conditions, post-1960 (HCFC-22) and post-1995 (HFC-134a) recharge could be identified using these tracers in stable, unmixed groundwater samples. Ambient concentrations of HCFC-22 and HFC-134a were measured in 50 groundwater samples from 27 locations in northern and western parts of Virginia, Tennessee, and North Carolina (USA), and 3 unsaturated-zone profiles were collected in northern Virginia. Mixing ratios of both HCFC-22 and HFC-134a decrease with depth in unsaturated-zone gas profiles with an accompanying increase in CO2 and loss of O2. Apparently, ambient concentrations of HCFC-22 and HFC-134a are readily consumed by methanotrophic bacteria under aerobic conditions in the unsaturated zone. The results of this study indicate that soils are a sink for these two greenhouse gases. These observations contradict the previously reported results from microcosm experiments that found that degradation was limited above-ambient HFC-134a. The groundwater HFC and HCFC concentrations were compared with concentrations of chlorofluorocarbons (CFCs, CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6). Nearly all samples had measured HCFC-22 or HFC-134a that were below concentrations predicted by the CFCs and SF6, with many samples showing a complete loss of HCFC-22 and HFC-134a. This study indicates that HCFC-22 and HFC-134
Dicty_cDB: Contig-U04424-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available _2( CU633751 |pid:none) Cupriavidus taiwanensis str. LMG19... 36 0.93 BT065311_1(...a sp. wRi, complete geno... 33 7.9 >CU633751_2( CU633751 |pid:none) Cupriavidus taiwanensis str. LMG19424 pl
NCBI nr-aa BLAST: CBRC-MMUR-01-1593 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-1593 ref|YP_002007133.1| methionyl-tRNA formyltransferase [Cupriavidus taiwan...ensis] emb|CAQ71072.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Cupriavidus taiwanensis] YP_002007133.1 7.7 32% ...
Synthesis and crystal structure of novel fluorescent 1,3,4-oxadiazole-containing carboxylate ligands
Mikhailov, Igor E.; Popov, Leonid D.; Tkachev, Valery V.; Aldoshin, Sergey M.; Dushenko, Galina A.; Revinskii, Yurii V.; Minkin, Vladimir I.
2018-04-01
Novel chelating ligands, 3-(5-aryl-1,3,4-oxadiazol-2-yl)acrylic acids and their zinc complexes were synthesized and their spectral and luminescent properties studied. The compounds intensively (quantum efficiencies φ = 0.18-0.76) luminesce in nonpolar solvents in the blue-green region (λmaxPL = 458-504 nm) of the spectrum. Molecular and crystal structures of 3-[5-(4-dimethylaminophenyl)-1,3,4-oxadiazol-2-yl]acrylic acid were established using X-ray crystallography. In crystal, the infinite chains of the molecules lie in the parallel planes and are arranged by the "head to tail" type to provide for strong π-π stacking interactions between the layers facilitating appearance of high electron transport properties and formation of excimers.
Test of 134Cs, 85,89Sr leaching rate in a resemble vitrifiable cement waste form
International Nuclear Information System (INIS)
Lin Meiqiong; Wei Feng; Yin Qi; Fan Xianhua; Xu Shengli; Li Yongde
2003-01-01
A novel material--resemble vitrifiable cement for conditioning low and mediate level radioactive waste has been developed. Waste form has been characterized for their physical and chemical performance, phase composition. The cement formulation has been patented. In this experiment the cement is mixed with simulated wastes spiked with 134 Cs and 85,89 Sr by 5 min at least. The Ratio of the waste to the cement is 0.45-0.55. The mixture is packed into cylindrical molds which has the same dimension of diameter and height . The grouts are cured for a period of 28 d in a room temperature curing chamber at an atmospheric pressure. The cured waste form is then completely immersed into deionized water. According to standard GB7023-86, leaching rate of 134 Cs and 85,89 Sr are measured. The result shows that the leaching rate of the species 134 Cs and 85,89 Sr is to be on the order 10 -4 and 10 -5 on the 42 d immersion, respectively and is better than that of commercial cement
International Nuclear Information System (INIS)
Wongwises, Somchai; Kamboon, Amnouy; Orachon, Banchob
2006-01-01
This paper presents an experimental study on the application of hydrocarbon mixtures to replace HFC-134a in automotive air conditioners. The hydrocarbons investigated are propane (R290), butane (R600) and isobutane (R600a). The measured data are obtained from an automotive air conditioning test facility utilizing HFC-134a as the refrigerant. The air conditioner, with a capacity of 3.5 kW driven by a Diesel engine, is charged and tested with four different ratios of hydrocarbon mixtures. The experiments are conducted at the same surrounding conditions. The temperature and pressure of the refrigerant at every major position in the refrigerant loop, the temperature, flow rate and humidity of air, torque and engine speed are recorded and analyzed. The parameters investigated are the refrigeration capacity, the compressor power and the coefficient of performance (COP). The results show that propane/butane/isobutane: 50%/40%/10% is the most appropriate alternative refrigerant to replace HFC-134a, having the best performance of all the hydrocarbon mixtures investigated
International Nuclear Information System (INIS)
Asojo, Oluwatoyin A.; Loukas, Alex; Inan, Mehmet; Barent, Rick; Huang, Jicai; Plantz, Brad; Swanson, Amber; Gouthro, Mark; Meagher, Michael M.; Hotez, Peter J.
2005-01-01
In order to clarify the structural basis of the pathogenesis-related-1 domain, Na-ASP-1, the first multi-domain ASP from the human hookworm parasite N. americanus, has been crystallized. 2.2 Å resolution data have been collected from a crystal belonging to the monoclinic space group P2 1 . Human hookworm infection is a major cause of anemia and malnutrition in the developing world. In an effort to control hookworm infection, the Human Hookworm Vaccine Initiative has identified candidate vaccine antigens from the infective larval stage (L3) of the parasite, including a family of pathogenesis-related-1 (PR-1) proteins known as the ancylostoma-secreted proteins (ASPs). The functions of the ASPs are unknown. In addition, it is unclear why some ASPs have one while others have multiple PR-1 domains. There are no known structures of a multi-domain ASP and in an effort to remedy this situation, recombinant Na-ASP-1 has been expressed, purified and crystallized. Na-ASP-1 is a 406-amino-acid multi-domain ASP from the prevalent human hookworm parasite Necator americanus. Useful X-ray data to 2.2 Å have been collected from a crystal that belongs to the monoclinic space group P2 1 with unit-cell parameters a = 67.7, b = 74.27, c = 84.60 Å, β = 112.12°. An initial molecular-replacement solution has been obtained with one monomer in the asymmetric unit
Energy Technology Data Exchange (ETDEWEB)
Asojo, Oluwatoyin A., E-mail: oasojo@unmc.edu [Eppley Institute for Research in Cancer and Allied Diseases, 987696 Nebraska Medical Center, Omaha, NE 68198-7696 (United States); Loukas, Alex [Department of Microbiology and Tropical Medicine, The George Washington University Medical Center, Washington DC 20037 (United States); Division of Infectious Diseases and Immunology, Queensland Institute of Medical Research, Brisbane, QLD 4006 (Australia); Inan, Mehmet; Barent, Rick; Huang, Jicai; Plantz, Brad; Swanson, Amber; Gouthro, Mark; Meagher, Michael M. [Department of Chemical Engineering, The University of Nebraska-Lincoln, Lincoln, NE 68588-0643 (United States); Hotez, Peter J. [Department of Microbiology and Tropical Medicine, The George Washington University Medical Center, Washington DC 20037 (United States); Eppley Institute for Research in Cancer and Allied Diseases, 987696 Nebraska Medical Center, Omaha, NE 68198-7696 (United States)
2005-04-01
In order to clarify the structural basis of the pathogenesis-related-1 domain, Na-ASP-1, the first multi-domain ASP from the human hookworm parasite N. americanus, has been crystallized. 2.2 Å resolution data have been collected from a crystal belonging to the monoclinic space group P2{sub 1}. Human hookworm infection is a major cause of anemia and malnutrition in the developing world. In an effort to control hookworm infection, the Human Hookworm Vaccine Initiative has identified candidate vaccine antigens from the infective larval stage (L3) of the parasite, including a family of pathogenesis-related-1 (PR-1) proteins known as the ancylostoma-secreted proteins (ASPs). The functions of the ASPs are unknown. In addition, it is unclear why some ASPs have one while others have multiple PR-1 domains. There are no known structures of a multi-domain ASP and in an effort to remedy this situation, recombinant Na-ASP-1 has been expressed, purified and crystallized. Na-ASP-1 is a 406-amino-acid multi-domain ASP from the prevalent human hookworm parasite Necator americanus. Useful X-ray data to 2.2 Å have been collected from a crystal that belongs to the monoclinic space group P2{sub 1} with unit-cell parameters a = 67.7, b = 74.27, c = 84.60 Å, β = 112.12°. An initial molecular-replacement solution has been obtained with one monomer in the asymmetric unit.
7 CFR 947.134 - Establishment of list of manufacturers of potato products.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Establishment of list of manufacturers of potato... AGRICULTURE IRISH POTATOES GROWN IN MODOC AND SISKIYOU COUNTIES, CALIF., AND IN ALL COUNTIES IN OREGON, EXCEPT MALHEUR COUNTY Rules and Regulations Safeguards § 947.134 Establishment of list of manufacturers of potato...
Lifescience Database Archive (English)
Full Text Available e) Dechloromonas aromatica RCB, comp... 315 3e-84 CU633749_120( CU633749 |pid:none) Cupriavidus taiwanensis ...complet... 313 1e-83 CU633749_1505( CU633749 |pid:none) Cupriavidus taiwanensis str. LM... 313 1e-83 protein
Decomposition of SF6-R134a effluents by RF plasma
International Nuclear Information System (INIS)
Joshi, Avinash V.
2012-01-01
The efficiency of recovery achieved by open or closed loop extraction of RPC exhaust gases is in the range of 90-95% under optimum conditions. For a large detector setup operating on one volume change per day basis, a 5% loss amounts to discharging 50 kg of R134a and 0.5 kg of SF 6 into atmosphere every day. The emissions are equivalent to create nearly 50 000 m 3 of carbon dioxide daily. The gas emissions need to be completely converted to safer compounds. The gases such as R134a and SF 6 are stable compounds. In order to decompose these, the mixture is first activated by adding of 50% oxygen and 2% argon and under typical RF plasma conditions of 13.56 MHz, 1 Torr pressure and 0.2 W/cm 2 power density. The chemical reaction takes place on the surface of a silicon electrode. The product of the reaction is mainly SiF 4 (gas), which is further hydrolyzed to form HF solution and silicon hydroxide sludge. More than 90% of the effluent gas mixture can be effectively removed by this method.
Directory of Open Access Journals (Sweden)
Shi Yan
2013-01-01
Full Text Available Abstract Background Lignin materials are abundant and among the most important potential sources for biofuel production. Development of an efficient lignin degradation process has considerable potential for the production of a variety of chemicals, including bioethanol. However, lignin degradation using current methods is inefficient. Given their immense environmental adaptability and biochemical versatility, bacterial could be used as a valuable tool for the rapid degradation of lignin. Kraft lignin (KL is a polymer by-product of the pulp and paper industry resulting from alkaline sulfide treatment of lignocellulose, and it has been widely used for lignin-related studies. Results Beta-proteobacterium Cupriavidus basilensis B-8 isolated from erosive bamboo slips displayed substantial KL degradation capability. With initial concentrations of 0.5–6 g L-1, at least 31.3% KL could be degraded in 7 days. The maximum degradation rate was 44.4% at the initial concentration of 2 g L-1. The optimum pH and temperature for KL degradation were 7.0 and 30°C, respectively. Manganese peroxidase (MnP and laccase (Lac demonstrated their greatest level of activity, 1685.3 U L-1 and 815.6 U L-1, at the third and fourth days, respectively. Many small molecule intermediates were formed during the process of KL degradation, as determined using GC-MS analysis. In order to perform metabolic reconstruction of lignin degradation in this bacterium, a draft genome sequence for C. basilensis B-8 was generated. Genomic analysis focused on the catabolic potential of this bacterium against several lignin-derived compounds. These analyses together with sequence comparisons predicted the existence of three major metabolic pathways: β-ketoadipate, phenol degradation, and gentisate pathways. Conclusion These results confirmed the capability of C. basilensis B-8 to promote KL degradation. Whole genomic sequencing and systematic analysis of the C. basilensis B-8 genome
International Nuclear Information System (INIS)
Choma, J.; Stasiuk, J.
1992-01-01
A mechanism of radioactive cesium-134 adsorption from water solutions on new, inorganic adsorbent composed from 85% of tri ammonium dodecamolibdophosphate(V) and 15% of urea resin is presented. A migration is found of Cs cations into the adsorbent grains. The absorption of Cs-134 beta radiation is studied as a function of WMF-15 tablet thickness. The penetration depth of radionuclide was found to be function of the process duration and the adsorbent density. Diffusion of cesium into the adsorbent grains explains the effect of ''recreation'' of its adsorption capacitance. (author). 2 refs, 2 figs
Nishitani, Kohei; Mietus, Zachary; Beck, Christopher A; Ito, Hiromu; Matsuda, Shuichi; Awad, Hani A; Ehrhart, Nicole; Schwarz, Edward M
2017-01-01
Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34) effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20) received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1) Placebo (n = 5; daily saline), 2) Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op), or 3) Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op). Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT) was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05). These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR) on host bone and graft-host junctions (p<0.05). Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05). Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01). In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.
Directory of Open Access Journals (Sweden)
Kohei Nishitani
Full Text Available Small animal studies have demonstrated significant high-dose recombinant parathyroid hormone1-34 (rPTH1-34 effects on intercalary allograft healing. Towards a human adjuvant therapy to decrease non-unions, we evaluated rPTH1-34 safety and efficacy in a clinically relevant canine femoral allograft model. Adult female mongrel hounds (n = 20 received a 5cm mid-diaphyseal osteotomy reconstructed with a plated allograft, and were randomized to: 1 Placebo (n = 5; daily saline, 2 Continuous rPTH1-34 (n = 7; 5 μg/kg/day s.c. from day 1-55 post-op, or 3 Delayed rPTH1-34 (n = 8; 5 μg/kg/day s.c. from day 14-28 post-op. Safety was assessed by physical behavior and blood calcium monitoring. Cone beam CT (CB-CT was performed on days 14, 28 and 56 post-op to assess 2D cortical healing, 3D bone volume, and Union Ratio. Biomechanical testing and dynamic histomorphometry were also performed. The high drug dose was poorly tolerated, as most dogs receiving rPTH1-34 had to be given intravenous saline, and one dog died from hypercalcemia. Continuous rPTH1-34 significantly increased 2D healing and callus volumes at 4-weeks versus Placebo, and sustained the significant increase in cortical union at 8-week (p<0.05. These rPTH1-34 effects were confirmed by histomorphometry, revealing significant increases in mineral apposition rates (MAR on host bone and graft-host junctions (p<0.05. Delayed rPTH1-34 significantly increased callus volume and MAR at 8 weeks (p<0.05. Although no biomechanical differences were observed, as expected for early healing, the results demonstrated that 2D RUST scoring significantly correlated with torsional biomechanics (p<0.01. In conclusion, 8-weeks of intermittent high-dose rPTH1-34 treatment significantly increases callus formation and accelerates bony union of intercalary massive allografts in a clinically relevant canine model, but with serious side-effects from hypercalcemia.
Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer
International Nuclear Information System (INIS)
Gerking, S.D.; Berg, A.; Gerard, P.
1976-01-01
The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C
International Nuclear Information System (INIS)
Ge Yanqing; Hao Benqian; Duan Guiyun; Wang Jianwu
2011-01-01
A series of novel substituted 1,3,4-oxadiazole derivatives were synthesized by the reaction of 3-butyl-1-chloroimidazo[1,5-a]pyridine-7-carbohydrazide with propionyl chloride and substituted benzoic chloride in the presence of phosphorus oxychloride. The compounds were characterized using IR, 1 H NMR, 13 C NMR and HRMS. Absorption and fluorescence spectra were measured in dichloromethane; an intense absorption maxima was noted at ca. 290 nm and emission maxima was noted at ca. 470 nm. The absorption spectra of the 1,3,4-oxadiazole derivatives reveal that a phenyl and an ethyl group attached to the 1,3,4-oxadiazole ring markedly influenced the maximum absorption. The structures based on density function theory (DFT) calculation show planar configurations for the compounds. The calculated molecular orbital correlates well with their absorption. - Research highlights: → Novel imidazo[1,5-a]pyridine derivatives were synthesized. → The structures were determined by IR, 1 H NMR, 13 C NMR and HRMS spectra. → We investigated the absorption and fluorescence spectral characteristics of the compounds. → The side group in 1,3,4-oxadiazole ring can affect its photophysical properties markedly. → Quantum calculation correlates well with their absorption.
Transfer of Chernobyl-derived 134Cs, 137Cs, 131I and 103Ru from flowers to honey and pollen
International Nuclear Information System (INIS)
Bunzl, K.; Kracke, W.
1988-01-01
The activity concentrations of 137 Cs, 134 Cs, 131 I and 103 Ru were determined separately in honey and pollen samples collected from a single bee colony during several months after the deposition of Chernobyl fallout. The source of each honey and pollen sample was determined by pollen analysis. Although the activity concentrations in honey and pollen varied with time, the concentrations of 137 Cs and 134 Cs were, in general, higher in pollen than in honey. For 103 Ru and 131 I, these differences were comparatively small. The mean 131 I/ 137 Cs and 103 Ru/ 137 Cs ratios were about one order of magnitude higher in honey than in pollen. The mean 131 I/ 103 Ru ratio was about the same for honey and pollen. This observation, in the light of the corresponding nuclide ratios found in the deposition, suggests that 137 Cs, 134 Cs, 131 I and 103 Ru were taken up by the plant leaves and transported to nectar and pollen. The higher activity concentrations of 137 Cs and 134 Cs in pollen, relative to honey, indicate that these radionuclides behave analogously to potassium, which is also found in higher quantities in pollen. (author)
New 1,3,4-Oxadiazole Based Photosensitizers for Dye Sensitized Solar Cells (DSSCs
Directory of Open Access Journals (Sweden)
Umer Mehmood
2015-01-01
Full Text Available 1,3,4-Oxadiazole based photosensitizers with biphenyl, naphthalene, anthracene, and triphenylamine as the electron-donating moiety were synthesized for solar cell applications. In these photosensitizers, cyano groups were introduced as the electron acceptor and the anchor group because of their high electron-withdrawing ability and strong bonding to the semiconductor. Oxadiazole isomers were used as the π-conjugation system, which bridges the donor-acceptor systems. The electrochemical and optical properties of the sensitizers were investigated both in their native form and upon incorporation into dye sensitized solar cells. The results of UV-visible absorption spectroscopy, electrochemical impedance spectroscopic measurements, and photocurrent voltage characteristics indicate that 1,3,4-oxadiazole pi-spacer with the anthracene moiety has the highest efficiency of 2.58%. Density functional theory was employed to optimize the structures of the sensitizers and the TiO2 cluster.
Energy Technology Data Exchange (ETDEWEB)
Sreenivasa Chari, M.; Manjaiah, K.M. [Indian Agricultural Research Institute, Division of Soil Science and Agricultural Chemistry, New Delhi - 110012 (India); Sachdev, P.; Sachdev, M.S. [Indian Agricultural Research Institute, Nuclear Research Laboratory, New Delhi - 110012 (India)
2011-07-15
A greenhouse pot culture experiment was conducted to study the effect of graded levels of waste mica (0, 10, 20 and 40 g kg{sup -1}) on reducing the radiocesium uptake by spinach (Spinacia olerecea L) and lettuce (Lactuca sativa L.) grown in {sup 134}Cs-contaminated (at 37 k Bq kg{sup -1} soil) Inceptisols, Vertisols and Ultisols. The biomass yield, and potassium content and its uptake by crops have been significantly improved by waste mica application. The crops grown in Vertisols recorded higher biomass yield, and K content and its uptake as compared with Inceptisols and Ultisols. The average {sup 134}Cs transfer factor values recorded were: 0.21, 0.17 and 0.26 at the first cutting, 0.15, 0.12 and 0.28 at the second cutting and 0.07, 0.05 and 0.23 at the third cutting from Inceptisols, Vertisols and Ultisols, respectively. Waste mica significantly suppressed radiocesium uptake, the effect being more pronounced at 40 g mica kg{sup -1} soil. There exists an inverse relationship between the {sup 134}Cs transfer factors with plant potassium content and also the K uptake by the crops. (authors)
Lifescience Database Archive (English)
Full Text Available chloromonas aromatica RCB, comp... 315 2e-84 CU633749_120( CU633749 |pid:none) Cupriavidus taiwan...et... 313 9e-84 CU633749_1505( CU633749 |pid:none) Cupriavidus taiwanensis str. LM... 313 9e-84 (Q5XIT9) Rec
20 CFR 220.134 - Medical-vocational guidelines in appendix 2 of this part.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Medical-vocational guidelines in appendix 2... THE RAILROAD RETIREMENT ACT DETERMINING DISABILITY Vocational Considerations § 220.134 Medical-vocational guidelines in appendix 2 of this part. (a) The Dictionary of Occupational Titles includes...
Itai, Shunsuke; Yamada, Shinji; Kaneko, Mika K; Chang, Yao-Wen; Harada, Hiroyuki; Kato, Yukinari
2017-12-01
Epidermal growth factor receptor (EGFR), a receptor tyrosine kinase, activates downstream signaling cascades in many tumors. In this study, we established novel anti-EGFR monoclonal antibodies (mAbs) and characterized their efficacy in flow cytometry, Western blot, and immunohistochemical analyses. We immunized mice with a combination of the extracellular domain of EGFR and EGFR-overexpressing LN229 glioblastoma cells (LN229/EGFR) and performed the first screening using enzyme-linked immunosorbent assay. Next, we selected mAbs using flow cytometry. Among 156 established clones, two mAbs, EMab-51 (IgG 1 , kappa) and EMab-134 (IgG 1 , kappa), reacted with EGFR in Western blot analysis; EMab-134 showed a much higher sensitivity compared with EMab-51. We compared the binding affinities of EMab-51 and EMab-134 using flow cytometry; the calculated K D values for EMab-51 and EMab-134 against SAS cells/HSC-2 cells were 9.2 × 10 -9 M/9.9 × 10 -9 M and 2.6 × 10 -9 M/8.3 × 10 -9 M, respectively, indicating that EMab-134 has a higher affinity to EGFR-expressing cells. Immunohistochemical analysis of EMab-51 and EMab-134 showed sensitive and specific reactions against oral cancer cells; EMab-134 demonstrated a much higher sensitivity (36/38 cases; 94.7%) to oral squamous cell carcinomas compared with EMab-51 (6/38 cases; 15.8%). This novel anti-EGFR mAb, EMab-134, could be advantageous for detecting EGFR in the pathological analysis of EGFR-expressing cancers.
The two most economically important diseases of grapevine cultivation worldwide are caused by the fungal pathogen powdery mildew (Erysiphe necator syn. Uncinula necator) and the oomycete, downy mildew (Plasmopara viticola). These pathogens, endemic to North America, were introduced into Europe in t...
134Cs-transport in an experimental ecological system
International Nuclear Information System (INIS)
Mocsy, Ildiko; Uray, Ildiko; Salagean, Stefania
1986-01-01
An experimental aquatic ecosystem was developed consisting of river water, slurry, algae and crustaceans. The change of the cesium concentration factor (F c ) of two alga species were measured using 20 Bq/ml of 134 CsCl. Measurements were performed in the 6th, 12th, 24th, 48th and 72nd hour after irradiation. F c in crustaceans was found to be 1300 in the 12th hr, then decreased rapidly down to 275. The temporal dependence of cesium accumulation in slurry increased consistently. It was found that algae accumulated cesium variously. Owing to its high accumulation, Cladophora glomerata can be used as a biological indicator of cesium concentration in surface waters. (K.I.)
Coulomb excitation of neutron-rich $^{134-136}$Sn isotopes
We propose to study excited states in the isotopes $^{134,136}$Sn by $\\gamma$-ray spectroscopy following "safe" Coulomb excitation. The experiment aims to investigate the evolution of quadrupole collectivity beyond the magic shell closure at N = 82 by the determination of B(E2) values and electric quadrupole moments $\\mathcal{Q}_2$. Recent shell-model calculations using realistic interactions predict possible enhanced collectivity in neutron-rich regions. Evidence for this could be obtained by this experiment. Furthermore, the currently unknown excitation energies of the 2$^+_{1}$ and 4$^+_{1}$ states in $^{136}$Sn will be measured for the first time.
DEFF Research Database (Denmark)
Jepsen, Ditte Beck; Ryg, Jesper; Jørgensen, Niklas Rye
2018-01-01
Background: PaVOS is a randomized controlled trial (RCT) which aims to address the use of whole-body vibration exercise (WBV) in combination with parathyroid hormone 1-34 fragment teriparatide (PTH 1-34) treatment in patients with osteoporosis. PTH 1-34 is an effective but expensive anabolic...... fracture risk. Methods/design: PaVOS is a multicenter, assessor-blinded, superiority, two-armed randomized controlled trial (RCT). Postmenopausal women (n = 40, aged 50 years and older) starting taking PTH 1-34 from outpatient clinics will be randomized and assigned to a PTH 1-34 + WBV-exercise group...... (intervention group), or a PTH 1-34-alone group (control group). The intervention group will undergo WBV three sessions a week (12 min each, including 1:1 ratio of exercise: rest, 30 Hz, 1 mm amplitude) for a 12-month intervention period. Both the intervention and the control group will receive PTH 1...
International Nuclear Information System (INIS)
Avoscan, L.
2007-06-01
Selenium is an essential trace element for the living organisms but it is very toxic at high concentration. Selenite and selenate oxides, soluble forms, highly toxic and bio-assimilable, are the most prevalent forms in the environment. Some soil micro-organisms play a dominant role and contribute to the natural cycle of selenium. Our study model, Cupriavidus (formerly Ralstonia) metallidurans CH34, a telluric bacterium characteristic of metal-contaminated biotopes, is known to resist selenite by reducing it into elemental selenium, an insoluble and less toxic form of selenium. In order to better understand the mechanisms of selenium reduction in the bacteria, three methods of speciation were combined (XAS (XANES and EXAFS), HPLC-ICP-MS and SDS-PAGEPIXE). They were completed by the direct quantification of selenium accumulated in the bacteria. Speciation analyses highlighted the existence of two mechanisms of reduction of selenium oxides in C. metallidurans CH34. Assimilation transforms selenite and selenate into organic selenium, identified as seleno-methionine and leads to its non-specific incorporation into bacterial proteins (presence of selenious proteins). Detoxication precipitates selenite in nano-particles of elemental selenium. This way of detoxication is not set up after an exposure to selenate although it is nevertheless possible to detect elemental selenium but in very small amount compared to the exposure of selenite. Seleno-diglutathion is detected in bacteria stressed by an exposure to selenate in medium limited in sulphate. Bacteria exposed to selenite accumulate 25 times more selenium than when they are exposed to selenate. The study of mutants resistant to selenite, which do not express the membrane protein DedA, showed that the accumulation of selenium after exposure to selenite is decreased compared with the wild strain meaning probable link between the transport of selenite and the DedA protein. Finally, selenate would use the sulphate permease
Directory of Open Access Journals (Sweden)
Khadija Nafeesa
2017-12-01
Full Text Available A new series of N-substituted derivatives of 2-[(5-{1-[(4-chlorophenylsulfonyl]-3-piperidinyl}-1,3,4-oxadiazol-2-ylsulfanyl]acetamide (6a-w has been designed and synthesized with multifunctional moieties. The synthesized compounds were evaluated for their antibacterial and anti-enzymatic potential supported by % hemolytic activity. The synthesized compound 5-(1-(4-chlorophenylsulfonyl-3-piperidinyl-1,3,4-oxadiazole-2-thiol (3 was stirred with synthesized electrophiles as N-aryl/alkyl/aralkyl-2-bromoacetamide (5a-w in an aprotic solvent under basic conditions to acquire the target molecules, 6a-w. The spectral analytical techniques of IR, EI-MS, 1H NMR and 13C-NMR were utilized for structural elucidation of synthesized molecules. The antibacterial screening against certain bacterial strains of gram-negative and gram-positive bacteria rendered compound 6i as good inhibitor of gram-negative bacterial strains. The enzyme inhibition revealed low potential against lipoxygenase (LOX enzyme. The hemolytic study provided valuable information about cytotoxic behavior of synthesized molecules. Keywords: 1,3,4-Oxadiazole, Acetamide, Antibacterial activity, Hemolytic activity, Lipoxygenase inhibition
Energy Technology Data Exchange (ETDEWEB)
Teherani, D K
1987-09-14
Various samples from Styria (grass) and Salzburg (cheese) were analyzed for /sup 131/I, /sup 134/Cs and /sup 137/Cs concentration during April - July 1986 by ..gamma..-ray spectroscopy. The concentrations are reported in nCi kg/sup -1/ wet weight. The values found for /sup 131/I were 0.2-17.2 (grass), 0.1-0.5 (cheese), for /sup 134/Cs 1.1-6.2 (grass), 0.2-1.3 (cheese), for /sup 137/Cs 1.6-15.7 (grass), 0.3-2.2 (cheese). While radioactivity of /sup 131/I, /sup 134/Cs and /sup 137/Cs in cheese samples increased from May to June, it decreased in grass samples from May to July. (author) 5 refs
Synthesis and Antifungal Activity of Novel Sulfone Derivatives Containing 1,3,4-Oxadiazole Moieties
Directory of Open Access Journals (Sweden)
Maoguo Tong
2011-11-01
Full Text Available A series of new sulfone compounds containing 1,3,4-oxadiazole moieties were synthesized. The structures of these compounds were confirmed by spectroscopic data (IR, 1H- and 13C-NMR and elemental analyses. Antifungal tests indicated that all the title compounds exhibited good antifungal activities against eight kinds of plant pathogenic fungi, and some showed superiority over the commercial fungicide hymexazol. Among them, compounds 5d, 5e, 5f, and 5i showed prominent activity against B. cinerea, with determined EC50 values of 5.21 μg/mL, 8.25 µg/mL, 8.03 µg/mL, and 21.00 µg/mL, respectively. The present work demonstrates that sulfone derivatives such as 5d containing a 1,3,4-oxadiazole moiety can be used as possible lead compounds for the development of potential agrochemicals.
Compatibility of manufacturing process fluids with R-134a and polyolester lubricant. Final report
Energy Technology Data Exchange (ETDEWEB)
Cavestri, R.C.; Schooley, D.L. [Imagination Resources, Inc., Dublin, OH (United States)
1996-07-01
This report includes a broad list of processing fluids that are known to be used to manufacture air conditioning and refrigeration products. Sixty-four process fluids from this list were selected for compatibility studies with R-134a and ICI EMKARATE RL32H (32 ISO) polyolester lubricant. Solutions or suspensions of the process fluid residues in polyolester lubricant were heated for 14 days at 175{degrees}C (347{degrees}F) in evacuated sealed glass tubes containing only valve steel coupons. Miscibility tests were performed at 90 wt.% R-134a, 10 wt.% polyolester lubricant with process fluid residue contaminate and were scanned in 10{degrees}C (18{degrees}F) increments over a temperature range of ambient to -40{degrees}C (-40{degrees}F). Any sign of turbidity, haze formation or oil separation was considered the immiscibility point.
2010-01-01
... APPEALS Rules of Practice for Appeals From Women-Owned Small Business Concern (WOSB) and Economically... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who can file a response to an appeal petition and when must such a response be filed? 134.710 Section 134.710 Business Credit and...
Lifescience Database Archive (English)
Full Text Available t_id B2AIZ9 Definition tr|B2AIZ9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain...Z9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain R1
Cs-134 transfer from water or food to the Ciprinid Tinca tinca Linnaeus: uptake and loss kinetics
International Nuclear Information System (INIS)
Corisco, J.A.G.; Carreiro, M.C.V.
1991-01-01
Experiments with 134 Cs and the fish Tinca tinca Linnaeus (fam. Cyprinidae), as a part of a more extensive work, concerning a simplified freshwater trophic chain using water from Fratel dam, (at Tejo River), were undertaken. Direct uptake from water, during a period of about 30 days, leads to a kinetics expressed by the power function: CF (t) = 0.58 t 0.781 (t in days), the concentration factor (CF) referred to wet weight. Retention study, showed the existence of two biological half-lives, Tb 1 = 7 days and Tb 2 = 87 days, which might concern respectively, the 134 Cs desorption from the transit organs and the loss of the assimilated isotope from the storage organs. In the accumulation through the food chain, using planktonic crustacean Daphnia magna Straus (Cladocera) as prey, a transfer factor (TF) related to wet weight of both fish and prey, is estimated through the power function: TF (t) = 0.022 t 0.578 (t in days). Finally, the retention study following the food pathway contamination, stresses the existence of one long term component, with half-life Tb = 61 days. The transfer factor kinetics seems to point out to a rather slow process, leading to lower 134 Cs concentration values, than the contamination through the water. The loss of the assimilated 134 Cs, uptaken through both pathways, water or food, is a slow process. The longer biological half-life is very important in Radiological Protection, once it may be attributed to the radionuclide loss from the muscular mass. (author)
International Nuclear Information System (INIS)
Massas, I.; Skarlou, V.; Haidouti, C.; Giannakopoulou, F.
2010-01-01
Three rates of Ca(OH) 2 were applied to an acid soil and the 134 Cs uptake by radish, cucumber, soybean and sunflower plants was studied. The 134 Cs concentration in all plant species was reduced from 1.6-fold in the sunflower seeds to 6-fold in the soybean vegetative parts at the higher Ca(OH) 2 rate. Potassium (K) concentration in plants was also reduced, but less effectively. The significantly decreased 134 Cs-K soil to plant distribution factors (D.F.) clearly suggest a stronger effect of soil liming on 134 Cs than on K plant uptake. This observation was discussed in terms of ionic interactions in the soil matrix and within the plants. The results also indicated that the increased Ca 2+ concentration in the exchange phase and in the soil solution along with the improved root activity, due to the soil liming, enhanced the immobilization of 134 Cs in the soil matrix and consequently lowered the 134 Cs availability for plant uptake.
Viscosity Measurements and Correlations for 1,1,1,2-tetrafluoroethane (HFC-134a) up to 140 MPa
DEFF Research Database (Denmark)
Comuñas, M.J.P.; Baylaucq, A.; Cisneros, Sergio
2003-01-01
In spite of being one of the most studied refrigerants, large discrepancies in the experimental determination of the dynamic viscosity of 1, 1, 1,2-tetrafluoroethane (HFC-134a) prevail. Additionally, there is a need for supplementary high-pressure measurements that can help to derive sound general...... correlations for the viscosity of this compound. Hence, in this work new dynamic viscosity measurements for HFC-134a using a falling-body viscometer in the temperature range of 293.15-373.15 K and pressures up to 140 MPa are presented. This work high-pressure data in combination with already published data...
Energy Technology Data Exchange (ETDEWEB)
De Rossi, Filippo; Mastrullo, Rita; Mazzei, Pietro [Naples Univ. (Italy)
1993-05-01
A software package for both the computation of thermodynamic properties and the analysis of the usual vapour compression plant schemes is a useful tool for air conditioning and refrigeration researchers and manufacturers. At present, it could make an important contribution to the search for CFC substitutes; in fact, comparisons between two or more working fluids could be accomplished more easily. A program created by the authors is presented by means of some demonstrative diagrams referring to a comparison between the ''ozone killer'' R12 and its substitute R134a. An R134a exergy-enthalpy chart is also provided. (Author)
Energy Technology Data Exchange (ETDEWEB)
Shrestha, Som [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sharma, Vishaldeep [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Abdelaziz, Omar [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-02-18
This report investigates the tested performance of lower - GWP candidate refrigerant, 94.07 wt% R - 32 + 5.93 wt % R - 134 a mixture (hereafter referred to as R - 32/134a), as an alternative to baseline refrigerant R - 410 A using a 36,000 Btu/hr compressor calorimeter located at the Heat Exchanger Advanced Testing Facility at Oak Ridge National Laboratory . These tests were conducted during May and August 2013. R - 410A is a near - azeotropic blend of R - 32 and R - 125 with 0.5/0.5 mass fraction and has a GWP 100 of 2100. R - 32 and R - 134a are pure refrigerants and have GWP 100 of 716 and 1370 1, respectively. Based on the GWP 100 values of pure refrigerants and their mass fraction in the blend, GWP 100 of R - 32/134a, which is under development by National Refrigerant, is 755. This report compares various performance parameters, such as cooling capacity, compressor power, refrigerant mass flow rate, EER, isentropic efficiency and discharge temperature of the alternative refrigerant to that of R - 410 A.
International Nuclear Information System (INIS)
Skarlou, V.; Massas, I.; Anoussis, J.; Haidouti, C.; Arapis, G.
1999-01-01
The effect of soil pH and the fungicide 'Captan' on 134 Cs transfer factors (TFs) was studied in a greenhouse pot experiment with cucumber and radish plants. A soil with a low pH (4.2) was selected and its pH value has increased to 5.7, 6.5 and 7.6 by the addition of different amounts of Ca(OH) 2 . Liming of the soil and the subsequent increase in pH values resulted in a reduction of 134 Cs TFs which was not always significant. TFs were the highest in the very acid soil (pH 4.2) and were practically the same above the pH 5.7 although they were the lowest in the calcareous soil. The ratio highest / lowest TF of each crop or plant part ranged between ∼ 2.0 for radish and 4.5 for cucumber plants and it was much lower than that previously reported and attributed to pH differences. Edible to other plant material TF ratio indicates that cucumber plant accumulates considerably more of the totally absorbed 134 CS in the edible part than radish crops. When biomass production was used for excluding dilution effects, 134 CS total activity (Bq/pot) was higher for both plants when grown in the intermediate soil pH (5.7 - 6.5), due to the higher yield at these pH values. The application of the fungicide 'Captan' gave no significant differences in 134 Cs TFs for both plant species and in all studied soil pH. Refs. 4 (author)
Idiopathic urolithiasis in Tunisian children: A report of 134 cases
Directory of Open Access Journals (Sweden)
A Alaya
2013-01-01
Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.
International Nuclear Information System (INIS)
Aprea, Ciro; Greco, Adriana; Maiorino, Angelo
2016-01-01
Highlights: • An experimental comparison between R134A and HFO1234YF is presented. • A domestic refrigerator made to work with R134A is analysed. • The annual energy consumptions of the device are reported. • The energy saving achievable after the drop-in is evaluated. - Abstract: The latest international regulations on the reduction of greenhouse gases are strongly redesigning the scenario of use of refrigerants, gradually eliminating the possibility of employing the HFCs. Among all sectors of refrigeration, one of the most affected by these restrictions is the domestic refrigeration. Although for it have been suggested some solutions, such as the construction of household refrigerator operating with the hydrocarbons, there remains the need to find a substitute for HFC134a. In particular, the substitution may involve both existing machines and already in operation, which cannot be loaded with hydrocarbons, and new devices. With the aim of finding a simple implementation solution, in the present work, it is reported an experimental investigation carried out on a domestic refrigerator designed and built to operate with HFC134a and for which a drop-in with HFO1234yf has been realised. The experimentation has been addressed so as to highlight the behaviour of the system as a result of the drop-in, with a particular interest in the energy performance variation. A slight energy saving has been recorded with HFO1234yf, and an improving of the cooling capacity has been noticed.
Ll, Jin; Sato, Haruki; Watanabe, Koichi
On the basis of critically-evaluated thermodynamic property data among those recently published, a new Peng-Robinson equation of state for the HFC refrigerants,R-32,R-125 and R-134a,has be end eveloped so as to represent the VLE properties in the vapor-liquid coexisting phase at temperatures 223K-323K. In accord with a challenge to correlate the binary and/or ternary interatction parameters as functions of temperature, we have also applied the present modified Peng-Robinson equation of state to the promising alternative HFC refrigerant mixtures, i.e., R-32/125,R-32/134a and R-32/125/134a systems. The developed equation of state improves significantly its effectiveness for practical engineering property calculations at refrigerantion and air-conditioning industries in comparison with conventional Peng-Robinson equation.
2010-07-01
... STUDENT ASSISTANCE GENERAL PROVISIONS Immigration-Status Confirmation § 668.134 Institutional policies and... immigration status of applicants for title IV, HEA student financial assistance who claim to meet the... eligible noncitizen until the institution has provided the student the opportunity to submit the...
Effect of Rain Acidity Upon Mobility of Cs-134 and Co-60 in Soil
International Nuclear Information System (INIS)
Ruangchuay, S.; Harvey, N.W.; Sriyotha, P.
1998-01-01
This research was aimed to study the effects of groundwater and acid rain upon the mobility of radionuclides (Cs-134 and Co-60) in contaminated top soil. Clay soil was homogeneously packed in columns with dimension φ.12.5 cm. * 50 cm.. At the top 5 cm. of the columns, soil contaminated with radionuclides was added with the same consistency. Column were kept standing for 4 months in an artificial water table kept at 3 cm. from the bottom. During this period artificial acid rain with pH3, 4.5 and 6 was applied weekly at the top. Soil samples were taken every 30 days for examination of total and extracable radioactivity. It was shown that with the aide of the rain radionuclide movement down the profile was greater, with Co-60 > Cs-134. However acidity of the rain shown no effect on their movement
Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds
Directory of Open Access Journals (Sweden)
Lei Zhou
2017-11-01
Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.
Size control and catalytic activity of bio-supported palladium nanoparticles.
Søbjerg, Lina Sveidal; Lindhardt, Anders T; Skrydstrup, Troels; Finster, Kai; Meyer, Rikke Louise
2011-07-01
The development of nanoparticles has greatly improved the catalytic properties of metals due to the higher surface to volume ratio of smaller particles. The production of nanoparticles is most commonly based on abiotic processes, but in the search for alternative protocols, bacterial cells have been identified as excellent scaffolds of nanoparticle nucleation, and bacteria have been successfully employed to recover and regenerate platinum group metals from industrial waste. We report on the formation of bio-supported palladium (Pd) nanoparticles on the surface of two bacterial species with distinctly different surfaces: the gram positive Staphylococcus sciuri and the gram negative Cupriavidus necator. We investigated how the type of bacterium and the amount of biomass affected the size and catalytic properties of the nanoparticles formed. By increasing the biomass:Pd ratio, we could produce bio-supported Pd nanoparticles smaller than 10nm in diameter, whereas lower biomass:Pd ratios resulted in particles ranging from few to hundreds of nm. The bio-supported Pd nanoparticle catalytic properties were investigated towards the Suzuki-Miyaura cross coupling reaction and hydrogenation reactions. Surprisingly, the smallest nanoparticles obtained at the highest biomass:Pd ratio showed no reactivity towards the test reactions. The lack of reactivity appears to be caused by thiol groups, which poison the catalyst by binding strongly to Pd. Different treatments intended to liberate particles from the biomass, such as burning or rinsing in acetone, did not re-establish their catalytic activity. Sulphur-free biomaterials should therefore be explored as more suitable scaffolds for Pd(0) nanoparticle formation. Copyright © 2011 Elsevier B.V. All rights reserved.
Fe-phyllosilicate redox cycling organisms from a redox transition zone in Hanford 300 Area sediments
Directory of Open Access Journals (Sweden)
Jason eBenzine
2013-12-01
Full Text Available Microorganisms capable of reducing or oxidizing structural iron (Fe in Fe-bearing phyllosilicate minerals were enriched and isolated from a subsurface redox transition zone at the Hanford 300 Area site in eastern Washington, USA. Both conventional and in situ i-chip enrichment strategies were employed. One Fe(III-reducing Geobacter (G. bremensis strain R1, Deltaproteobacteria and six Fe(II phyllosilicate-oxidizing isolates from the Alphaproteobacteria (Bradyrhizobium japonicum strains 22, is5, and in8p8, Betaproteobacteria (Cupriavidus necator strain A5-1, Dechloromonas agitata strain is5, and Actinobacteria (Nocardioides sp. strain in31 were recovered. The G. bremensis isolate grew by oxidizing acetate with the oxidized form of NAu-2 smectite as the electron acceptor. The Fe(II-oxidizers grew by oxidation of chemically reduced smectite as the energy source with nitrate as the electron acceptor. The Bradyrhizobium isolates could also carry out aerobic oxidation of biotite. This is the first report of the recovery of a Fe(II-oxidizing Nocardioides, and to date only one other Fe(II-oxidizing Bradyrhizobium is known. The 16S rRNA gene sequences of the isolates were similar to ones found in clone libraries from Hanford 300 sediments and groundwater, suggesting that such organisms may be present and active in situ. Whole genome sequencing of the isolates is underway, the results of which will enable comparative genomic analysis of mechanisms of extracellular phyllosilicate Fe redox metabolism, and facilitate development of techniques to detect the presence and expression of genes associated with microbial phyllosilicate Fe redox cycling in sediments.
Magnetic and magnetocaloric properties of spin-glass material DyNi{sub 0.67}Si{sub 1.34}
Energy Technology Data Exchange (ETDEWEB)
Chen, X. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); College of Physics and Electronic Information Engineering, Neijiang Normal University, Neijiang 641100 (China); Mudryk, Y., E-mail: slavkomk@ameslab.gov [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pathak, A.K.; Feng, W. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Pecharsky, V.K. [The Ames Laboratory, U.S. Department of Energy, Iowa State University, Ames, IA 50011-3020 (United States); Department of Materials Science and Engineering, Iowa State University, Ames, IA 50011-2300 (United States)
2017-08-15
Highlights: • Spin-glass state is observed in the DyNi{sub 0.67}Si{sub 1.4} compound. • Random Ni/Si distribution in the AlB{sub 2}-type structure leads to magnetic frustration. • Magnetic frustration affects magnetic field dependence of magnetocaloric effect. - Abstract: Structural, magnetic, and magnetocaloric properties of DyNi{sub 0.67}Si{sub 1.34} were investigated using X-ray powder diffraction, magnetic susceptibility, and magnetization measurements. X-ray powder diffraction pattern shows that DyNi{sub 0.67}Si{sub 1.34} crystallizes in the AlB{sub 2}-type hexagonal structure (space group: P6/mmm, No. 191, a = b = 3.9873(9) Å, and c = 3.9733(1) Å). The compound is a spin-glass with the freezing temperature T{sub G} = 6.2 K. The ac magnetic susceptibility measurements confirm magnetic frustration in DyNi{sub 0.67}Si{sub 1.34}. The maximum value of the magnetic entropy change determined from M(H) data is −16.1 J/kg K at 10.5 K for a field change of 70 kOe.
Zhan, Tao; Potts, Winston; Collins, John F.; Austin, Jeff
2014-12-01
Many vehicle owners in the United States recharge their vehicles' air conditioning systems with small containers of hydrofluorocarbon-134a (HFC-134a, CH2FCF3), at a frequency estimated to be once every year on average. Such nonprofessional service produces immediate emissions of this potent greenhouse gas during service and from the residual heel in partially used containers. The nonprofessional operations are also associated with increased delayed refrigerant emissions that occur because owners are less likely to repair leaks than professional technicians. In California, an estimated 1.3 million nonprofessional service operations performed each year generate 0.27 ± 0.07 million metric ton CO2 equivalent (MMTCO2e) of immediate emissions and 0.54 ± 0.08 MMTCO2e of delayed emissions, using a Global Warming Potential of 1300 for HFC-134a. The immediate emissions can be largely mitigated by a regulation that requires self-sealing valves and improved labeling instructions on the containers, a deposit-return-recycling program for the containers, and a consumer education program. If 95% of the used containers were to be returned by consumers for recycling of the container heel, the annual immediate emissions would be reduced by 0.26 ± 0.07 MMTCO2e. In the United States, an estimated 24 million nonprofessional service operations are performed each year, generating 5.1 ± 1.4 MMTCO2e of immediate emissions and 10.4 ± 1.5 MMTCO2e of delayed emissions. Mitigation measures equivalent to the California regulation would reduce nationwide immediate emissions by 4.9 ± 1.4 MMTCO2e, if 95% of the used cans were returned for recycling. These business-as-usual emissions and mitigation potentials are projected to stay approximately constant until around 2022, and remain at significant levels into the 2030s.
Mercier, Jean-Francois; Zhang, Weihua; Loignon-Houle, Francis; Cooke, Michael W.; Ungar, Kurt R.; Pellerin, Eric R.
2013-04-01
Cesium-137 (t1/2 = 30 yr) and cesium-134 (t1/2 = 2yr) constitute major fission by-products observed as the result of a nuclear incident. Such radioisotopes become integrated into the soil and biomass, and can therefore undergo re-suspension into the environment via activities such as forest fires. The Canadian Radiological Monitoring Network (CRMN), which consists of 26 environmental monitoring stations spread across the country, commonly observes cesium-137 in air filters due to re-suspension of material originating from long-past weapons testing. Cesium-134 is not observed owing to its relatively short half-life. The Fukushima-Daiichi nuclear power plant incident of March 2011 caused a major release of radioactive materials into the environment. In Canada, small quantities of both cesium-137 and cesium-134 fallout were detected with great frequency in the weeks which followed, falling off rapidly beginning in July 2011. Since September 2011, the CRMN has detected both cesium-137 and cesium-134 from air filters collected at Yellowknife, Resolute, and Quebec City locations. Using the known initial cesium-134/cesium-137 ratio stemming from this incident, along with a statistical assessment of the normality of the data distribution, we herein present evidence that strongly suggests that these activity spikes are due to re-suspended hot particles originating from the Fukushima-Daiichi nuclear power plant incident. Moreover, we have evidence to suggest that this re-suspension is localized in nature. This study provided empirical insight into the transport and uptake of radionuclides over vast distances, and it demonstrates that the CRMN was able to detect evidence of a re-suspension of Fukushima-Daiichi related isotopes.
The removal of 134Cs from radioactive process waste water by coprecipitate flotation
International Nuclear Information System (INIS)
Aziz, M.; Shakir, K.; Benyamin, K.
1986-01-01
The coprecipitate flotation of 134 Cs from radioactive process waste water using copper ferrocyanide as a coprecipitating agent and sodium lauryl sulphate, cetyl trimethyl ammonium bromide or gelatin as collector was extensively investigated to establish the best conditions for caesium removal with each of the collectors under test. The investigated parameters include the collector dosage, the Cu 2+ /Fe(CN) 6 4- ratio, the caesium, potassium, sodium and calcium ion concentrations, the ageing time period of the Cu 2+ - Fe(CN) 6 4- - 134 Cs - water system and the bubbling time duration. The results indicate that copper ferrocyanide has a high affinity for caesium and can preferentially co-precipitate it in presence of relatively high amounts of other alkali or alkaline earth cations. For the alkali metals the affinity increases in the order Na < K < Cs. Under the optimal conditions removals higher than 99% could be achieved with any of the tested collectors. The results are discussed in terms of the ion exchange properties of copper ferrocyanide and collector behaviour. Advantages of the coflotation technique over other methods are enumerated. (Auth.)
Directory of Open Access Journals (Sweden)
Natalie Leys
2017-04-01
Full Text Available Microbe-mineral interactions have become of interest for space exploration as microorganisms could be used to biomine from extra-terrestrial material and extract elements useful as micronutrients in life support systems. This research aimed to identify the impact of space flight on the long-term survival of Cupriavidus metallidurans CH34 in mineral water and the interaction with basalt, a lunar-type rock in preparation for the ESA spaceflight experiment, BIOROCK. Therefore, C. metallidurans CH34 cells were suspended in mineral water supplemented with or without crushed basalt and send for 3 months on board the Russian FOTON-M4 capsule. Long-term storage had a significant impact on cell physiology and energy status (by flow cytometry analysis, plate count and intracellular ATP measurements as 60% of cells stored on ground lost their cell membrane potential, only 17% were still active, average ATP levels per cell were significantly lower and cultivability dropped to 1%. The cells stored in the presence of basalt and exposed to space flight conditions during storage however showed less dramatic changes in physiology, with only 16% of the cells lost their cell membrane potential and 24% were still active, leading to a higher cultivability (50% and indicating a general positive effect of basalt and space flight on survival. Microbe-mineral interactions and biofilm formation was altered by spaceflight as less biofilm was formed on the basalt during flight conditions. Leaching from basalt also changed (measured with ICP-OES, showing that cells release more copper from basalt and the presence of cells also impacted iron and magnesium concentration irrespective of the presence of basalt. The flight conditions thus could counteract some of the detrimental effects observed after the 3 month storage conditions.
Vadlja, Denis; Koller, Martin; Novak, Mario; Braunegg, Gerhart; Horvat, Predrag
2016-12-01
Statistical distribution of cell and poly[3-(R)-hydroxybutyrate] (PHB) granule size and number of granules per cell are investigated for PHB production in a five-stage cascade (5CSTR). Electron microscopic pictures of cells from individual cascade stages (R1-R5) were converted to binary pictures to visualize footprint areas for polyhydroxyalkanoate (PHA) and non-PHA biomass. Results for each stage were correlated to the corresponding experimentally determined kinetics (specific growth rate μ and specific productivity π). Log-normal distribution describes PHA granule size dissimilarity, whereas for R1 and R4, gamma distribution best reflects the situation. R1, devoted to balanced biomass synthesis, predominately contains cells with rather small granules, whereas with increasing residence time τ, maximum and average granule sizes by trend increase, approaching an upper limit determined by the cell's geometry. Generally, an increase of intracellular PHA content and ratio of granule to cell area slow down along the cascade. Further, the number of granules per cell decreases with increasing τ. Data for μ and π obtained by binary picture analysis correlate well with the experimental results. The work describes long-term continuous PHA production under balanced, transient, and nutrient-deficient conditions, as well as their reflection on the granules size, granule number, and cell structure on the microscopic level.
Eckelbarger, Joseph D; Parker, Marshall H; Yap, Maurice Ch; Buysse, Ann M; Babcock, Jonathan M; Hunter, Ricky; Adelfinskaya, Yelena; Samaritoni, Jack G; Garizi, Negar; Trullinger, Tony K
2017-04-01
Optimization studies on a high-throughput screening (HTS) hit led to the discovery of a series of N-(6-arylpyridazin-3-yl)amides with insecticidal activity. It was hypothesized that the isosteric replacement of the pyridazine ring with a 1,3,4-thiadiazole ring could lead to more potent biological activity and/or a broader sap-feeding pest spectrum. The resulting N-(5-aryl-1,3,4-thiadiazol-2-yl)amides were explored as a new class of insecticides. Several methods for 2-amino-1,3,4-thiadiazole synthesis were used for the preparation of key synthetic intermediates. Subsequent coupling to variously substituted carboxylic acid building blocks furnished the final targets, which were tested for insecticidal activity against susceptible strains of Aphis gossypii (Glover) (cotton aphid), Myzus persicae (Sulzer) (green peach aphid) and Bemisia tabaci (Gennadius) (sweetpotato whitefly). Structure-activity relationship (SAR) studies on both the amide tail and the aryl A-ring of novel N-(5-aryl-1,3,4-thiadiazol-2-yl)amides led to a new class of insecticidal molecules active against sap-feeding insect pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Bazylak, Grzegorz; Malak, Anna; Ali, Imran; Borowiak, Teresa; Dutkiewicz, Grzegorz
2008-06-01
Retention profiles in series of the neutral and highly hydrophobic 1,3,4-oxadiazoles containing chlorophenylurea and halogenobenzamide moiety and indicating analgesic activity were determined in the isocratic standard- and narrow-bore HPLC systems employing, respectively, various octadecylsilica and different calixarene bonded stationary phases. When acetonitrile - 2.65 mM phosphoric acid (55 : 45, %, v/v), pH* 3.25, mobile phase was applied retention of these compounds increased with decline of their overall hydrophobicity according to the general preference of more polar compounds by calixarene cavity in time of its non-specific host-guest supramolecular interactions with halogenated substances. The size of calixarene nanocavity and its upper-rim substitution did not change the observed retention order, resolution and selectivity of separation for oxadiazoles. Compared to the retention on the non-end-capped and the highly-end-capped octadecylsilica HPLC column a most improved separation of some regioisomers of halogenated 1,3,4-oxadiazoles were observed on both used calixarene-type HPLC supports. In addition, preliminary data on the self-assembled supramolecular crystal structure of exemplary 1,3,4-oxadiazolchlorophenylurea with cis-elongated conformation was reported and formation of the monovalent inclusion host-guest complexes between 1,3,4-oxadiazoles and each calixarene-type stationary phase was studied with molecular modelling MM+ and AM1 methods. The structural, isomeric and energetic factors leading to the hydrogen bond stabilized inclusion complexes between these species were considered and used for explanation of observed retention sequence and selectivity of 1,3,4-oxadiazoles separation in applied calixarene-based HPLC systems. All these data would be useful in future development of optimized procedures enabling encapsulation of 1,3,4-oxadiazolurea-type drugs with calixarenes.
Energy Technology Data Exchange (ETDEWEB)
Essa, M W.A.; Hussein, H H.M.; Abdelfattah, A T; Abdelbaky, W M [Nuclear research Center, Atomic Energy Authority, Cairo (Egypt)
1997-12-31
Studies were performed to examine the effect of a accumulation of {sup 134} Cs and Cs-137 on the concentration of K-40 in white rats. Five male and five female rats were fed with normal diet for four weeks. After that, the ten rats were fed with macaroni contaminated with Cs-134 (116 Bq/kg) and Cs-137 (318 Bq/kg) besides the normal diet. Animal whole body counting was done once weekly for four months using HPGe and multichannel analyzer. The results should that the uptake of cesium increases until saturation was reached after about one month to values 60,65 Bq/kg for Cs-134, and 200,240 Bq/kg for Cs-137. Results show a decrease in k-40 concentration due to the replacement of potassium ions by cesium ions in the cell. After saturation, feeding with radioactive diet was replaced by normal diet. A release of Cs-134 and Cs-137 was noticed with increase of K-40 concentration. 6 figs., 2 tabs.
19 CFR 134.47 - Souvenirs and articles marked with trademarks or trade names.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Souvenirs and articles marked with trademarks or... Imported Articles § 134.47 Souvenirs and articles marked with trademarks or trade names. When as part of a trademark or trade name or as part of a souvenir marking, the name of a location in the United States or...
Directory of Open Access Journals (Sweden)
Mohammed G. Ghonime
2018-02-01
Full Text Available Malignant gliomas are the most common primary brain tumor and are characterized by rapid and highly invasive growth. Because of their poor prognosis, new therapeutic strategies are needed. Oncolytic virotherapy (OV is a promising strategy for treating cancer that incorporates both direct viral replication mediated and immune mediated mechanisms to kill tumor cells. C134 is a next generation Δγ134.5 oHSV-1 with improved intratumoral viral replication. It remains safe in the CNS environment by inducing early IFN signaling which restricts its replication in non-malignant cells. We sought to identify how C134 performed in an immunocompetent tumor model that restricts its replication advantage over first generation viruses. To achieve this we identified tumors that have intact IFN signaling responses that restrict C134 and first generation virus replication similarly. Our results show that both viruses elicit a T cell mediated anti-tumor effect and improved animal survival but that subtle difference exist between the viruses effect on median survival despite equivalent in vivo viral replication. To further investigate this we examined the anti-tumor activity in immunodeficient mice and in syngeneic models with re-challenge. These studies show that the T cell response is integral to C134 replication independent anti-tumor response and that OV therapy elicits a durable and circulating anti-tumor memory. The studies also show that repeated intratumoral administration can extend both OV anti-tumor effects and induce durable anti-tumor memory that is superior to tumor antigen exposure alone.
International Nuclear Information System (INIS)
Inoue, Mutsuo; Uemura, H.; Kofuji, H.; Shirotani, Y.; Nagao, S.; Fujimoto, K.; Takata, H.; Kudo, N.
2017-01-01
In 2014 and 2015, we examined the spatial distribution of cesium-134 (half-life: 2.06 years) from the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) in marine sediments within coastal-basin areas (water depths of 40-520 m) off central Honshu Island (the main island of Japan) in the Sea of Japan. The 134 Cs concentrations in both the surface sediment (0-1 cm depth) and whole-core inventory exhibited wide variations, and were highest at the site closest to the Agano River Estuary area (6.7 Bq/kg-dry and 886 Bq/m 2 , respectively). This indicates that 134 Cs in coastal areas was delivered by riverine suspended solids (SS). Given the spatial variation in 134 Cs concentrations, we believe that 134 Cs partially migrated northeastward within ∼50 km along Honshu Island (at water depths shallower than ∼140 m), and southwestward, including the Sado Basin area. This is predominantly attributable to the transport of SS by bottom currents and unsteady downward delivery onto the steep slopes of the basin. The total amount of 134 Cs in the study area in 2014 was estimated at approximately 0.6 TBq (decay-corrected to March 11, 2011, date of FDNPP accident). (author)
Zhao, Xianxian; Tang, Juan; Wang, Xu; Yang, Ruoheng; Zhang, Xiaoping; Gu, Yunfu; Li, Xi; Ma, Menggen
2015-05-01
Furfural and 5-hydroxymethylfurfural (HMF) are the two main aldehyde compounds derived from pentoses and hexoses, respectively, during lignocellulosic biomass pretreatment. These two compounds inhibit microbial growth and interfere with subsequent alcohol fermentation. Saccharomyces cerevisiae has the in situ ability to detoxify furfural and HMF to the less toxic 2-furanmethanol (FM) and furan-2,5-dimethanol (FDM), respectively. Herein, we report that an uncharacterized gene, YNL134C, was highly up-regulated under furfural or HMF stress and Yap1p and Msn2/4p transcription factors likely controlled its up-regulated expression. Enzyme activity assays showed that YNL134C is an NADH-dependent aldehyde reductase, which plays a role in detoxification of furfural to FM. However, no NADH- or NADPH-dependent enzyme activity was observed for detoxification of HMF to FDM. This enzyme did not catalyse the reverse reaction of FM to furfural or FDM to HMF. Further studies showed that YNL134C is a broad-substrate aldehyde reductase, which can reduce multiple aldehydes to their corresponding alcohols. Although YNL134C is grouped into the quinone oxidoreductase family, no quinone reductase activity was observed using 1,2-naphthoquinone or 9,10-phenanthrenequinone as a substrate, and phylogenetic analysis indicates that it is genetically distant to quinone reductases. Proteins similar to YNL134C in sequence from S. cerevisiae and other microorganisms were phylogenetically analysed. Copyright © 2015 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Yongxin Ren
Full Text Available Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH.Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth(-/- mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg for 1-4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth(-/- mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth(-/- mice compared to vehicle-treated wild-type and Pth(-/- mice.Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing.
Ren, Yongxin; Liu, Bo; Feng, Yuxu; Shu, Lei; Cao, Xiaojian; Karaplis, Andrew; Goltzman, David; Miao, Dengshun
2011-01-01
Although the capacity of exogenous PTH1-34 to enhance the rate of bone repair is well established in animal models, our understanding of the mechanism(s) whereby PTH induces an anabolic response during skeletal repair remains limited. Furthermore it is unknown whether endogenous PTH is required for fracture healing and how the absence of endogenous PTH would influence the fracture-healing capacity of exogenous PTH. Closed mid-diaphyseal femur fractures were created and stabilized with an intramedullary pin in 8-week-old wild-type and Pth null (Pth(-/-)) mice. Mice received daily injections of vehicle or of PTH1-34 (80 µg/kg) for 1-4 weeks post-fracture, and callus tissue properties were analyzed at 1, 2 and 4 weeks post-fracture. Cartilaginous callus areas were reduced at 1 week post-fracture, but were increased at 2 weeks post-fracture in vehicle-treated and PTH-treated Pth(-/-) mice compared to vehicle-treated and PTH-treated wild-type mice respectively. The mineralized callus areas, bony callus areas, osteoblast number and activity, osteoclast number and surface in callus tissues were all reduced in vehicle-treated and PTH-treated Pth(-/-) mice compared to vehicle-treated and PTH-treated wild-type mice, but were increased in PTH-treated wild-type and Pth(-/-) mice compared to vehicle-treated wild-type and Pth(-/-) mice. Absence of endogenous PTH1-84 impedes bone fracture healing. Exogenous PTH1-34 can act in the absence of endogenous PTH but callus formation, including accelerated endochondral bone formation and callus remodeling as well as mechanical strength of the bone are greater when endogenous PTH is present. Results of this study suggest a complementary role for endogenous PTH1-84 and exogenous PTH1-34 in accelerating fracture healing.
Energy Technology Data Exchange (ETDEWEB)
El-Sharkawy, Ibrahim I.; Saha, Bidyut B.; Koyama, Shigeru [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, Kasuga-koen 6-1, Kasuga-shi, Fukuoka 816-8580 (Japan); Srinivasan, Kandadai [School of Engineering and Logistics, Charles Darwin University, Darwin NT 0909 (Australia)
2007-03-15
The purpose of this paper is to provide empirical correlations for isosteric heats of adsorption on carbon based adsorbents for two refrigerants namely ethanol and HFC 134a. A non-dimensional correlation which partitions the contributions of the concentration and temperature dependence is proposed. The correlation is tested out against data obtained from experimental isotherms of ethanol adsorption on activated carbon fibers [ACF (A-20) and ACF (A-15)] and HFC 134a on two specimens of activated carbon powders and one specimen of carbon granules. It is expected that the suggested correlation will be useful for designers of adsorption chillers where indenting heat inventories fulcrums on the magnitude of isosteric heat of adsorption. (author)
The epigraphic tradition at Labraunda seen in the light of Labraunda inscription no. 134
DEFF Research Database (Denmark)
Isager, Signe
2008-01-01
An important new inscription was discovered in the sanctuary of Zeus Labraundos in 2002. The inscription belongs to the so-called Olympichos file, and together with I. Labraunda no. 49 it is now numbered I. Labraunda no. 134. The inscription has just been published by Lars Karlsson and Signe Isager...
Emissions of CO2, CO, NOx, HC, PM, HFC-134a, N2O and CH4 from the global light duty vehicle fleet
Directory of Open Access Journals (Sweden)
Timothy J. Wallington
2008-04-01
Full Text Available Vehicles emit carbon dioxide (CO2, carbon monoxide (CO, nitrogen oxides (NOx, hydrocarbons (HC, particulate matter (PM, hydrofluorocarbon 134a (HFC-134a, methane (CH4, and nitrous oxide (N2O. An understanding of these emissions is needed in discussions of climate change and local air pollution issues. To facilitate such discussions an overview of past, present, and likely future emissions from light duty vehicles is presented. Emission control technologies have reduced the emissions of CO, VOCs, PM, HFC-134a, CH4, and N2O from modern vehicles to very low levels.
Directory of Open Access Journals (Sweden)
Mishra Shubham
2016-12-01
Full Text Available Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%, which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle. Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.
Mishra, Shubham; Sarkar, Jahar
2016-12-01
Performance assessment of ejector-expansion vapor compression refrigeration system with eco-friendly R134a alternative refrigerants (R152a, R1234yf, R600a, R600, R290, R161, R32, and propylene) is presented for air-conditioning application. Ejector has been modeled by considering experimental data based correlations of component efficiencies to take care of all irreversibilities. Ejector area ratio has been optimized based on maximum coefficient of performance (COP) for typical air-conditioner operating temperatures. Selected refrigerants have been compared based on area ratio, pressure lift ratio, entrainment ratio, COP, COP improvement and volumetric cooling capacity. Effects of normal boiling point and critical point on the performances have been studied as well. Using ejector as an expansion device, maximum improvement in COP is noted in R1234yf (10.1%), which reduces the COP deviation with R134a (4.5% less in basic cycle and 2.5% less in ejector cycle). Hence, R1234yf seems to be best alternative for ejector expansion system due to its mild flammability and comparable volumetric capacity and cooling COP. refrigerant R161 is superior to R134a in terms of both COP and volumetric cooling capacity, although may be restricted for low capacity application due to its flammability.
Kamarehei, Maryam; Yazdanparast, Razieh
2014-10-01
The brain in Alzheimer's disease is under increased oxidative stress, and this may have a role in the pathogenesis and neural death in this disorder. It has been verified that numerous signaling pathways involved in neurodegenerative disorders are activated in response to reactive oxygen species (ROS). EUK134, a synthetic salen-manganese antioxidant complex, has been found to possess many interesting pharmacological activities awaiting exploration. The present study is to characterize the role of Notch signaling in apoptotic cell death of SK-N-MC cells. The cells were treated with hydrogen peroxide (H2O2) or menadione to induce oxidative stress. The free-radical scavenging capabilities of EUK134 were studied through the MTT assay, glutathione peroxidase (GPx) enzyme activity assay, and glutathione (GSH) Levels. The extents of lipid peroxidation, protein carbonyl formation, and intracellular ROS levels, as markers of oxidative stress, were also studied. Our results showed that H2O2/menadione reduced GSH levels and GPx activity. However, EUK134 protected cells against ROS-induced cell death by down-regulation of lipid peroxidation and protein carbonyl formation as well as restoration of antioxidant enzymes activity. ROS induced apoptosis and increased NICD and HES1 expression. Inhibition of NICD production proved that Notch signaling is involved in apoptosis through p53 activation. Moreover, H2O2/menadione led to Numb protein down-regulation which upon EUK134 pretreatment, its level increased and subsequently prevented Notch pathway activation. We indicated that EUK134 can be a promising candidate in designing natural-based drugs for ROS-induced neurodegenerative diseases. Collectively, ROS activated Notch signaling in SK-N-MC cells leading to cell apoptosis.
Energy Technology Data Exchange (ETDEWEB)
Dong Xueqiang [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Gong Maoqiong, E-mail: gongmq@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Liu Junsheng [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Wu Jianfeng, E-mail: jfwu@mail.ipc.ac.c [Key Laboratory of Cryogenics, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, P.O. Box 2711, Beijing 100190 (China)
2010-09-15
(Vapour + liquid) equilibrium (VLE) data for the binary systems of {l_brace}1,1,2,2-tetrafluoroethane (R134) + propane (R290){r_brace} and {l_brace}1,1,2,2-tetrafluoroethane (R134) + isobutane (R600a){r_brace} were measured with a recirculation method at the temperatures ranging from (263.15 to 278.15) K and (268.15 to 288.15) K, respectively. All of the data were correlated by the Peng-Robinson (PR) equation of state (EoS) with the Huron-Vidal (HV) mixing rules utilizing the non-random two-liquid (NRTL) activity coefficient model. Good agreement can be found between the experimental data and the correlated results. Azeotropic behaviour can be found at the measured temperature ranges for these two mixtures.
Hildreth, Blake Eason; Williams, Michelle M; Dembek, Katarzyna A; Hernon, Krista M; Rosol, Thomas J; Toribio, Ramiro E
2015-12-01
Evidence exists that parathyroid hormone-related protein (PTHrP) 1-34 may be more anabolic in bone than parathyroid hormone 1-34. While optical imaging is growing in popularity, scant information exists on the relationships between traditional bone imaging and histology and bioluminescence (BLI) and fluorescence (FLI) imaging. We aimed to evaluate the effects of PTHrP 1-34 on bone mass and determine if relationships existed between radiographic and histologic findings in bone and BLI and FLI indices. Vertebrae (vossicles) from mice coexpressing luciferase and green fluorescent protein were implanted subcutaneously into allogenic nude mice. Transplant recipients were treated daily with saline or PTHrP 1-34 for 4 weeks. BLI, FLI, radiography, histology, and µCT of the vossicles were performed over time. PTHrP 1-34 increased bioluminescence the most after 2 weeks, fluorescence at all time points, and decreased the time to peak bioluminescence at 4 weeks (P ≤ 0.027), the latter of which suggesting enhanced engraftment. PTHrP 1-34 maximized vertebral body volume at 4 weeks (P bone observed histologically increased in both groups at 2 and 4 weeks (P ≤ 0.002); however, PTHrP 1-34 exceeded time-matched controls (P ≤ 0.044). A positive linear relationship existed between the percentage of trabecular bone and (1) total bioluminescence (r = 0.595; P = 0.019); (2) total fluorescence (r = 0.474; P = 0.074); and (3) max fluorescence (r = 0.587; P = 0.021). In conclusion, PTHrP 1-34 enhances engraftment and bone mass, which can be monitored non-invasively by BLI and FLI.
Energy Technology Data Exchange (ETDEWEB)
Massas, I., E-mail: massas@aua.g [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece); Skarlou, V.; Haidouti, C.; Giannakopoulou, F. [Soil Science Laboratory, Department of Natural Resources Management and Agricultural Engineering, Agricultural University of Athens, Iera Odos 75, 11855 Athens (Greece)
2010-03-15
Three rates of Ca(OH){sub 2} were applied to an acid soil and the {sup 134}Cs uptake by radish, cucumber, soybean and sunflower plants was studied. The {sup 134}Cs concentration in all plant species was reduced from 1.6-fold in the sunflower seeds to 6-fold in the soybean vegetative parts at the higher Ca(OH){sub 2} rate. Potassium (K) concentration in plants was also reduced, but less effectively. The significantly decreased {sup 134}Cs-K soil to plant distribution factors (D.F.) clearly suggest a stronger effect of soil liming on {sup 134}Cs than on K plant uptake. This observation was discussed in terms of ionic interactions in the soil matrix and within the plants. The results also indicated that the increased Ca{sup 2+} concentration in the exchange phase and in the soil solution along with the improved root activity, due to the soil liming, enhanced the immobilization of {sup 134}Cs in the soil matrix and consequently lowered the {sup 134}Cs availability for plant uptake.
Yang, Chih-Chiang; Hsu, Chia-Jung; Chou, Pi-Tai; Cheng, Hsu Chun; Su, Yuhlong Oliver; Leung, Man-kit
2010-01-21
Multi-(5-phenyl-1,3,4-oxadiazo-2-yl)benzenes show emission in organic solvents from ultraviolet to blue (339-447 nm). The reduction potentials E(1/2)(red) cover a large range of -2.11 V for 2,5-diphenyl-1,3,4-oxadiazole to -0.76 V for 1,2,3,4,5,6-hexa(5-phenyl-1,3,4-oxadiazo-2-yl)benzene. An unexpectedly wide spectral range of the oxadiazole (OXD) exciplex emissions in PVK is observed, ranging from 406 to 603 nm. The OXDs also exhibit similar electroluminescence (EL) when blended into polyvinylcarbazole (PVK). A linear correlation between the lambda(max) of the electroluminescence and photoluminescence is observed, implying that the emission mechanisms in both processes are similar. In addition, the linear correlation between the E(1/2)(red) versus lambda(max) of EL (eV) reflected that the term of the charge-transfer configuration of the contact electron-hole pair plays a major role in the exciplex emission. The exciplex EL of 1,2,5-tri(5-phenyl-1,3,4-oxadiazo-2-yl)benzene (5) could be as high as 1.0 cd/A. Since the exciplex emission usually has a large Stokes shift, this provides a window for us to generate duo emissions for near white light EL with high efficiency. Among the devices we tried, the device of PVK/2-tert-butylphenyl-5-biphenyl-1,3,4-oxadiazole/5/2,5,8,11-tetra-tert-butylperylene (100:40:40:4) gave EL with good current efficiency of 1.63 cd/A.
Lifetimes of low-lying states in 132Nd and 134Nd
International Nuclear Information System (INIS)
Kruecken, R.; Mullins, S.M.; Thornley, D.J.; Kirwan, A.J.; Nolan, P.J.; Regan, P.H.; Wadsworth, R.
1995-01-01
Lifetimes of low-lying states have been measured in 132 Nd and 134 Nd using the coincidence-plunger technique. The reaction 32 S+ 105 Pd was used at a bombarding energy of 152 MeV. The measurement has been performed at the NSF Daresbury using the ESSA 30 array. The differential decay-curve method (DDCM) was used to analyze the recoil-distance Doppler-shift (RDDS) data. The experimental B(E2) values in 132 Nd are well described by the predictions of the rotational model and the IBM in the O(6) limit. ((orig.))
Analysis of the direct contamination pathway of 85Sr, 103Ru and 134Cs in soybean
International Nuclear Information System (INIS)
Yim, K. M.; Park, D. W.; Park, H. K.; Choi, Y. H.; Choi, S. D.; Lee, C. M.
2001-01-01
A solution containing 85 Sr, 103 Cs was sprayed to the aerial part of the soybean plant in a greenhouse at 6 different times before harvest and the direct contamination pathway of the radionuclide analyzed. Plant interception factor showed little difference among radionuclides. The maximum value was 0.93, which was observed at the middle growth stage. Translocation factors 85 Sr, 103 Cs in the soybean seed at harvest were in the range of 4.5x10 -5 ∼2.5x10 -3 , 6.0x10 -5 ∼2.3x10 -4 and 4.5x10 -3 ∼3.0x10 -1 , respectively. They were highest at the 3rd application for 85 Sr and 134 Cs and at the 2nd application for 103 Ru. Translocation factors of 85 Sr and 103 Ru in the soybean shell tended to increase with decreasing time interval between application and harvest but that of 134 Cs was highest at the 2nd application. The fractions of the initial deposition that remained in the soybeam plant at harvest were in the range of 0.14 ∼15.2% for 85 Sr and 103 Ru, 9.9∼41.9% for 134 Cs. These results can be utilized for predicting the radionuclide concentration in mature soybean plant and deciding counter-measures when an accidental deposition of the radionuclides occurs during the growing season of soybean
Dutta, Debodyuti; Mishra, Sabyashachi
2016-11-17
In the fight against bacterial infections and antibiotic resistance, the dapE-encoded N-succinyl-l,l-diaminopimelic acid desuccinylase (DapE) is a potentially safe target enzyme. The role of the Glu134, His67, and His349 residues in the binding and hydrolysis of N-succinyl-l,l-diaminopimelic acid (SDAP) is investigated by employing molecular dynamics simulation and hybrid quantum mechanical-molecular mechanical (MM) calculations of the E134D, H67A, and H349A mutants of DapE. The free energy of substrate binding obtained from the MM-Poisson-Boltzmann surface area approach correctly reproduced the experimentally observed ordering of substrate affinity, that is, E134D > wt > H67A > H349A. The mechanism of catalytic action by the E134D mutant is elucidated by structurally and energetically characterizing the intermediates and the transition states along the reaction pathway. The rate-determining step in the general acid-base hydrolysis reaction by the E134D mutant is found to be the nucleophilic attack step, which involves an activation energy barrier 10 kcal/mol greater than that in the wild-type (wt)-DapE. This explains the 3 orders of magnitude decrease in the experimentally determined k cat value for the E134D mutant compared to that of wt-DapE. In the H67A and H349A mutants, the Glu134 residue undergoes a conformational change and exhibits a strong coordination with the metal centers. This not only results in a weaker substrate binding in the two histidine mutants but also hinders the activation of the catalytic water molecule, which constitutes the first step of the substrate hydrolysis by DapE. This leads to an effective quenching of the catalytic activity in the H67A and H349A mutants.
DEFF Research Database (Denmark)
Christensen, Mette; Larsen, Lars A; Kauppinen, Sakari
2010-01-01
delivery of microRNAs in vivo by use of recombinant adeno-associated virus (rAAV). rAAV-mediated overexpression of miR-134 in neurons of the postnatal mouse brain provided evidence for a negative role of miR-134 in dendritic arborization of cortical layer V pyramidal neurons in vivo, thereby confirming...
International Nuclear Information System (INIS)
El-Morsi, Mohamed
2015-01-01
This study presents a comparison of energetic and exergetic performance of a vapour compression refrigeration system using pure HC (hydrocarbon) refrigerants. In this study, three different pure HCs propane (R290), butane (R600) and commercial LPG (liquefied petroleum gas) are used in the theoretical analysis. R134a is also used in the analysis as a reference refrigerant. The evaporator temperature ranges from −30 to 0 °C while the condenser ranges from 30 to 50 °C. MATLAB software is used for solving the thermodynamic equations, while the thermo-physical properties are calculated using REFPROP software. The results show that R600 has the highest COP c and exergetic efficiency, while LPG has the lowest. When compared to R134a, the COP c for R134a is higher than that for LPG by 10%. Also, the exergetic efficiency is higher by 5%. However, LPG has the advantage of being not expensive, available in large amounts and zero ozone depletion potential and low global warming potential. - Highlights: • The results show that R600 has the highest COP c & exergy efficiency, and the lowest irreversibility. • LPG has the lowest COP c & exergy efficiency, and the highest irreversibility. • Compared to R134a, LPG has a lower COP c and exergy efficiency by an average of 10% and 5%, respectively
Bęczkowski, Paweł M; Techakriengkrai, Navapon; Logan, Nicola; McMonagle, Elizabeth; Litster, Annette; Willett, Brian J; Hosie, Margaret J
2014-11-28
Feline immunodeficiency virus (FIV) infection is mediated by sequential interactions with CD134 and CXCR4. Field strains of virus vary in their dependence on cysteine-rich domain 2 (CRD2) of CD134 for infection. Here, we analyse the receptor usage of viral variants in the blood of 39 naturally infected cats, revealing that CRD2-dependent viral variants dominate in early infection, evolving towards CRD2-independence with disease progression. These findings are consistent with a shift in CRD2 of CD134 usage with disease progression.
S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5 ...
African Journals Online (AJOL)
Purpose: To evaluate the antibacterial, enzyme-inhibitory and hemolytic activities of Salkylated/aralkylated 2-(1H-indol-3-ylmethyl)-1,3,4-oxadiazole-5-thiol derivatives. Methods: Antibacterial activities of the compounds were evaluated using broth dilution method in 96 well plates. Enzyme inhibitory activities assays were ...
Klaewsongkram, Jettanong; Thantiworasit, Pattarawat; Sodsai, Pimpayao; Buranapraditkun, Supranee; Mongkolpathumrat, Pungjai
2016-11-01
Imatinib is a tyrosine kinase inhibitor indicated for the treatment of gastrointestinal stromal tumors (GISTs) and certain neoplastic diseases; however, nonimmediate adverse reactions are common. To describe the process of imatinib slow desensitization in patients who experienced nonimmediate reactions to imatinib and the dynamic change in drug-specific CD4 + CD25 + CD134 + T-lymphocyte percentages. Five patients diagnosed as having GISTs and with a recent history of imatinib-induced nonimmediate reactions (maculopapular exanthema with eosinophilia, exfoliative dermatitis, palmar-plantar erythrodysesthesia, and drug rash with eosinophilia and systemic symptoms) were desensitized using a slow desensitization protocol. The reintroduced imatinib dosage was stepped up every week starting from 10 mg/d and increasing to 25, 50, 75, 100, 150, 200, and 300 mg/d until the target dose of 400 mg/d was achieved. Prednisolone of up to 30 mg/d was allowed if allergic reactions recurred. The percentages of CD4 + CD25 + CD134 + T cells present after incubating peripheral blood mononuclear cells with imatinib, at baseline and after successful desensitization, were analyzed using flow cytometric analysis. By using a slow desensitization technique, all patients were able to receive 400 mg/d of imatinib, and prednisolone was gradually tapered off. The percentages of imatinib-induced CD4 + CD25 + CD134 + T cells decreased from a mean (SD) of 11.3% (6.5%) and 13.4% (7.3%) at baseline to 3.2% (0.7%) and 3.0% (1.1%) after successful desensitization, when stimulating peripheral blood mononuclear cells with 1 and 2 μM of imatinib, respectively. Slow desensitization is a helpful procedure in treating patients with imatinib-induced nonimmediate reactions other than simple maculopapular exanthema. The reduced percentages of imatinib-induced CD4 + CD25 + CD134 + T cells in these patients may be associated with immune tolerance. Copyright © 2016 American College of Allergy, Asthma & Immunology
Investigation into the conditions under which HFC134a may become flammable.
CSIR Research Space (South Africa)
Kramers, AP
2002-01-01
Full Text Available or approaching 180°C would be associated with an onset of catastrophic conditions such as plant room fires and total mechanical failure of equipment. It is suggested in that the guidelines listed in Section 5.2, pertaining to abnormal plant conditions... /lubricant mixtures can become explosive. The work must therefore consider both normal and abnormal operating conditions to which HFC134a may be exposed to empower machine operators, mine maintenance personnel and contractors to take preventative...
Lifescience Database Archive (English)
Full Text Available 37 0.74 tr|B3R4M5|B3R4M5_CUPTR Histone deacetylase OS=Cupriavidus taiwan... 36 0.96 tr|B1XVX0|B1XVX0_POLNS ...3R4M5|B3R4M5_CUPTR Histone deacetylase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A1299 PE=
S-Alkylated/aralkylated 2-(1H-indol-3-yl-methyl)-1,3,4- oxadiazole-5 ...
African Journals Online (AJOL)
ylmethyl)-1,3,4- oxadiazole-5-thiol derivatives. Methods: 2-(1H-indol-3-yl)acetic acid (1) was reacted with absolute ethanol and catalytic amount of sulfuric acid to form ethyl 2-(1H-indol-3-yl)acetate (2) which was transformed to 2-(1H-indol-3- ...
Equation of state and thermmodynamic properties of 1,1,1,2-tetrafluoroethane (refrigerant R134a)
International Nuclear Information System (INIS)
Vas'kov, E.T.
1995-01-01
An equation of state and tables of thermodynamic properties of R134a in the saturation state and in the one-phase region are obtained in the temperature interval 320-500 K at pressures ranging from 0.01 to 7.5 MPa
Directory of Open Access Journals (Sweden)
Tatiane E. Hirose
2015-03-01
Full Text Available Objectives: To evaluate the possible effects of the introduction of the pneumococcal conjugate 10-valent vaccine schedule in the state of Parana on pneumococcal meningitis cases and to assess the distribution of serotypes among cases. Method: Cross-sectional study with retrospective data collection of cases of pneumococcal meningitis in the state of Paraná reported to Sistema de Informação de Agravos de Notificação (SINAN, from 1998 to 2011. A total of 1,339 cases of pneumococcal meningitis were analyzed; 1,205 cases from the pre-vaccine period (1998-2009 were compared to 134 cases from the post-vaccine period (2010-2011. Descriptive and comparative statistical analyses (chi-squared test and prevalence ratio were performed using JMP 5.1.2 statistical software (JMP Statistical Discovery, North Carolina, USA and EPI INFO 6 (Centers for Disease Control and Prevention, Georgia, EUA. Results: There was a significant reduction in the mean rates of incidence and mortality in the general population. The analysis of cases in the pre- and post-vaccination periods in the age groups covered by vaccination (younger than 2 years showed significant reductions in incidence rates (6.01 cases/100,000 to 2.49 cases/100,000 individuals and mortality (1.85 cases/100,000 population to 0.47 cases/100,000 population, while the mean lethality rate did not change significantly. There was a significant reduction in cases whose serotypes are included in the vaccine (80.7% to 53.3%. Conclusion: Even after a short time of use, the 10-valent pneumococcal conjugate vaccine has already had a significant impact in reducing the incidence and mortality of meningitis cases among infants, as well as the reduction of cases whose serotypes are included in the vaccine. Resumo: Objetivos: Avaliar os possíveis efeitos da introdução da vacina pneumocócica conjugada 10 valente no calendário vacinal no Paraná sobre os casos de meningite pneumocócica; avaliar a distribuição dos
Pidugu, Vijaya Rao; Yarla, Nagendra Sastry; Pedada, Srinivasa Rao; Kalle, Arunasree M; Satya, A Krishna
2016-11-01
Oxadiazole is a heterocyclic compound containing an oxygen atom and two nitrogen atoms in a five-membered ring. Of the four oxadiazoles known, 1,3,4-oxadiazole has become an important structural motif for the development of new drugs and the compounds containing 1,3,4-oxadiazole cores have a broad spectrum of biological activity. Herein, we describe the design, synthesis and biological evaluation of a series of novel 2,5-disubstituted 1,3,4-oxadiazoles (10a-10j) as class I histone deacetylase (HDAC) inhibitors. The compounds were designed and evaluated for HDAC8 selectivity using in silico docking software (Glide) and the top 10 compounds with high dock score and obeying Lipinski's rule were synthesized organically. Further the biological HDAC inhibitory and selectivity assays and anti-proliferative assays were carried out. In in silico and in vitro studies, all compounds (10a-10j) showed significant HDAC inhibition and exhibited HDAC8 selectivity. Among all tested compounds, 10b showed substantial HDAC8 inhibitory activity and better anticancer activity which is comparable to the positive control, a FDA approved drug, vorinostat (SAHA). Structural activity relation is discussed with various substitutions in the benzene ring connected on 1,3,4-oxadizole and glycine/alanine. The study warranted further investigations to develop HDAC8-selective inhibitory molecule as a drug for neoplastic diseases. Novel 1,3,4-oxadizole substituted with glycine/alanine showed HDAC8 inhibition. Copyright © 2016 Elsevier Ltd. All rights reserved.
134cs uptake by plants from soil applying different absorbents
International Nuclear Information System (INIS)
Oncsik, M.
1998-01-01
A study of isotope uptake by plants using different zeolite clay minerals (montmorillonite, mordenite, clinoptilolite) was started with a view to reducing the rate of isotope uptake by plants by applying additives given to the soil. In pot experiments, the 134 Cs activity of green peas was reduced by 16% in average as compared to the control in the soils enriched with zeolite (mordenite type). Under field conditions, the radioactivity of millet and carrot yields were investigated in soils ameliorated with montmorillonite clay mineral. The radioactive contamination of the yield in soil treated with zeolite was in average 10% lower for millet and 24% for carrot roots as compared to the control
DEFF Research Database (Denmark)
Kristensen, Mie; Nielsen, Line Hagner; Zor, Kinga
2018-01-01
The cell-penetrating peptide (CPP) penetratin, has demonstrated potential as a carrier for transepithelial delivery of cargo peptides, such as the therapeutically relevant part of parathyroid hormone, i.e. PTH(1-34). The purpose of the present study was to elucidate the relevance of modifying the pH...... evaluated by using the Real-Time-GLO assay as well as by microscopy following Tryphan blue staining. Morphological Caco-2 cell changes were studied exploiting the impedance-based xCELLigence system as well as optically using the oCelloscope setup. Finally, the effect of pH on the folding propensity...... the conjugation approach, the PTH(1-34) permeation was significantly enhanced by lowering the pH from 7.4 to 5, but also associated with a compromised barrier and a lowering of the cellular viability. The negative effects on the cellular viability following cellular incubation with the PTH(1-34)-penetratin...
International Nuclear Information System (INIS)
Oncsik, M.B.
1999-01-01
The radioisotope uptake of potato and culinary dry bean was studied in field experiments on meadow soil enriched with vermiculite and humanite by artificial soil contamination. The isotope uptake from the soil was characterized by a transfer factor (TF). Based on the results of the potato experiment it was found that the TF value characterizing the 134 Cs contamination of the crop, changed between 1.31 - 0.77*10 -4 m 2 (kg dry matter) -1 on high humus content soil (treated with humanite) and on soil treated with vermiculite, while it was 22-45 % higher in plants grown on the radioactive control plots. lt was 1.69*10 -4 m 2 (kg dry matter)2 -1 in average. The TF values of 85 Sr uptake of potato are several times higher than those of experiments treated by isotope 134 Cs. The TF values fluctuated between 5.30-7.33*10 -4 m 2 (kg dry matter) -1 in soils treated with the additives, while on the plots with radioactive contamination it was 8.42*10 -4 m 2 (kg dry matter) -1 . Based on the results of 134 Cs studies of edible part of dry bean, it could be stated that after the soil contamination the TF value was 0.99*10 -4 m 2 (kg dry matter) -1 in average. According to the activity results of the experiments there was significant difference between the contamination of the plant parts. Refs. 6 (author)
Foong, Choon Pin; Lau, Nyok-Sean; Deguchi, Shigeru; Toyofuku, Takashi; Taylor, Todd D; Sudesh, Kumar; Matsui, Minami
2014-12-24
Special features of the Japanese ocean include its ranges of latitude and depth. This study is the first to examine the diversity of Class I and II PHA synthases (PhaC) in DNA samples from pelagic seawater taken from the Japan Trench and Nankai Trough from a range of depths from 24 m to 5373 m. PhaC is the key enzyme in microorganisms that determines the types of monomer units that are polymerized into polyhydroxyalkanoate (PHA) and thus affects the physicochemical properties of this thermoplastic polymer. Complete putative PhaC sequences were determined via genome walking, and the activities of newly discovered PhaCs were evaluated in a heterologous host. A total of 76 putative phaC PCR fragments were amplified from the whole genome amplified seawater DNA. Of these 55 clones contained conserved PhaC domains and were classified into 20 genetic groups depending on their sequence similarity. Eleven genetic groups have undisclosed PhaC activity based on their distinct phylogenetic lineages from known PHA producers. Three complete DNA coding sequences were determined by IAN-PCR, and one PhaC was able to produce poly(3-hydroxybutyrate) in recombinant Cupriavidus necator PHB-4 (PHB-negative mutant). A new functional PhaC that has close identity to Marinobacter sp. was discovered in this study. Phylogenetic classification for all the phaC genes isolated from uncultured bacteria has revealed that seawater and other environmental resources harbor a great diversity of PhaCs with activities that have not yet been investigated. Functional evaluation of these in silico-based PhaCs via genome walking has provided new insights into the polymerizing ability of these enzymes.
Determination of distribution ratio for 60Co, 85Sr and 134Cs in loess medium
International Nuclear Information System (INIS)
Tanaka, Tadao; Ogawa, Hiromichi; Zhentang Li; Hui Wang; Kamiyama, Hideo.
1994-06-01
Distribution ratio R for 60 Co, 85 Sr and 134 Cs between loess and ground water was measured by using 16 loess samples taken from the field test site of China Institute for Radiation Protection, in which the field test of radionuclide migration had been performed. The R of each radionuclide was taken nearly constant value among 16 samples. This revealed that the site can be regarded as uniform loess medium from the view point of sorption ability. The sorption ability between the three radionuclides was the order of 134 Cs > 60 Co >> 85 Sr. The 85 Sr was an available nuclide for examining the migration phenomena, because 85 Sr might easily migrate in the loess medium due to its low sorption ability. The results of parametric check suggested that it is necessary to select the valid temperature and pH for determining the R value. The sorption of Sr on the loess was dominated by reversible ion-exchange reaction, while that of Co and Cs was dominated by irreversible one. (author)
Dumur, Frédéric; Contal, Emmanuel; Wantz, Guillaume; Phan, Trang N T; Bertin, Denis; Gigmes, Didier
2013-01-21
A series of styrene-substituted 1,3,4-oxadiazoles has been designed and investigated as new low-molecular-weight organogelators. The photophysical properties of the resulting thermoreversible organogels have been characterized by UV/Vis absorption and luminescence spectroscopies. Surprisingly, the gelation ability of the oxadiazoles depended on the presence of the styrene moiety as gelation of the investigated oxadiazoles did not take place in its absence. Gel formation was accompanied by a modification of the fluorescence of the organogelators in the supramolecular state. UV irradiation of the gels caused a rearrangement of the immobilized 1,3,4-oxadiazoles bearing a styrene moiety by a tandem [4+2] and [3+2] cascade reaction. Structure modification and color change of the gels were also evident upon irradiation. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
2-Isobutyl-6-(4-methoxyphenylimidazo[2,1-b][1,3,4]thiadiazole
Directory of Open Access Journals (Sweden)
Hoong-Kun Fun
2011-02-01
Full Text Available In the title compound, C15H17N3OS, the dihedral angle between the statistically planar imidazo[2,1-b][1,3,4]thiadiazole fused-ring system (r.m.s. deviation = 0.002 Å and the methyoxbenzene ring is 4.52 (6°. In the crystal, molecules are arranged into columns and stacked down the a axis. The crystal structure is stabilized by weak C—H...π and π–π interactions [centroid–centroid separations = 3.6053 (8 and 3.7088 (7 Å].
Directory of Open Access Journals (Sweden)
Sych I.V.
2015-12-01
Full Text Available Introduction: The analysis of modern literature, including overseas one, showed that a lot of the scientific researches is devoted to finding and creating biologically active compounds on base 1,3,4-thiadiazole. Derivatives of 1,3,4-thiadiazole are the large group of heterocyclic compounds with high rates of antimicrobial, antituberculosis, antidiabetic, antineoplastic and anticonvulsant activity. Material and methods: The purpose of this study was the expansion of sulfone derivatives substituted nitrogen-containing heterocyclic systems through the synthesis of 2-R1-N (5-R-1,3,4-thiadiazol-2-ilbenzolsulfonamides and prediction their pharmacological activity for future planning pharmacological screening. Synthesis of semi-products 2-amino-5-R-1,3,4-thiadiazoles was carried out by cyclization thiosemicarbazide and substituted derivatives of carboxylic acids in the presence of concentrated sulfuric acid. The synthesis of target compounds 2-R1-N(5-R-1,3,4-thiadiazol-2-ylbenzolsulfon-amides was carried out by N-acylation of 2-amino-5R-1,3,4-thiadiazole substituted benzolsul-fochlorides in the presence of anhydrous pyridine. The reaction proceeds by the classic SN2-mechanism. The resulting compounds are white crystalline substances, soluble in alcohol, chloroform and acetone, difficult to dissolve in water. Yields of obtained compounds was satisfactory (76-84%. The purity of the obtained compounds was determined by TLC. The structure of the obtained compounds was proved by elemental analysis, IR methods and 1H NMR spectroscopy. NMR 1H spectra were recorded at Bruker WM spectrometer (200 MHz; solvent DMSO-d6; chemical shifts were in ppm, internal standard (TMS (tetramethylsilane was used. The prognosis of biological activity for obtained compounds were carried out using the program PASS (Prediction of Activity Spectra for Substances in order to plan the further pharmacological screening. The program PASS predicts more than 500 kinds of biological
Directory of Open Access Journals (Sweden)
Mohammad Soleiman-Beigi
2013-01-01
Full Text Available A novel practical and efficient catalyst-free method for the synthesis of 5-substituted 1,3,4-oxadiazole-2-thiols has been developed, which is assisted by reaction solvent (DMF. The solvent effects on product selectivity were studied based on Onsager’s reaction field theory of electrostatic solvation. The ab initio theoretical studies on the effect of solvents on the process also supported the suitability of DMF as the reaction medium for the preparation of 1,3,4-oxadiazole-2-thiol derivatives.
Qi, De-Qiang; Yu, Chuan-Ming; You, Jin-Zong; Yang, Guang-Hui; Wang, Xue-Jie; Zhang, Yi-Ping
2015-11-01
A series of pyrazole-based 1,3,4-oxadiazole derivatives were rationally designed and synthesized in good yields by following a convenient route. All the newly synthesized molecules were fully characterized by IR, 1H NMR and elemental analysis. Eight compounds were structurally determined by single crystal X-ray diffraction analysis. The fluorescence properties of all the compounds were investigated in dimethyl sulfoxide media. In addition, these newly synthesized compounds were evaluated for in vitro inhibitory activity against commercial enzyme xanthine oxidase (XO) by measuring the formation of uric acid from xanthine. Among the compounds synthesized and tested, 3d and 3e were found to be moderate inhibitory activity against commercial XO with IC50 = 72.4 μM and 75.6 μM. The studies gave a new insight in further optimization of pyrazole-based 1,3,4-oxadiazole derivatives with excellent fluorescence properties and XO inhibitory activity.
Double beta decay searches of 134Xe, 126Xe and 124Xe with large scale Xe detectors
International Nuclear Information System (INIS)
Barros, N; Thurn, J; Zuber, K
2014-01-01
The sensitivity for double beta decay studies of 134 Xe and 124 Xe is investigated assuming a potential large scale Xe experiment developed for dark matter searches depleted in 136 Xe. The opportunity for an observation of the 2νββ - decay of 134 Xe is explored for various scenarios. A positive observation should be possible for all calculated nuclear matrix elements. The detection of 2ν ECEC of 124 Xe can be probed in all scenarios covering the theoretical predicted half-life uncertainties and a potential search for 126 Xe is discussed. The sensitivity to β + EC decay of 124 Xe is discussed and a positive observation might be possible, while β + β + decay still remains unobservable. The performed studies take into account solar pp–neutrino interactions, 85 Kr beta decay and remaining 136 Xe double beta decay as background components in the depleted detector. (paper)
Directory of Open Access Journals (Sweden)
Eman M. Flefel
2017-01-01
Full Text Available New 1-thia-azaspiro[4.5]decane derivatives, their derived thiazolopyrimidine and 1,3,4-thiadiazole compounds were synthesized. The thioglycoside derivatives of the synthesized (1,3,4-thiadiazolylthiaazaspiro[4.5]decane and thiazolopyrimidinethione compounds were synthesized by glycosylation reactions using acetylated glycosyl bromides. The anticancer activity of synthesized compounds was studied against the cell culture of HepG-2 (human liver hepatocellular carcinoma, PC-3 (human prostate adenocarcinoma and HCT116 (human colorectal carcinoma cell lines and a number of compounds showed moderate to high inhibition activities.
Kuppusamy, Saranya; Thavamani, Palanisami; Megharaj, Mallavarapu; Lee, Yong Bok; Naidu, Ravi
2016-11-01
An isolate of Cupriavidus (strain MTS-7) was identified from a long-term PAHs and heavy metals mixed contaminated soil with the potential to biodegrade both LMW and HMW PAHs with added unique traits of acid and alkali tolerance, heavy metal tolerance, self-nutrient assimilation by N fixation and P solubilization. This strain completely degraded the model 3 (150 mg L(-1) Phe), 4 (150 mg L(-1) Pyr) and 5 (50 mg L(-1) BaP) ring PAHs in 4, 20 and 30 days, respectively. It could mineralize 90-100% of PAHs (200 mg L(-1) of Phe and Pyr) within 15 days across pH ranging from 5 to 8 and even in the presence of toxic metal contaminations. During biodegradation, the minimum inhibitory concentrations were 5 (Cu(2+)) and 3 (Cd(2+), Pb(2+), Zn(2+)) mg L(-1) of the potentially bioavailable metal ions and over 17 mg L(-1) metal levels was lethal for the microbe. Further, it could fix 217-274 μg mL(-1) of N and solubilize 79-135 μg mL(-1) of P while PAHs degradation. MTS-7 as a superior candidate could be thus used in the enhanced bioaugmentation and/or phytoremediation of long-term mixed contaminated sites. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
J. Kameník
2013-09-01
Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m–3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m–3 were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m–3 (Station Aloha, 18 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m–3, and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.
Energy Technology Data Exchange (ETDEWEB)
Kamenik, J.; Dulaiova, H. [Hawaii Univ., Manoa, Honolulu, HI (United States). Dept. of Geology and Geophysics; Buesseler, K.O.; Pike, S.M. [Woods Hole Oceanographic Institution, Woods Hole, MA (United States). Dept. of Marine Chemistry and Geochemistry; St' astna, K. [Czech Technical Univ., Prague (Czech Republic). Dept. of Nuclear Chemistry
2013-07-01
Surface seawater {sup 134}Cs and {sup 137}Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable {sup 134}Cs values that were impacted by Fukushima releases. Between March and May 2011, {sup 134}Cs was not detected around the Hawaiian Islands and Guam. Here, most {sup 137}Cs activities (1.2-1.5 Bq m{sup -3}) were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6-1.8 Bq m{sup -3}) were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m{sup -3} (Station Aloha, 18 values). In contrast, samples collected between Japan and Hawaii contained {sup 134}Cs activities in the range of 1-4 Bq m{sup -3}, and {sup 137}Cs levels were about 2-3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.
Closure Report for Corrective Action Unit 134: Aboveground Storage Tanks, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
2009-01-01
Corrective Action Unit (CAU) 134 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Aboveground Storage Tanks' and consists of the following four Corrective Action Sites (CASs), located in Areas 3, 15, and 29 of the Nevada Test Site: (1) CAS 03-01-03, Aboveground Storage Tank; (2) CAS 03-01-04, Tank; (3) CAS 15-01-05, Aboveground Storage Tank; and (4) CAS 29-01-01, Hydrocarbon Stain
Energy Technology Data Exchange (ETDEWEB)
1991-01-01
There are two ozone-neutral materials that could substitute the strongly ozone-destructive refrigerant R12, namely 1,1 difluoroethane (R152a) and 1,1,1,2 tetrafluoroethane (R134a). R152a has excellent thermodynamic and energetic properties. It is innocuous and easy to produce. Its great drawback is its inflammability due to the four hydrogen atoms per molecule. R134a is chemically inert and non-flammable, but its mixing behaviour with refrigerating oils poses problems. Idealised refrigeration processes using R134a show somewhat lower performance data than these using R128 so R134a would be expected to have a slightly greater primary energy demand. It may turn out that by using a mixture of R152a and R134a the unfavourable properties of the two components when used singly can be mutually moderated or completely neutralised, as follows. Addition of R134a neutralises the inflammability of R152a. A mixture may be expected to have more favourable thermodynamic and energetic properties than R134a alone. The foremost aim of the project was to determine by experiment the thermodynamic properties of the mixture of R152a and R134a. (orig./EF)
Symmetries of Quadrupole-Collective Vibrational Motion in Transitional Even-Even 124−134Xenon Nuclei
Pietralla, N; Rainovski, G; Ahn, T; Bauer, C; Leske, J; Möller, O; Möller, T
2010-01-01
Projectile-Coulomb excitation of Xe isotopes has been performed at ANL using the Gammasphere array for the detection of γ-rays. The one-quadrupole phonon 2+ 1,ms mixed-symmetry state (MSS) has been traced in the stable N=80 isotones down to 134Xe. First, the data on absolute E2 andM1 transition rates quantify the amount of F-spin symmetry in these nuclei and provide a new local measure for the pn-QQ interaction. Second, the evolution of the 2+ 1,ms state has been studied along the sequence of stable even-even 124−134Xe isotopes that are considered to form a shape transition path from vibrational nuclei with vibrational U(5) symmetry near N=82 to γ-softly deformed shapes with almost O(6) symmetry. Third, our data on more than 50 absolute E2 transition rates between off-yrast low-spin states of 124,126Xe enable us to quantitatively test O(6) symmetry in these nuclei. As a result we find that O(6) symmetry is more strongly broken in the A=130 mass region than previously thought. The data will be discussed.
Solvent Induced Disulfide Bond Formation in 2,5-dimercapto-1,3,4-thiadiazole
Palanisamy Kalimuthu; Palraj Kalimuthu; S. Abraham John
2007-01-01
Disulfide bond formation is the decisive event in the protein folding to determine the conformation and stability of protein. To achieve this disulfide bond formation in vitro, we took 2,5-dimercapto-1,3,4-thiadiazole (DMcT) as a model compound. We found that disulfide bond formation takes place between two sulfhydryl groups of DMcT molecules in methanol. UV-Vis, FT-IR and mass spectroscopic as well as cyclic voltammetry were used to monitor the course of reaction. We proposed a mechanism for...
Desorption of Sr 89, Co 60 and Cs 134 from Suez Canal bottom sediments (Port Tawfeek Area)
International Nuclear Information System (INIS)
El-Assy, N.B.; Abdel-Fattah, A.T.; El-Shinawy, R.M.K.; Essa, M.W.A.
1986-01-01
Chemical and physical properties of Suez Canal Bottom Sediments (S.C.B.S) and seawater at Port Tawfeek, the south entrance of Suez Canal, were studied. The (S.C.B.S) was separated into its size fractions (natural sediment, sand, silt and clay). These different sediment fractions were allowed to be in equilibrium with Strontium 89, Cobalt 60 and Cesium 134 solutions. Desorption studies were carried out on these contaminated sediments. The release of Strontium 89 and Cesium 134 was found to be identical and the sequence of this release was as follows : sand> silt> natural sediment> clay. The effect of seawater is 6-8 times that of bidistilled water. In case of Cobalt 60 the above sequence was disturbed and the salinity effect was only 2 times that of bidistilled water. It was also found that Strontium and Cobalt were more easily desorbed from the sand fraction a behaviour which can be explained by their loose attachment to the crystal surface
International Nuclear Information System (INIS)
Eikelmann, I.M.H.; Bye, K.; Sletten, H.D.
1990-01-01
The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively
An Inversion Disrupting FAM134B Is Associated with Sensory Neuropathy in the Border Collie Dog Breed
Directory of Open Access Journals (Sweden)
Oliver P. Forman
2016-09-01
Full Text Available Sensory neuropathy in the Border Collie is a severe neurological disorder caused by the degeneration of sensory and, to a lesser extent, motor nerve cells with clinical signs starting between 2 and 7 months of age. Using a genome-wide association study approach with three cases and 170 breed matched controls, a suggestive locus for sensory neuropathy was identified that was followed up using a genome sequencing approach. An inversion disrupting the candidate gene FAM134B was identified. Genotyping of additional cases and controls and RNAseq analysis provided strong evidence that the inversion is causal. Evidence of cryptic splicing resulting in novel exon transcription for FAM134B was identified by RNAseq experiments. This investigation demonstrates the identification of a novel sensory neuropathy associated mutation, by mapping using a minimal set of cases and subsequent genome sequencing. Through mutation screening, it should be possible to reduce the frequency of or completely eliminate this debilitating condition from the Border Collie breed population.
Ghaedi, M.; Hosaininia, R.; Ghaedi, A. M.; Vafaei, A.; Taghizadeh, F.
2014-10-01
In this research, a novel adsorbent gold nanoparticle loaded on activated carbon (Au-NP-AC) was synthesized by ultrasound energy as a low cost routing protocol. Subsequently, this novel material characterization and identification followed by different techniques such as scanning electron microscope (SEM), Brunauer-Emmett-Teller (BET) and transmission electron microscopy (TEM) analysis. Unique properties such as high BET surface area (>1229.55 m2/g) and low pore size (influence of variables, including the amount of adsorbent, initial pollutant concentration, contact time on pollutants removal percentage has great effect on the removal percentage that their influence was optimized. The optimum parameters for adsorption of 1,3,4-thiadiazole-2, 5-dithiol onto gold nanoparticales-activated carbon were 0.02 g adsorbent mass, 10 mg L-1 initial 1,3,4-thiadiazole-2,5-dithiol concentration, 30 min contact time and pH 7. The Adaptive neuro-fuzzy inference system (ANFIS), and multiple linear regression (MLR) models, have been applied for prediction of removal of 1,3,4-thiadiazole-2,5-dithiol using gold nanoparticales-activated carbon (Au-NP-AC) in a batch study. The input data are included adsorbent dosage (g), contact time (min) and pollutant concentration (mg/l). The coefficient of determination (R2) and mean squared error (MSE) for the training data set of optimal ANFIS model were achieved to be 0.9951 and 0.00017, respectively. These results show that ANFIS model is capable of predicting adsorption of 1,3,4-thiadiazole-2,5-dithiol using Au-NP-AC with high accuracy in an easy, rapid and cost effective way.
International Nuclear Information System (INIS)
Pal, P.K.; Bohra, R.C.
2015-01-01
The boiler tube made up of Monel-400 of RAPS-2 has failed on few occasions. Due to the failure of boiler tube, the active heavy water enters into boiler and feed water leading to contamination of radioactivity in secondary water circuit. The identification of boiler tube failure was done by measuring gamma ray activity of Iodine-134 in the boiler water with sample using gamma spectrometry with high purity germanium detector. In order to increase the sensitivity of the method 5 liters of Boiler water sample was passed through a plastic column containing 40 ml of anion resin and 10 ml of activated charcoal to capture the isotopes of Iodine in the anionic form and molecular form. Samples were collected from all 8 Boilers of RAPS-2. The activity of 134 I was shown only by Boiler - 5. No other boilers showed any activity of 134 I. This indicated that Boiler - 5 had leaky tubes. The leaky hairpin of boiler - 5 was identified by measuring Tritium and IP in the riser and down comer of all 10 HXs. On the basis of Tritium and IP result, HX-7 was identified as leaky hairpin. (author)
US emissions of HFC-134a derived for 2008-2012 from an extensive flask-air sampling network
Hu, Lei; Montzka, Stephen A.; Miller, John B.; Andrews, Aryln E.; Lehman, Scott J.; Miller, Benjamin R.; Thoning, Kirk; Sweeney, Colm; Chen, Huilin; Godwin, David S.; Masarie, Kenneth; Bruhwiler, Lori; Fischer, Marc L.; Biraud, Sebastien C.; Torn, Margaret S.; Mountain, Marikate; Nehrkorn, Thomas; Eluszkiewicz, Janusz; Miller, Scot; Draxler, Roland R.; Stein, Ariel F.; Hall, Bradley D.; Elkins, James W.; Tans, Pieter P.
2015-01-01
U.S. national and regional emissions of HFC-134a are derived for 2008-2012 based on atmospheric observations from ground and aircraft sites across the U.S. and a newly developed regional inverse model. Synthetic data experiments were first conducted to optimize the model assimilation design and to
Energy Technology Data Exchange (ETDEWEB)
Hernandez, J.I.; Best, R.; Estrada, C.A. [UNAM, Morelos (Mexico). Centro de Investigacion en Energia; Dorantes, R.J. [UAM Azcapotzalco, Reynosa Tamaulipas (Mexico). Dpto. de Energia
2004-09-01
A complete theoretical analysis on the thermodynamic behaviour of a HYbrid Compressor and Ejector Refrigeration System - HYCERS - is carried out. An ejector under optimum performance is employed. Two working fluids were selected: refrigerant 142b (HCFC 142b) which has shown very good characteristics in air conditioning applications of ejector systems and refrigerant 134a (HFC134a) which is widely used in refrigeration applications and readily available in most countries. The variation of the generator and condenser temperatures as well as the intercooler pressure were considered for an evaporator temperature of 10{sup o}C and a unitary cooling capacity of 1 kW. The ideal efficiency, the enthalpy-based coefficient of performance, the exergy efficiency and the supplied energy ratio are obtained. With this information, at a moderate condenser and generator temperature of 30 and 85{sup o}C, respectively, the HYCERS working with R134a had the best operation with a highest coefficient of performance of 0.48 and an exergy efficiency of 0.25. On the other hand, if a higher condenser temperature is imposed, the HYCERS with 142b had its best performance at a higher generator temperature. In selecting a working fluid the ejector subsystem behaviour is determinant in system performance. If a working fluid is badly selected, despite having high entrainment ratios, the system will not function properly. Therefore, the methodology here defined becomes an effective tool for selecting adequate working fluids and optimum system design conditions. Also, the employment of a unitary cooling load allows system scaling at any capacity as it increases linearly. (author)
Exposure of a herbivorous fish to 134Cs and 137Cs from the riverbed following the Fukushima disaster
International Nuclear Information System (INIS)
Tsuboi, Jun-ichi; Abe, Shin-ichiro; Fujimoto, Ken; Kaeriyama, Hideki; Ambe, Daisuke; Matsuda, Keishi; Enomoto, Masahiro; Tomiya, Atsushi; Morita, Takami; Ono, Tsuneo; Yamamoto, Shoichiro; Iguchi, Kei'ichiro
2015-01-01
Ayu Plecoglossus altivelis, a herbivorous fish, is an important fishery resource and key component of the foodweb in many Japanese streams. Radionuclide contamination of this species is likely transferred to higher trophic levels, include humans, in the food chain. After the Fukushima accident in March 2011, ayu were exposed to highly contaminated silt while feeding on algae attached to the riverbed stones. To understand the route by which herbivorous fish are exposed to radionuclides, the activity concentrations of sum of 134 Cs and 137 Cs (radiocesium) were analyzed in riverbed samples (algae and silt) and in the internal organs and the muscle of ayu in five river systems in the Fukushima Prefecture between summer 2011 and autumn 2013. Although there was a positive correlation between the radiocesium activity concentrations in the muscle and the internal organs of ayu, the median activity concentration in the muscle was much lower than those in the internal organs. The activity concentrations of radiocesium in the riverbed samples and the internal organs and the muscle of ayu were correlated with contamination levels in soil samples taken from the watershed upstream of the sample sites. The results of the generalized linear mixed models suggest that the activity concentrations in both the internal organs and the muscle of ayu declined over time. Additionally, the activity concentrations in the internal organs were correlated with those in the riverbed samples that were collected around the same time as the ayu. The activity concentrations in the muscle were correlated with ayu body size. Our results suggest that ayu ingest 134 Cs and 137 Cs while grazing silt and algae from the riverbed, and a part of the 134 Cs and 137 Cs is assimilated into the muscle of the fish. - Highlights: • The radiocesium (sum of 134 Cs and 137 Cs) concentrations in a herbivorous fish were measured following the Fukushima disaster. • The muscle concentrations were correlated with
Synthesis and antimicrobial properties of 1,3,4-oxadiazole analogs containing dibenzosuberone moiety
Energy Technology Data Exchange (ETDEWEB)
Moger, Manjunath [Mangalore University, Karnataka (India). Department of Chemistry; Satam, Vijay; Paniraj, A.S.; Gopinath, Vadiraj S.; Hindupur, Rama Mohan; Pati, Hari N., E-mail: hari.pati@advinus.com [Advinus Therapeutics Ltd., 21 and 22, Phase II, Peenya Industrial Area, Karnataka (India); Govindaraju, Darshan Raj C. [Department of Bio-Medicinal Research, Vidya Herbs Pvt. Ltd., Karnataka (India)
2014-01-15
A series of ten novel 1,3,4-oxadiazole analogs containing dibenzosuberone moiety were synthesized using linear as well as convergent synthesis approach. All the compounds were characterized by mass spectrometry, infrared (IR), {sup 1}H and {sup 13}C nuclear magnetic resonance ({sup 1}H NMR and {sup 13}C NMR) spectroscopies and elemental analysis. These compounds were evaluated for antibacterial and antifungal activities. Among ten analogs, four compounds, namely, 8a, 8d, 8e and 8j were found to be highly active antibacterial and antifungal agents (author)
International Nuclear Information System (INIS)
Li, Jingjing; Liu, Senlin; Zhang, Yongxing; Chen, Ling; Yan, Yuan; Cheng, Weiya; Lou, Hailin; Zhang, Yongbao
2015-01-01
Haiyang Nuclear Power Plant to be built in China was selected as a case for the dose pre-assessment for marine biota in this study. The concentrations of Cs and Co in organisms (turbot, yellow croaker, swimming crab, abalone, sea cucumber, and sea lettuce), seawater, and bottom sediment sampled on-site were measured by neutron activation analysis, and the site-specific transfer parameters (concentration ratios and distribution coefficients) of Cs and Co were calculated. 134 Cs, 137 Cs, and 60 Co activity concentrations in the organisms and the sediment at the site were calculated with the site-specific transfer parameters and the anticipated activity concentrations in the liquid effluent of the nuclear power plant. The ERICA tool was used to estimate the dose rates of 134 Cs, 137 Cs, and 60 Co to the selected organisms based on the biological models developed. The total dose rates of 134 Cs, 137 Cs, and 60 Co to the six organisms were all <0.001 μGy h −1 . - Highlights: • Pre-assessment for biota dose rates from Haiyang Nuclear Power Plant was made. • The site-specific transfer parameters were obtained by neutron activation analysis. • The dose rates of 134 Cs, 137 Cs, and 60 Co to the organisms were <0.001 μGy h −1
International Nuclear Information System (INIS)
Ravikumar, T.S.; Mohan Lal, D.
2009-01-01
R134a has been accepted as the single major refrigerant in the automobile industry and it has been used worldwide. But, the problem associated with it is the use of the PAG oil as the lubricant. Unlike the conventional mineral oil, the synthetic PAG oil used with R134a is highly hygroscopic in nature. The PAG lubricants come with different additives unique for different compressors. This leads to serious service issues. Therefore, a refrigerant, which will be readily available to replace R12, and also compatible with mineral oil, is needed. In the present study the readily available R134a is used in place of R12. However, to avoid PAG oil and to use the conventional mineral oil as lubricant, R134a is mixed with the commercially available hydrocarbon blend, (45.2% R290 and 56.8% R600a) in the proportion of 91% and 9%, respectively by mass. The quantity of hydrocarbons used is well below the lower flammable limit. This new mixture R134a/R600a/R290 is tested in the air-conditioning system of a passenger car 'on road' in the true running conditions and compared with the results that has been obtained with R12. The cool down performance under varying speed and varying ambient conditions, system performance under severe accelerating conditions and bumper-to-bumper traffic conditions is studied. The test results show that the new blend can be a promising substitute for the existing R12 systems and it can eliminate the use of hygroscopic PAG oil.
International Nuclear Information System (INIS)
Babichev, B.A.; Kozharin, V.V.
1990-01-01
An experimental and computational method for determination of burnup and actinoid concentrations in WWER fuel elements using 134 Cs and 137 Cs concentrations in fuel is considered. It is shown that the error in calculation of fuel burnup and U and Pu isotope concentrations in WWER-440 fuel elements is 1.3-4.9% provided that the error in 134 Cs and 137 Cs concentration measurements does not exceed 1.7 and 1.2%. 9 refs.; 10 figs.; 4 tabs
Functional analysis of α1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells
International Nuclear Information System (INIS)
Guo, Qiya; Guo, Bin; Wang, Yingming; Wu, Jun; Jiang, Wenjun; Zhao, Shenan; Qiao, Shouyi; Wu, Yanhua
2012-01-01
Highlights: ► Human FUT6 is up-regulated in HCC tissues. ► Expression of FUT6 promotes G0/G1-S transition and cell growth. ► FUT6 confers a growth advantage in vivo. ► FUT6 suppresses p21 expression through modulating PI3K/Akt signaling. -- Abstract: The α1,3/4-fucosyltransferases (FUT) subfamily are key enzymes in cell surface antigen synthesis during various biological processes. A novel role of FUTs in tumorigenesis has been discovered recently, however, the underlying mechanism remains largely unknown. Here, we characterized FUT6, a member of α1,3/4-FUT subfamily, in human hepatocellular carcinoma (HCC). In HCC tissues, the expression levels of FUT6 and its catalytic product SLe x were significantly up-regulated. Overexpression of FUT6 in HCC cells enhanced S-phase cell population, promoted cell growth and colony formation ability. Moreover, subcutaneously injection of FUT6-overexpressing cells in nude mice promoted cell growth in vivo. In addition, elevating FUT6 expression markedly induced intracellular Akt phosphorylation, and suppressed the expression of the cyclin-dependent kinases inhibitor p21. Bath application of the PI3K inhibitor blocked FUT6-induced Akt phosphorylation, p21 suppression and cell proliferation. Our results suggest that FUT6 plays an important role in HCC growth by regulating the PI3K/Akt signaling pathway.
Lifescience Database Archive (English)
Full Text Available OS=Homo ... 33 0.91 sp|P03315|POLS_SFV Structural polyprotein OS=Semliki forest viru... 32 1.5 sp|P25386|USO...ATK 206 Query: 8 PL 3 L Sbjct: 207 KL 208 >sp|P03315|POLS_SFV Structural polyprotein OS=Semliki forest...r|Q8JMP5|Q8JMP5_SFV Structural polyprotein OS=Semliki forest vi... 34 4.4 tr|A9BD99|A9BD99_PROM4 Trigger fac... Predicted protein OS=Monosiga brevicollis... 34 4.4 tr|Q87049|Q87049_SFV Virion protein OS=Semliki forest... virus GN=C... 34 5.8 tr|Q809B6|Q809B6_SFV Structural polyprotein OS=Semliki forest
Energy Technology Data Exchange (ETDEWEB)
Green, N.W.; Klungsoeyr, J.
1994-12-31
This report presents the 1990 sediment data compiled as part of the Norwegian contribution to the North Sea Task Force Monitoring Master Plan and the Joint Monitoring Programme (JMP). The JMP is ordered under the Oslo and Paris Commissions, which were established to protect the marine environment against anthropogenic contamination. The stations monitored by Norway are spread over the Kattegat, Skagerrak, North Sea south to the Dogger Bank and the Faeroe Islands. The contaminants investigated are mainly selected metals, organochlorines, polycyclic aromatic hydrocarbons, and the samples were collected by gravity cores and grab/box samplers. The raw data and the mean and standard deviations of parallel samples (if relevant) are presented. 6 refs., 2 tabs.
Directory of Open Access Journals (Sweden)
A. Sowmya
2016-10-01
Full Text Available In the title imidazo[2,1-b][1,3,4]thiadiazole derivative, C19H14ClN3OS, the 4-methylbenzyl and chlorophenyl rings are inclined to the planar imidazo[2,1-b][1,3,4]thiadiazole moiety (r.m.s. deviation = 0.012 Å by 64.5 (1 and 3.7 (1°, respectively. The molecular structure is primarily stabilized by a strong intramolecular C—H...O hydrogen bond, leading to the formation of a pseudo-seven-membered S(7 ring motif, and a short intramolecular C—H...N contact forming an S(5 ring motif. In the crystal, molecules are linked by pairs of C—H...S hydrogen bonds, forming inversion dimers. The dimers are linked by C—H...O and C—H...π interactions, forming chains propagating along [110].
Ivolgina, Victoria A.; Chernov'yants, Margarita S.
2018-06-01
The interest in the study of heteroaromatic thioamides which are known to exhibit antithyroid activity is stimulated by the variety and an unusual structure their complexes with molecular iodine. The directions of dithiones investigation are diversity enough, however a few works are devoted to the study them as the potential thyreostatics. The ability of 5-mercapto-3-phenyl-1,3,4-thiadiazole-2-thion potassium salt to form the outer-sphere charge-transfer complex in dilute chloroform solution, coordinating 2 iodine molecules has been studied by UV-vis spectroscopy (lgβ = 7.91). The compound of the 5,5‧-disulfanediylbis(3-phenyl-1,3,4-thiadiazole-2(3H)-thione) - product of irreversible oxidation of 5-mercapto-3-phenyl-1,3,4-thiadiazole-2-thione potassium salt has been isolated and characterized by X-ray diffraction. Intermolecular interactions between sulfur atoms are observed with very short interatomic distance, shorter than sum of van der Waals radii. The contact between heterocyclic sulfur and heterocyclic nitrogen is also slightly short - 3.169 Å (0.053 Å less than vdW radii sum). This investigation constitutes a starting point for study of novel antithyroid drugs in future.
Directory of Open Access Journals (Sweden)
S. Nagao
2013-10-01
Full Text Available At stations on the Natsui River and the Same River in Fukushima Prefecture, Japan, effects of a heavy rain event on radiocesium export were studied after Typhoon Roke during 21–22 September 2011, six months after the Fukushima Dai-ichi Nuclear Power Plant accident. Radioactivity of 134Cs and 137Cs in river waters was 0.009–0.098 Bq L−1 in normal flow conditions during July–September 2011, but it increased to 0.85 Bq L−1 in high flow conditions because of heavy rains occurring with the typhoon. The particulate fractions of 134Cs and 137Cs were 21–56% of total radiocesium in the normal flow condition, but were close to 100% after the typhoon. These results indicate that the pulse input of radiocesium associated with suspended particles from land to coastal ocean occurred because of the heavy rain event. Export flux of 134Cs and 137Cs attributable to the heavy rain accounts for 30–50% of the annual radiocesium flux from inland to coastal ocean region in 2011. Results show that rain events are one factor contributing to the transport and dispersion of radiocesium in river watersheds and coastal marine environments.
Charitonidis, N.; Karyotakis, Y.; Gatignon, L.
2017-11-01
Gases with relatively high refractive index, n - 1 ≥ 500 ×10-6 at atmospheric pressure, giving a satisfactory photoelectron yield at relatively low pressures (≤ 5 bar) are rare. These gases are often the only practical solution for low momentum particle identification in conventional secondary beam lines. The refractive index of R134a, one of the most common gases available to the physics community, has never been measured or reported. In the present note, the results of a dedicated experiment to estimate the refractive index of R134a, using mixed hadron/electron beams in the range 0.5-10 GeV are presented.
Energy Technology Data Exchange (ETDEWEB)
Lirussi, F.; Passera, D.; Iemmolo, R.M.; Nassuato, G.; Okolicsanyi, L. (Inst. of Medicine, Univ. of Parma (Italy))
1993-03-01
The authors investigated retrospectively the ultrasonographic and roentgenographic characteristics of the gallstones and the gallbladder in 134 symtom-free carriers and evaluated prospectively the outcome and side effects of 6 to 24 months' ursodeoxycholic acid (UDCA) therapy in 36 individuals with silent stones. Two-thirds of the 134 subjects had multiple stones, and 71 to 75% had stones less than 15 mm in diameter. Gallstone calcification was detected in 13%. A non-functioning gallbladder was observed in 19%, whereas gallbladder contraction was normal in 64 of 76 gallstone carriers. With regard to oral bile acid treatment, complete and partial dissolutions were achieved in 7 and 9 of 33 subjects, respectively (48.5%). Development of a non-functioning gallbladder occurred in 9%, and acquired gallstone calcification was seen in another 15%. It is concluded that: (i) the characteristics of the gallstones and the gallbladder are similar to those observed in symptomatic patients, and (ii) UDCA therapy may be given in selected symptom-free carriers for no more than 6 to 12 months. Thereafter, it does not appear to be cost-effective. 23 refs., 2 figs., 3 tabs.
Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident
Energy Technology Data Exchange (ETDEWEB)
Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza, E-mail: lararapls@hotmail.com, E-mail: camilabiouff@gmail.com, E-mail: akelecom@id.uff.br [Universidade Federal Fluminense (LARARA-PLS/UFF), Niteroi, RJ (Brazil). Lab. de Radiobiologia e Radiometria Pedro Lopes dos Santos; Pereira, Wagner de S., E-mail: pereiraws@gmail.com [Industrias Nucleares do Brasil (UNB), Pocos de Caldas, MG (Brazil). Servico de Radioprotecao. Grupo Multidisciplinar de Radioprotecao
2013-07-01
The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C{sub s}-134 and C{sub s}-137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C{sub s}-134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)
Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident
International Nuclear Information System (INIS)
Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza; Pereira, Wagner de S.
2013-01-01
The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C s -134 and C s -137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C s -134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)
Forman, Oliver P; Hitti, Rebekkah J; Pettitt, Louise; Jenkins, Christopher A; O'Brien, Dennis P; Shelton, G Diane; De Risio, Luisa; Quintana, Rodrigo Gutierrez; Beltran, Elsa; Mellersh, Cathryn
2016-09-08
Sensory neuropathy in the Border Collie is a severe neurological disorder caused by the degeneration of sensory and, to a lesser extent, motor nerve cells with clinical signs starting between 2 and 7 months of age. Using a genome-wide association study approach with three cases and 170 breed matched controls, a suggestive locus for sensory neuropathy was identified that was followed up using a genome sequencing approach. An inversion disrupting the candidate gene FAM134B was identified. Genotyping of additional cases and controls and RNAseq analysis provided strong evidence that the inversion is causal. Evidence of cryptic splicing resulting in novel exon transcription for FAM134B was identified by RNAseq experiments. This investigation demonstrates the identification of a novel sensory neuropathy associated mutation, by mapping using a minimal set of cases and subsequent genome sequencing. Through mutation screening, it should be possible to reduce the frequency of or completely eliminate this debilitating condition from the Border Collie breed population. Copyright © 2016 Forman et al.
Goreshnik, E.A.; Veryasov, G.; Morozov, Dmitry; Slyvka, Yu.; Ardan, B.; Mys'kiv, M.G.
2016-01-01
[Cu2(amdt)2]SiF6·C6H6 and [Cu2(amdt)2(H2O)2]SiF6·CH3CN·2H2O (amdt = 2-allylamino-5- methyl-1,3,4-thiadiazole) were obtained by alternating-current electrochemical synthesis, starting from water–acetonitrile–benzene mixtures containing 2-allylamino-5-methyl-1,3,4- thiadiazole and CuSiF6·4H2O. The electrochemical reduction of the saturated copper hexafluorosilicate water solution beneath the neatly poured layer of acetonitrile-benzene amdt solution resulted in the formation of cr...
Energy Technology Data Exchange (ETDEWEB)
Reis, Camilla Moretto dos; Miranda, Amanda Fraga; Echevarria, Aurea, E-mail: echevarr@ufrrj.b [Universidade Federal Rural do Rio de Janeiro (DQ/ICE/UFRRJ), Seropedica, RJ (Brazil). Inst. de Ciencias Exatas. Dept. de Quimica; Echevarria-Lima, Juliana [Universidade Federal do Rio de Janeiro (DI/IMPG/UFRJ), RJ (Brazil). Inst. de Microbiologia Paulo de Goes. Dept. de Imunologia
2011-07-01
A new and efficient synthesis of eight 1,3,4-thiadiazolium-2-phenylamine derivatives (1-8, where 8 is novel in the literature) was performed using thionyl chloride or trimethylsilyl chloride as catalysts under microwave or ultrasound irradiation. The target compounds were obtained in good yields and remarkably short times, 5 min under microwave irradiation and 10 min under ultrasound irradiation, where compared to traditional methodology (24 to 48 h at room temperature standing). The best yields were obtained using the microwave irradiation and, in general way, using thionyl chloride instead trimethylsilyl chloride. The cytotoxicity against K562 human leukemia and Daudi lymphoma lines was evaluated and showed promising results from the 4-phenyl-5-(4'-nitro-styryl)-1,3,4-thiadiazolium-2-phenylamine chloride derivative. (author)
The relation between carbon monoxide emission and visual extinction in cloud L134
International Nuclear Information System (INIS)
Tucker, K.D.; Dickman, R.L.; Encrenaz, P.J.; Kutner, M.L.
1976-01-01
Emission from the J=1→0 transition of carbon monoxide has been mapped over an area of 40' x 55' in cloud L134, and visual extinctions over the entire cloud have been obtained by means of star counts. Line intensities of > or =2 K are observable down to an extinction level of about one magnitude. From observations of the J=1→0 transition of the 13 CO isotopic species at 18 locations in the cloud, we have found a linear correlation between the local thermodynamic equilibrium (LTE) column densities of 13 CO and magnitudes of visual extinction
Eosin Y Catalyzed Visible-light-promoted One –Pot Facile Synthesis of 1,3,4- Thiadiazole
Directory of Open Access Journals (Sweden)
Vishal Srivastava
2015-03-01
Full Text Available A novel one-pot visible light irradiated synthesis of 1,3,4-thiadiazole from aldehydes and thioacyl hydrazides have been reported in presence of eosin Y as an organophotoredox catalyst at room temperature under aerobic condition. This synthesis includes application of air and visible light as inexpensive, readily available, non-toxic and sustainable regents, which fulfils the basic principle of green chemistry.
New transposon tools tailored for metabolic engineering of Gram-negative microbial cell factories
Directory of Open Access Journals (Sweden)
Esteban eMartínez-García
2014-10-01
Full Text Available Re-programming microorganisms to modify their existing functions and/or to bestow bacteria with entirely new-to-Nature tasks have largely relied so far on specialized molecular biology tools. Such endeavors are not only relevant in the burgeoning metabolic engineering arena, but also instrumental to explore the functioning of complex regulatory networks from a fundamental point of view. À la carte modification of bacterial genomes thus calls for novel tools to make genetic manipulations easier. We propose the use of a series of new broad-host-range mini-Tn5 vectors, termed pBAMDs, for the delivery of gene(s into the chromosome of Gram-negative bacteria and for generating saturated mutagenesis libraries in gene function studies. These delivery vectors endow the user with the possibility of easy cloning and subsequent insertion of functional cargoes with three different antibiotic resistance markers (kanamycin, streptomycin, and gentamicin. After validating the pBAMD vectors in the environmental bacterium Pseudomonas putida KT2440, their use was also illustrated by inserting the entire poly(3-hydroxybutyrate (PHB synthesis pathway from Cupriavidus necator in the chromosome of a phosphotransacetylase mutant of Escherichia coli. PHB is a completely biodegradable polyester with a number of industrial applications that make it attractive as a potential replacement of oil-based plastics. The non-selective nature of chromosomal insertions of the biosynthetic genes was evidenced by a large landscape of PHB synthesis levels in independent clones. One clone was selected and further characterized as a microbial cell factory for PHB accumulation, and it achieved polymer accumulation levels comparable to those of a plasmid-bearing recombinant. Taken together, our results demonstrate that the new mini-Tn5 vectors can be used to confer interesting phenotypes in Gram-negative bacteria that would be very difficult to engineer through direct manipulation of the
New Transposon Tools Tailored for Metabolic Engineering of Gram-Negative Microbial Cell Factories
Energy Technology Data Exchange (ETDEWEB)
Martínez-García, Esteban; Aparicio, Tomás; Lorenzo, Víctor de; Nikel, Pablo I., E-mail: pablo.nikel@cnb.csic.es [Systems and Synthetic Biology Program, Centro Nacional de Biotecnología (CNB-CSIC), Madrid (Spain)
2014-10-28
Re-programming microorganisms to modify their existing functions and/or to bestow bacteria with entirely new-to-Nature tasks have largely relied so far on specialized molecular biology tools. Such endeavors are not only relevant in the burgeoning metabolic engineering arena but also instrumental to explore the functioning of complex regulatory networks from a fundamental point of view. À la carte modification of bacterial genomes thus calls for novel tools to make genetic manipulations easier. We propose the use of a series of new broad-host-range mini-Tn5-vectors, termed pBAMDs, for the delivery of gene(s) into the chromosome of Gram-negative bacteria and for generating saturated mutagenesis libraries in gene function studies. These delivery vectors endow the user with the possibility of easy cloning and subsequent insertion of functional cargoes with three different antibiotic-resistance markers (kanamycin, streptomycin, and gentamicin). After validating the pBAMD vectors in the environmental bacterium Pseudomonas putida KT2440, their use was also illustrated by inserting the entire poly(3-hydroxybutyrate) (PHB) synthesis pathway from Cupriavidus necator in the chromosome of a phosphotransacetylase mutant of Escherichia coli. PHB is a completely biodegradable polyester with a number of industrial applications that make it attractive as a potential replacement of oil-based plastics. The non-selective nature of chromosomal insertions of the biosynthetic genes was evidenced by a large landscape of PHB synthesis levels in independent clones. One clone was selected and further characterized as a microbial cell factory for PHB accumulation, and it achieved polymer accumulation levels comparable to those of a plasmid-bearing recombinant. Taken together, our results demonstrate that the new mini-Tn5-vectors can be used to confer interesting phenotypes in Gram-negative bacteria that would be very difficult to engineer through direct manipulation of the structural genes.
Shelobolina, Evgenya; Konishi, Hiromi; Xu, Huifang; Benzine, Jason; Xiong, Mai Yia; Wu, Tao; Blöthe, Marco; Roden, Eric
2012-01-01
The biogeochemistry of phyllosilicate-Fe redox cycling was studied in a Phalaris arundinacea (reed canary grass) dominated redoximorphic soil from Shovelers Sink, a small glacial depression near Madison, WI. The clay size fraction of Shovelers Sink soil accounts for 16% of the dry weight of the soil, yet contributes 74% of total Fe. The dominant mineral in the clay size fraction is mixed layer illite-smectite, and in contrast to many other soils and sediments, Fe(III) oxides are present in low abundance. We examined the Fe biogeochemistry of Shovelers Sink soils, estimated the abundance of Fe redox cycling microorganisms, and isolated in pure culture representative phyllosilicate-Fe oxidizing and reducing organisms. The abundance of phyllosilicate-Fe reducing and oxidizing organisms was low compared to culturable aerobic heterotrophs. Both direct isolation and dilution-to-extinction approaches using structural Fe(II) in Bancroft biotite as a Fe(II) source, and O(2) as the electron acceptor, resulted in recovery of common rhizosphere organisms including Bradyrhizobium spp. and strains of Cupriavidus necator and Ralstonia solanacearum. In addition to oxidizing biotite and soluble Fe(II) with O(2), each of these isolates was able to oxidize Fe(II) in reduced NAu-2 smectite with [Formula: see text] as the electron acceptor. Oxidized NAu-2 smectite or amorphous Fe(III) oxide served as electron acceptors for enrichment and isolation of Fe(III)-reducing microorganisms, resulting in recovery of a strain related to Geobacter toluenoxydans. The ability of the recovered microorganisms to cycle phyllosilicate-Fe was verified in an experiment with native Shovelers Sink clay. This study confirms that Fe in the native Shovelers Sink clay is readily available for microbial redox transformation and can be cycled by the Fe(III)-reducing and Fe(II)-oxidizing microorganisms recovered from the soil.
Shelobolina, Evgenya; Konishi, Hiromi; Xu, Huifang; Benzine, Jason; Xiong, Mai Yia; Wu, Tao; Blöthe, Marco; Roden, Eric
2012-01-01
The biogeochemistry of phyllosilicate–Fe redox cycling was studied in a Phalaris arundinacea (reed canary grass) dominated redoximorphic soil from Shovelers Sink, a small glacial depression near Madison, WI. The clay size fraction of Shovelers Sink soil accounts for 16% of the dry weight of the soil, yet contributes 74% of total Fe. The dominant mineral in the clay size fraction is mixed layer illite–smectite, and in contrast to many other soils and sediments, Fe(III) oxides are present in low abundance. We examined the Fe biogeochemistry of Shovelers Sink soils, estimated the abundance of Fe redox cycling microorganisms, and isolated in pure culture representative phyllosilicate–Fe oxidizing and reducing organisms. The abundance of phyllosilicate–Fe reducing and oxidizing organisms was low compared to culturable aerobic heterotrophs. Both direct isolation and dilution-to-extinction approaches using structural Fe(II) in Bancroft biotite as a Fe(II) source, and O2 as the electron acceptor, resulted in recovery of common rhizosphere organisms including Bradyrhizobium spp. and strains of Cupriavidus necator and Ralstonia solanacearum. In addition to oxidizing biotite and soluble Fe(II) with O2, each of these isolates was able to oxidize Fe(II) in reduced NAu-2 smectite with NO3- as the electron acceptor. Oxidized NAu-2 smectite or amorphous Fe(III) oxide served as electron acceptors for enrichment and isolation of Fe(III)-reducing microorganisms, resulting in recovery of a strain related to Geobacter toluenoxydans. The ability of the recovered microorganisms to cycle phyllosilicate–Fe was verified in an experiment with native Shovelers Sink clay. This study confirms that Fe in the native Shovelers Sink clay is readily available for microbial redox transformation and can be cycled by the Fe(III)-reducing and Fe(II)-oxidizing microorganisms recovered from the soil. PMID:22493596
New Transposon Tools Tailored for Metabolic Engineering of Gram-Negative Microbial Cell Factories
International Nuclear Information System (INIS)
Martínez-García, Esteban; Aparicio, Tomás; Lorenzo, Víctor de; Nikel, Pablo I.
2014-01-01
Re-programming microorganisms to modify their existing functions and/or to bestow bacteria with entirely new-to-Nature tasks have largely relied so far on specialized molecular biology tools. Such endeavors are not only relevant in the burgeoning metabolic engineering arena but also instrumental to explore the functioning of complex regulatory networks from a fundamental point of view. À la carte modification of bacterial genomes thus calls for novel tools to make genetic manipulations easier. We propose the use of a series of new broad-host-range mini-Tn5-vectors, termed pBAMDs, for the delivery of gene(s) into the chromosome of Gram-negative bacteria and for generating saturated mutagenesis libraries in gene function studies. These delivery vectors endow the user with the possibility of easy cloning and subsequent insertion of functional cargoes with three different antibiotic-resistance markers (kanamycin, streptomycin, and gentamicin). After validating the pBAMD vectors in the environmental bacterium Pseudomonas putida KT2440, their use was also illustrated by inserting the entire poly(3-hydroxybutyrate) (PHB) synthesis pathway from Cupriavidus necator in the chromosome of a phosphotransacetylase mutant of Escherichia coli. PHB is a completely biodegradable polyester with a number of industrial applications that make it attractive as a potential replacement of oil-based plastics. The non-selective nature of chromosomal insertions of the biosynthetic genes was evidenced by a large landscape of PHB synthesis levels in independent clones. One clone was selected and further characterized as a microbial cell factory for PHB accumulation, and it achieved polymer accumulation levels comparable to those of a plasmid-bearing recombinant. Taken together, our results demonstrate that the new mini-Tn5-vectors can be used to confer interesting phenotypes in Gram-negative bacteria that would be very difficult to engineer through direct manipulation of the structural genes.
Production of (R)-3-hydroxybutyric acid by Arxula adeninivorans.
Biernacki, Mateusz; Riechen, Jan; Hähnel, Urs; Roick, Thomas; Baronian, Kim; Bode, Rüdiger; Kunze, Gotthard
2017-12-01
(R)-3-hydroxybutyric acid can be used in industrial and health applications. The synthesis pathway comprises two enzymes, β-ketothiolase and acetoacetyl-CoA reductase which convert cytoplasmic acetyl-CoA to (R)-3-hydroxybutyric acid [(R)-3-HB] which is released into the culture medium. In the present study we used the non-conventional yeast, Arxula adeninivorans, for the synthesis enantiopure (R)-3-HB. To establish optimal production, we investigated three different endogenous yeast thiolases (Akat1p, Akat2p, Akat4p) and three bacterial thiolases (atoBp, thlp, phaAp) in combination with an enantiospecific reductase (phaBp) from Cupriavidus necator H16 and endogenous yeast reductases (Atpk2p, Afox2p). We found that Arxula is able to release (R)-3-HB used an existing secretion system negating the need to engineer membrane transport. Overexpression of thl and phaB genes in organisms cultured in a shaking flask resulted in 4.84 g L -1 (R)-3-HB, at a rate of 0.023 g L -1 h -1 over 214 h. Fed-batch culturing with glucose as a carbon source did not improve the yield, but a similar level was reached with a shorter incubation period [3.78 g L -1 of (R)-3-HB at 89 h] and the rate of production was doubled to 0.043 g L -1 h -1 which is higher than any levels in yeast reported to date. The secreted (R)-3-HB was 99.9% pure. This is the first evidence of enantiopure (R)-3-HB synthesis using yeast as a production host and glucose as a carbon source.
International Nuclear Information System (INIS)
Tschiersch, J.; Shinonaga, T.; Heuberger, H.
2004-01-01
The height of the dry deposition of particulate radionuclides to leafy vegetable is quite uncertain because of the different habit, surface texture and leaf uptake of the different species. There is no comparative data on the deposition to various species, but leafy vegetables are taken as reference plants for the estimation of the height of contamination of vegetable foods after a nuclear accident. Therefore new chamber experiments were performed to determine under homogeneous and controlled conditions the dry deposition of particulate radio-caesium on mature leafy vegetable. The simultaneous exposition of endive, head lettuce, red oak leaf lettuce and spinach (spring leafy vegetable) rsp. curly kale, white cabbage and spinach (summer leafy vegetable) was arranged. The sample collective of each species was such large that for the expected variation of the results a statistically firm analysis was possible. For spring vegetable, there was no significant difference observed in deposition of 134 Cs between spinach and leaf lettuce, about twice the amount was deposited on both species as on endive and 3 times as on head lettuce. All summer vegetables showed differences in deposition for Caesium, the deposition to curly kale was highest, about twice that on spinach and 35 times (80 times) that on white cabbage. The normalized deposition velocity could be estimated, in average it was about 8 times lower for 134 Cs than for gaseous elemental 131 I. The influence of the particle size on the deposition velocity was small in the considered size range of 0.58-1.1μm (AMAD) of the monodisperse aerosol. Washing could reduce the contamination by about 45% for 134 Cs. (author)
International Nuclear Information System (INIS)
Endo, Satoru; Kajimoto, Tsuyoshi; Shizuma, Kiyoshi
2013-01-01
The transfer coefficient (TF) from soil to rice plants of 134 Cs and 137 Cs in the form of radioactive deposition from the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident in March 2011 was investigated in three rice paddy fields in Minami-Soma City. Rice crops were planted in the following May and harvested at the end of September. Soil cores of 30-cm depth were sampled from rice-planted paddy fields to measure 134 Cs and 137 Cs radioactivity at 5-cm intervals. 134 Cs and 137 Cs radioactivity was also measured in rice ears (rice with chaff), straws and roots. The rice ears were subdivided into chaff, brown rice, polished rice and rice bran, and the 134 Cs and 137 Cs radioactivity concentration of each plant part was measured to calculate the respective TF from the soil. The TF of roots was highest at 0.48 ± 0.10 in the field where the 40 K concentration in the soil core was relatively low, in comparison with TF values of 0.31 and 0.38 in other fields. Similar trends could be found for the TF of whole rice plants, excluding roots. The TF of rice ears was relatively low at 0.019–0.026. The TF of chaff, rice bran, brown rice and polished rice was estimated to be 0.049, 0.10–0.16, 0.013–0.017 and 0.005–0.013, respectively. - Highlights: ► We investigated the transfer coefficient of 134 Cs and 137 Cs from soil to rice plants in Minami-Soma City due to the Fukushima accident in 2011. ► The rice ears, straws, roots, chaff, brown rice, polished rice, rice bran and soil samples have been measured by Ge-detector. ► Transfer coefficient of chaff, rice bran, brown rice, and polished rice is estimated as 0.049, ranging from 0.10 to 0.16, 0.013 to 0.017, and 0.005 to 0.013, respectively.
Critical heat flux experimental facility using Freon R-134a fluid
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Kim, B. D. [Korea Atomic Energy Research Institute, Taejeon (Korea)
2000-02-01
A CHF experimental loop using Freon R-134a as a working fluid has been designed and built to facilitate modeling of high pressure/temperature water CHF experiments. This loop was designed to operate at 4 MPa, 100 deg C with the maximum flow rate of 2.5 kg/s. The detailed technical specification and operating procedure of the loop are described together with comments on the performance and limitations of the loop. A series of CHF experiment was carried out in a vertical round tube and the fluid-to-fluid modeling techniques are applied for it's validity for the high temperature/pressure reactor conditions. The experimental range covered all the application ranges of CHF correlations developed for both PWR and PHWR. 28 refs., 9 figs., 5 tabs. (Author)
International Nuclear Information System (INIS)
Ashurova, Z.D.; Sangov, Z.G.; Murvatulloeva, M.S.; Khalikova, Z.D.; Djamshedov, D.N.; Salimova, Z.D.
2009-01-01
Studying of some pharmacologic and biologic parameters of 1,3,4-thia-diazol[3.2a]pirimidin derivatives let make conclusion on possibility of using of these matters as a substance at elaboration of antibacterial drugs
International Nuclear Information System (INIS)
Saxena, Sunil K.; Horiuchi, Hisanori; Fukuda, Mitsunori
2006-01-01
Liddle's syndrome (excessive absorption of sodium ions) and PHA-1 (pseudohypoaldosteronism type 1) with decreased sodium absorption are caused by the mutations in the amiloride-sensitive epithelial sodium channel ENaC. Rab proteins are small GTPases involved in vesicle transport, docking, and fusion. Earlier, we reported that Rab27a inhibits ENaC-mediated currents through protein-protein interaction in HT-29 cells. We hereby report that Rab27a-dependent inhibition is associated with the GTP/GDP status as constitutively active or GTPase-deficient mutant Q78L inhibits amiloride-sensitive currents whereas GDP-locked inactive mutant T23N showed no effect. In order to further explore the molecular mechanism of this regulation, we performed competitive assays with two Rab27a-binding proteins: synaptotagmin-like protein (SLP-5) and Munc13-4 (a putative priming factor for exocytosis). Both proteins eliminate negative modulation of Rab27a on ENaC function. The SLP-5 reversal of Rab27a effect was restricted to C-terminal C2A/C2B domains assigned for putative phospholipids-binding function while the Rab27a-binding SHD motif imparted higher inhibition. The ENaC-mediated currents remain unaffected by Rab27a though SLP-5 appears to strongly bind it. The immunoprecipitation experiments suggest that in the presence of excessive Munc13-4 and SLP-5 proteins, Rab27a interaction with ENaC is diminished. Munc13-4 and SLP-5 limit the Rab27a availability to ENaC, thus minimizing its effect on channel function. These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins
Li, Jingjing; Liu, Senlin; Zhang, Yongxing; Chen, Ling; Yan, Yuan; Cheng, Weiya; Lou, Hailin; Zhang, Yongbao
2015-09-01
Haiyang Nuclear Power Plant to be built in China was selected as a case for the dose pre-assessment for marine biota in this study. The concentrations of Cs and Co in organisms (turbot, yellow croaker, swimming crab, abalone, sea cucumber, and sea lettuce), seawater, and bottom sediment sampled on-site were measured by neutron activation analysis, and the site-specific transfer parameters (concentration ratios and distribution coefficients) of Cs and Co were calculated. (134)Cs, (137)Cs, and (60)Co activity concentrations in the organisms and the sediment at the site were calculated with the site-specific transfer parameters and the anticipated activity concentrations in the liquid effluent of the nuclear power plant. The ERICA tool was used to estimate the dose rates of (134)Cs, (137)Cs, and (60)Co to the selected organisms based on the biological models developed. The total dose rates of (134)Cs, (137)Cs, and (60)Co to the six organisms were all <0.001 μGy h(-1). Copyright © 2015 Elsevier Ltd. All rights reserved.
Structure of 2{sub 1,2}{sup +} states in {sup 132,134,136}Te
Energy Technology Data Exchange (ETDEWEB)
Severyukhin, A. P., E-mail: sever@theor.jinr.ru; Arsenyev, N. N. [Joint Institute for Nuclear Research, Bogoliubov Laboratory of Theoretical Physics (Russian Federation); Pietralla, N.; Werner, V. [Technische Universität Darmstadt, Institut für Kernphysik (Germany)
2016-07-15
Starting fromthe Skyrme interaction f- together with the volume pairing interaction, we study the g factors for the 2{sub 1,2}{sup +} excitations of {sup 132,134,136}Te. The coupling between one- and two-phonon terms in the wave functions of excited states is taken into account within the finite-rank separable approximation. Using the same set of parameters we describe the available experimental data and give the prediction for {sup 136}Te, g(2{sub 1}{sup +}) = −0.18 in comparison to +0.32 in the case of {sup 132}Te.
Synthesis and Bioassay of a New Class of Furanyl-1,3,4-Oxadiazole Derivatives
Directory of Open Access Journals (Sweden)
Galila A. Yacout
2013-07-01
Full Text Available Tyrosinase enzyme is a monophenol monoxygenase enzyme, which plays an important role in human as a rate limiting step enzyme for different specific metabolic pathways, as well as its useful application in industry and agriculture. So this study was carried out to test the effect of newly prepared compounds containing 1,3,4-oxadiazoles with different substituted groups on tyrosinase enzyme activity, hoping to use them in the treatment of some diseases arising from tyrosinase activity disorders such as Parkinson’s disease, schizophrenia, autism, attention deficit, hyperactivity disorder, and cancer.
Gao, Mingzhang; Wang, Min; Zheng, Qi-Huang
2008-02-01
Small conductance Ca2+-activated K+ (SKCa) channels play an important role in many functions such as neuronal communication and behavioral plasticity, secretion, and cell proliferation. SKCa channel modulation is associated with various brain, heart, and cancer diseases. N-methyl-laudanosine and its structurally related derivatives, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums, are reversible and selective SKCa channel blockers. Carbon-11 labeled N-methyl-laudanosine and its tetrahydroisoquinolinium derivatives may serve as new probes for positron emission tomography (PET) to image SKCa channels in the brain, heart, and cancer. The key intermediates, substituted isoquinolines (3a-c), were synthesized using a modification of the Pomeranz-Fritsch procedure. The precursors, substituted 1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinolines (8a-c), and their corresponding reference standards, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums (9a-c), were synthesized from compounds 3a-c with 3,4-dimethoxybenzyl chloride (2) in multiple steps with moderate to excellent chemical yields. The precursor 6,7-dimethoxy-1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinoline (10) was commercially available, and the methylation of compound 10 with methyl iodide provided N-methyl-laudanosine (11). The target quaternary ammonium tracers, carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums ([11C]9a-c and [11C]11), were prepared by N-[11C]methylation of the tertiary amine precursors (8a-c and 10) with [11C]methyl triflate and isolated by a simplified solid-phase extraction (SPE) purification using a SiO2 or cation-exchange CM Sep-Pak cartridge in 40-65% radiochemical yields.
Energy Technology Data Exchange (ETDEWEB)
Bouanis, M.; Tourabi, M.; Nyassi, A. [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); Zarrouk, A. [LCAE-URAC 18, Faculty of Science, First Mohammed University, PO Box 717, M-60 000 Oujda (Morocco); Jama, C. [UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France); Bentiss, F., E-mail: fbentiss@gmail.com [Laboratoire de Catalyse et de Corrosion des Matériaux (LCCM), Faculté des Sciences, Université Chouaib Doukkali, B.P. 20, M-24000 El Jadida (Morocco); UMET-ISP, CNRS UMR 8207, ENSCL, Université Lille Nord de France, CS 90108, F-59652 Villeneuve d' Ascq Cedex (France)
2016-12-15
Highlights: • 2,5-Bis(4-dimethylaminophenyl)-1,3,4-oxadiazole is good corrosion inhibitor for carbon steel in 1 M HCl. • XPS analysis has provided the composition of adsorbed protective layer on the steel surface. • The adsorption of the investigated 1,3,4-oxadiazole is mainly due to chemisorption. - Abstract: Corrosion inhibition of carbon steel in normal hydrochloric acid solution at 30 °C by 2,5-bis(4-dimethylaminophenyl)-1,3,4-oxadiazole (DAPO) has been studied by weight loss measurements and electrochemical techniques (polarization and AC impedance). The experimental results showed that DAPO acted as an efficient inhibitor against the carbon steel corrosion in 1 M HCl, and its inhibition efficiency increased with the inhibitor concentration reaching a value up to 93% at 1 mM. Polarization studies showed that the DAPO was a mixed-type inhibitor. The adsorption of this 1,3,4-oxadiazole derivative on the carbon steel surface in 1 M HCl solution followed the Langmuir adsorption isotherm and the corresponding value of the standard Gibbs free energy of adsorption (ΔG°{sub ads}) is associated to a chemisorption mechanism. Scanning Electron Microscopy (SEM) and X-Ray Photoelectron Spectroscopy (XPS) analyses were carried out to characterize the chemical composition of the inhibitive film formed on the steel surface. The surfaces studies showed that the inhibitive layer is composed of an iron oxide/hydroxide mixture where DAPO molecules are incorporated. The cytotoxicity of DAPO was also determined using cell culture system.
Designing the STS-134 Re-Rendezvous: A Preparation for Future Crewed Rendezvous Missions
Stuit, Timothy D.
2011-01-01
In preparation to provide the capability for the Orion spacecraft, also known as the Multi-Purpose Crew Vehicle (MPCV), to rendezvous with the International Space Station (ISS) and future spacecraft, a new suite of relative navigation sensors are in development and were tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the Orion relative navigation sensors on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle orbiter at the end of the mission. Unlike the rendezvous and docking at the beginning of the mission, the re-rendezvous profile replicates the newly designed Orion coelliptic approach trajectory, something never before attempted with the shuttle orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this rerendezvous to make the flight test successful. Additionally, all of this work had to be integrated with the normal operations of the ISS and shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and rerendezvous trajectory design that would not only prove the design of the relative navigation sensors for the Orion vehicle, but also would serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.
Prediction of cesium-134 and strontium-85 crop uptake based on soil properties
International Nuclear Information System (INIS)
Roca, M.C.; Vallejo, V.R.; Roig, M.; Tent, J.; Vidal, M.; Rauret, G.
1997-01-01
Nowadays, there is still the need to improve the quantification of parameters that affect radionuclide mobility. With this aim, radiocesium and radiostrontium soil-to-plant transfer was measured in lysimeters in a Calcic Luvisol, loamy soil and in a Fluvisol, loam-sandy soil, using lettuce [Lactuca sativa L. cv. Kinemontepas] and pea plants [Pisum sativum L. cv. Kelvedon Wonder]. Weighted Concentration Ratios (WCR), expressed as kg soil/kg plant, were calculated for different growth stages. Weighted Concentration Ratios were in general higher for 85Sr than for 134Cs, and also higher in the loam-sandy than in the loamy soil. To predict plant uptake, we evaluated a set of soil properties to define a prediction factor for the relative transfer in the two soils using cation exchange capacity (CEC) and radionuclide available fraction (fav) for radiostrontium, and soil solution composition, solid-liquid distribution coefficient, and radionuclide available fraction for radiocesium. The ratios of WCR in the loam-sandy and loamy soil were compared with the prediction factor. There was good agreement in lettuce for 85Sr (ratio of WCR was 5.4 for seedling and 3.9 for commercial samples, whereas prediction factor was 3.1) and for 134Cs (ratio of WCR was 5.1 for seedling and 5.5 for commercial samples, the prediction factor being 5.1), although for pea only the relative root uptake of radiocesium in seedling pea was well predicted (the ratio of WCR was 8.8, the prediction factor being 9.1). These soil parameters improved former predictions based solely on the fav, although factors depending on plant physiology should be better evaluated
Lifescience Database Archive (English)
Full Text Available n 2 OS=Homo ... 33 0.91 sp|P03315|POLS_SFV Structural polyprotein OS=Semliki forest viru... 32 1.5 sp|P25386...ESSAATK 206 Query: 8 PL 3 L Sbjct: 207 KL 208 >sp|P03315|POLS_SFV Structural polyprotein OS=Semliki forest....6 tr|Q8JMP5|Q8JMP5_SFV Structural polyprotein OS=Semliki forest vi... 34 4.4 tr|A9BD99|A9BD99_PROM4 Trigger...ion protein OS=Semliki forest virus GN=C... 34 5.8 tr|Q809B6|Q809B6_SFV Structural polyprotein OS=Semliki forest...ONBE Predicted protein OS=Monosiga brevicollis... 34 4.4 tr|Q87049|Q87049_SFV Vir
International Nuclear Information System (INIS)
Fontana, C.; Tenero, A.Lo; Musumeci, R.G.; Valeriani, F.
2000-01-01
The Central Laboratory of The Italian Red Cross is part of the National Network for the Monitoring of the Environmental Radioactivity in Italy, coordinated by the National Environmental Agency (ANPA). The Central Laboratory took part in the national campaigns for the monitoring of the environmental gamma radioactivity in order to evaluate the deposition of artificial radioactivity on Italian territory after the Chernobyl accident. The distribution of the concentration of artificial radionuclide Cs-137 as reached, in North and Central Italy, the higher values: 2-185 kBq/m 2 and 0-40 kBq/m 2 . This paper presents the data of the concentration of artificial radionuclides Cs-137 and Cs-134 in mosses picked up in four different locations in the Campania Region of Italy with the help of the Department of the State Forestry Corp of S.Gregorio Matese, Vesuvio, Laviano, Piaggine from 1993 to 1998. The deposition of artificial radioactivity on the territory expected after the Chernobyl fallout was evaluated. The content of K-40 was also measured. Soil samples were also taken from the same sites. In this study Hypnum cupressiforme and Homalotecium lutescens mosses were used as bioindicators, available in all Italian ecosystems. The soil and moss samples were gathered according to a national standard procedure. These results, obtained by gamma spectrometry analyses, initially have shown values of medium concentration in mosses in the Campania Region of Cs-137 of 375 Bq/m 2 and of Cs-134 of 16 Bq/m 2 and K-40 of 150 Bq/m 2 in line with the ones of other Italian regions. The results of the average concentrations of the Cs-137 and Cs-134 in the mosses confirm a uniform distribution of post-Chernobyl radioactivity in the regional territory, in the Department of the State Forestry Corp of Vesuvio, Laviano and Piaggine. The results of Cs-137 and Cs-134 of S.Gregorio Matese are in accordance with the previous data relative to the monitoring campaign of mosses in Italy from 1992 to
134Cs foliar contamination of vine: translocation to grapes and transfer to wine
International Nuclear Information System (INIS)
Carini, F.; Anguissola Scotti, I.; Montruccoli, M.; Silva, S.
1996-01-01
Grape vines growing in pots placed in open field were contaminated by sprinkling an aqueous solution of carrier free 134 Cs. Activity was determined in acini and must at the ripening stage. Interception and Translocation Factors (TLF) were quantified. They strictly depend on the state of growth of the crop. Wine was produced by a laboratory process and analysed as to radiocesium. Transfer parameters, F r and P e , were calculated to predict radiocesium concentration in wine: it is 0.6 times the activity found in grapes. The leaf fruit translocation seems to be the dominant process in the contamination of acini when compared to direct deposition. (author)
Tomi, Ivan H. R.; Jaffer, Hamed J.; Aldhaif, Yasmeen A.
2018-04-01
A homologous series of new 13 esters, 4-(5-(p-tolyl)-1,3,4-thiadiazol-2-yl)-phenyl-4-alkoxybenzoate, (IVn), based on 1,3,4-thiadiazole core has been synthesized. The structures of these esters were confirmed by Fourier transform infrared spectroscopy, proton nuclear magnetic resonance and mass techniques. Their mesophases behavior was investigated with hot-stage polarizing optical microscope and differential scanning calorimetry. The thermal stability for most of these derivatives was measured by thermal gravimetric analysis. All the target esters showed enantiotropic mesomorphic behaviors with nematic and nematic/smectic C phases. The phase transition temperatures and liquid crystalline properties were affected by the nature of heterocyclic ring and the length of the alkoxy chain. Only the nematic phase was observed in the first 10 derivatives, (n = 1-10), while the last 3, (n = 12, 16 and 18) showed nematic and smectic C phases. These compounds demonstrated high liquid crystalline ranges, both in heating and cooling cycles. The mesomorphic results obtained were compared with the reported analogs of similar constituents.
Determination of beta-radiation in 14C-labelled biological samples by 2,5-diphenyl-1,3,4-oxadiazole
International Nuclear Information System (INIS)
Kiehl, B.; Neumann, R.; Beger, J.
1991-01-01
2,5-Diphenyl-1,3,4-oxadiazole (PPD) has been investigated for its suitability as a primary szintillator. This compound can be used together with the secondary szintillator POPOP in toluene solution for the measurement of low-energetic β-radiation in biological samples marked by 14 C. A convenient approach to laboratory syntheses is presented. (orig.) [de
Mugambi, Robert Muriuki; Agola, Eric L; Mwangi, Ibrahim N; Kinyua, Johnson; Shiraho, Esther Andia; Mkoji, Gerald M
2015-11-06
Hookworm infection is a major concern in sub-Saharan Africa, particularly in children and pregnant women. Necator americanus and Ancylostoma duodenale are responsible for this condition. Hookworm disease is one of the Neglected tropical diseases (NTDs) that are targeted for elimination through global mass chemotherapy. To support this there is a need for reliable diagnostic tools. The conventional diagnostic test, Kato-Katz that is based on microscopic detection of parasite ova in faecal samples, is not effective due to its low sensitivity that is brought about mainly by non-random distribution of eggs in stool and day to day variation in egg output. It is tedious, cumbersome to perform and requires experience for correct diagnosis. LAMP-based tests are simple, relatively cheap, offer greater sensitivity, specificity than existing tests, have high throughput capability, and are ideal for use at the point of care. We have developed a LAMP diagnostic test for detection of hookworm infection in faecal samples. LAMP relies on auto cycling strand displacement DNA synthesis performed at isothermal temperature by Bst polymerase and a set of 4 specific primers. The primers used in the LAMP assay were based on the second Internal Transcribed Spacer (ITS-2) region and designed using Primer Explorer version 4 Software. The ITS-2 region of the ribosomal gene (rDNA) was identified as a suitable target due to its low mutation rates and substantial differences between species. DNA was extracted directly from human faecal samples, followed by LAMP amplification at isothermal temperature of 63 °C for 1 h. Amplicons were visualized using gel electrophoresis and SYBR green dye. Both specificity and sensitivity of the assay were determined. The LAMP based technique developed was able to detect N. americanus DNA in faecal samples. The assay showed 100 % specificity and no cross-reaction was observed with other helminth parasites (S. mansoni, A. lumbricoides or T. trichiura). The
International Nuclear Information System (INIS)
Abdel-Sabour, M.F.; El-naggr, H.A.; Soliman, S.M.
1994-01-01
Out door lysimeter experiment was carried out to elucidate the effect of four inorganic and three organic salts on 60 Co and 134 Cs uptake and dry matter yield of three cuts of clover in the soil Inshas A new concept was proposed for assessing the difference in capacity of soil to supply radionuclides (i.e. 60 Co and 134 Cs) to plants as affected by applied inorganic or organic compounds. The relation of plant tissues (P c ) Co/IR Cs content with increasing time can be expressed as log (Pc) = A + B log time (T), where A and B the regression. When the same plant species is grown on the same soil differ only in the applied compound (e.g. Fe-EDDHA, Fe-DTPA, Fe-O A C, Fe(Coo)z, A1(OH)3, Ca(H2 P O 4 )2 and Fe 2 O 3 ) the equation will change to, log (P'c) = A + B' log (T) (I). Based on both equations, the relationship between (Pc) becomes; log (P'c) = [(A'B')/(A B + A B ) [ +[1/A'B + A B ) [ log (Pc) (II). The intercept (C) and slope (S) in Eq. (II) were determined among 7 treatments (for either 60 Co or 134 Cs). Then the difference of either Co or Cs accumulation with time between control and any other treatment was evaluated according to (C) and (S) values. The data also that Fe-DTPA is preferred for 60 Co as enhancing compound for plant uptake (for decontamination use); compared with other applied salts; on the other hand, any tested salts did not significantly effect 134 Cs taken by clover. Also, it was found that more than 70% of total cobalt uptake was accumulated in the roots which indicate that Co is less mobile in plants than Cs. 3 figs., 4 tabs
Pohl, M.; Reich, W.; Krichbaum, T. P.; Standke, K.; Britzen, S.; Reuter, H. P.; Reich, P.; Schlickeiser, R.; Fiedler, R. L.; Waltman, E. B.; Ghigo, F. D.; Johnston, K. J.
1995-11-01
We report on multifrequency radio observations made with the Effelsberg 100-m telescope, the IRAM 30-m telescope and the Green Bank Interferometer between 1992 and 1994 of the γ-ray quasar 0528+134. We present a new VLBI based map of 0528+134 at 22GHz with sub-mas angular resolution observed in November 1992. At that time the source was in a phase of brightening at all of our observing frequencies above 3GHz. The increase of brightness may be related to activity in the unresolved core component of the quasar. The VLBI map at 22GHz (epoch 1992.85) shows a one-sided core jet structure of ~5mas length. A new component close to the core indicates an apparent transverse velocity of β_app_object of the AGN and that a remnant of this outburst moved further outward in the jet until it became optically thin at radio frequencies after a few months. During the flare in July 1993 we observed with the Effelsberg 100-m telescope an unusually strong decrease of the flux density by about 50% at 4.75GHz and 10.55GHz and slightly less at 2.695GHz. This behaviour is also seen in the monitoring data at 2.25GHz and 8.3GHz taken with the Green Bank Interferometer (NRL-GBI). The event lasted less than three days at the higher frequencies and more than two weeks at 2.25GHz. For the case that this event is related to the intense radio flare some geometrical effects like a small variation of the viewing angle of the quasars jet orientated very close to the line of sight are considered, but found to be an unlikely explanation for the observed behaviour. Alternatively, an extreme scattering event by a small dense plasma cloud in the line of sight is able to match the observed time lag in the lightcurves if we take into account the mas-structure of the source and different spectra of the components on the basis of their brightness in the VLBI maps. The importance of interstellar scattering is stressed as 0528+134 is seen in the direction of the dark cloud Barnard 30 located at 400pc distance
Directory of Open Access Journals (Sweden)
Kandhaswamy Karthikeyan
2017-01-01
Full Text Available In this work, the performance of R134a based automobile air conditioning system has been evaluated by retrofitted with R290/R600a mixture (in the ratio of 50:50, by mass, as an alternative. The performance was evaluated at five different operating speeds (1000, 1500, 2000, 2500, and 3000, which covers the entire range of working conditions with four different cabin load (100, 200, 300, and 400 W. The condenser inlet air temperature was varied in the range between 30 and 50°C, which covers the entire climatic variations in Coimbatore city of India. The performance characteristics such as, refrigerating effect, coefficient of performance, compressor power consumption, and compressor discharge temperatures were considered for comparison. The results showed that, hydrocarbon mixture has faster cooling rate due to its high latent heat of vaporization, 5% higher coefficient of performance due to higher refrigeration effect, 8-10 K lower compressor discharge temperature due to its lower specific heat ratio with 5% lower compressor power consumption due to its lower viscosity and lower liquid density. The charge requirement of R290/R600a mixture is about 50% less compared to R134a. However, the mixture composition is considered as an interment replacement in automobile air conditioners due to composition shift under leak-age conditions. Hence, R290/R600a mixture is considered as an interim energy efficient and environment friendly option in R134a automobile air conditioners to extend its life.
1.34 µm picosecond self-mode-locked Nd:GdVO4 watt-level laser
Han, Ming; Peng, Jiying; Li, Zuohan; Cao, Qiuyuan; Yuan, Ruixia
2017-01-01
With a simple linear configuration, a diode-pumped, self-mode-locked Nd:GdVO4 laser at 1.34 µm is experimentally demonstrated for the first time. Based on the aberrationless theory of self-focusing and thermal lensing effect, through designing and optimizing the resonator, a pulse width as short as 9.1 ps is generated at a repetition rate of 2.0 GHz and the average output power is 2.51 W. The optical conversion efficiency and the slope efficiency for the stable mode-locked operation are approximately 16.7% and 19.2%, respectively.
International Nuclear Information System (INIS)
Zvonova, I.A.; Jesko, T.V.; Balonov, M.I.; Danilova, I.O.; Wallstroem, E.; Alpsten, M.; Thornberg, C.; Mattsson, S.
1995-01-01
Six western districts of the Bryansk region, Russia, were heavily contaminated with radioactive fallout after the Chernobyl NPP accident. Annually, between 1991 and 1994, inhabitants of four settlements were studied. Whole-body 134+137 Cs contents were measured in about 500 inhabitants. No correlation between Cs whole-body content and Cs soil contamination was found; Cs accumulation in a body depends greatly on natural factors such as type of soil, on social factors such as food habits including consumption of forest products, and on countermeasures to reduce internal exposure. During 1991-1994 average whole-body content of 134+137 Cs in adult inhabitants was about 3-60 kBq, corresponding to an effective dose of 0.1-2.4 mSv.y -1 . Cs whole-body content increases equally for girls and boys up to adult age. Cs content in adults does not depend significantly on age and is usually 1.2-2 times higher in men than in women. The average annual internal effective dose varies with age significantly less than 134+137 Cs whole-body content. In children (0-5 years) the mean absorbed dose is usually 1.2-1.5 times less than in adults. (author)
Energy Technology Data Exchange (ETDEWEB)
Sapali, S N [Govt. College of Engineering, Department of Mechanical Engineering, Shivaji Nagar, Pune, Maharashtra 411 005 (India); Patil, Pradeep A [AISSMS College of Engineering, Pune University, Mechanical Engineering Department, Kennedy Road, Near R.T.O., Pune, Maharashtra 411 001 (India)
2010-11-15
In recent small and medium capacity refrigeration systems, the condenser tubes are provided with micro-fins from inside. The vapour refrigerant at the compressor outlet and the condenser inlet is in superheat state. As it advances in the condenser it is in two phases and at the outlet it is in sub cooled liquid. The heat transfer coefficient (HTC) during condensation of HFC-134a and R-404A in a smooth (8.56 mm ID) and micro-fin tubes (8.96 mm ID) are experimentally investigated. Different from previous studies, the present experiments are performed for various condensing temperatures, with superheating and sub cooling and using hermetically sealed compressor. The test runs are done at average saturated condensing temperatures ranging from 35 C to 60 C. The mass fluxes are between 90 and 800 kg m{sup -2} s{sup -1}. The experimental results indicate that the average HTC increases with mass flux but decreases with increasing condensing temperature for both smooth and micro-fin tubes. The average condensation HTCs of HFC-134a and R-404A for the micro-fin tubes were 1.5-2.5 and 1.3-2 times larger than that in smooth tube respectively. The HTCs for R-404A are less than that of HFC-134a. New correlations based on the data gathered during the experimentation for predicting condensation HTCs are proposed for wide range of operating conditions. (author)
Energy Technology Data Exchange (ETDEWEB)
Jung, Dongsoo; Cho, Youngmok; Park, Kiho [Inha Univ., Incheon (Korea). Dept. of Mechanical Engineering
2004-01-01
Flow condensation heat transfer coefficients (HTCs) of R22, R134a, R407C, and R410A inside horizontal plain and microfin tubes of 9.52 mm outside diameter and 1 m length were measured at the condensation temperature of 40{sup o}C with mass fluxes of 100, 200, and 300 kg m{sup -2} s{sup -1} and a heat flux of 7.7-7.9 kW m{sup -2}. For a plain tube, HTCs of R134a and R410A were similar to those of R22 while HTCs of R407C are 11-15% lower than those of R22. For a microfin tube, HTCs of R134a were similar to those of R22 while HTCs of R407C and R410A were 23-53% and 10-21% lower than those of R22. For a plain tube, our correlation agreed well with the present data for all refrigerants exhibiting a mean deviation of 11.6%. Finally, HTCs of a microfin tube were 2-3 times higher than those of a plain tube and the heat transfer enhancement factor decreased as the mass flux increased for all refrigerants tested. (Author)
International Nuclear Information System (INIS)
Zijian Zhang; Kazuhiko Ninomiya; Naruto Takahashi; Atsushi Shinohara
2015-01-01
To investigate the time variations of radionuclides discharged from the Fukushima Daiichi nuclear power plants accident, we started collecting aerosol samples in Osaka, Japan, using a high-volume sampler from March 15 to May 1, 2011. Atmospheric radioactivity concentrations of I-131, Cs-134 and Cs-137 were measured with germanium semi-conductor detectors. Only I-131 was detected in the early phase and two Cs-134.137 peaks were found in Osaka in April. Using the HYSPLIT model, we concluded that direct transportation of the air mass from the Fukushima area was responsible for such events. (author)
McEwan, William A; McMonagle, Elizabeth L; Logan, Nicola; Serra, Rodrigo C; Kat, Pieter; Vandewoude, Sue; Hosie, Margaret J; Willett, Brian J
2008-11-01
The env open reading frames of African lion (Panthera leo) lentivirus (feline immunodeficiency virus [FIV(Ple)]) subtypes B and E from geographically distinct regions of Africa suggest two distinct ancestries, with FIV(Ple)-E sharing a common ancestor with the domestic cat (Felis catus) lentivirus (FIV(Fca)). Here we demonstrate that FIV(Ple)-E and FIV(Fca) share the use of CD134 (OX40) and CXCR4 as a primary receptor and coreceptor, respectively, and that both lion CD134 and CXCR4 are functional receptors for FIV(Ple)-E. The shared usage of CD134 and CXCR4 by FIV(Fca) and FIV(Ple)-E may have implications for in vivo cell tropism and the pathogenicity of the E subtype among free-ranging lion populations.
Mrozek, A.; Karolak-Wojciechowska, J.; Amiel, P.; Barbe, J.
2000-06-01
Crystal structures of four bisubstituted 1,3,4-thiadiazole derivatives were determined. Detailed description of the five-membered heteroring geometry is enabled thorough analysis of ring aromaticity. For this purpose the HOMA index was used as a quantitative measure of aromaticity. The calculated HOMA indices evidenced the role of substituents. In particular, increase in the substituent electrophilicity brings about increase in aromaticity.
Synthesis and antibacterial activity of some derivatives of 1,3,4-thia-dia-zol[3,2-a]pyrimidine
International Nuclear Information System (INIS)
Sangov, Z.G.
2004-01-01
The purpose of this work is direct synthesis of derivatives of 1,3,4-thia-dia-zol[3,2-a]pyrimidine containing functional groups in second and sixth position of cycle, studying antibacterial activity obtained compounds on culture fungus, typical for this region and searching for new high-effective biologically active matters with low toxicity which let wide assortment of medicinal preparations
ANALISIS PERBANDINGAN EVAPORATOR KULKAS (LEMARI ES DENGAN MENGUNAKAN REFRIGERANT R-22 DAN R-134A
Directory of Open Access Journals (Sweden)
Imam Faozan
2017-03-01
Full Text Available Tulisan ini bertujuan untuk mengetahui komponen mesin refrigerasi khususnya pembahasan evaporator. Dalam penelitian ini digunakan lemari pendingin (kulkas sederhana untuk pengawetan dan pendinginan bahan makanan dalam rumah tangga. Untuk refrigerant yang digunakan adalah Refrigerant Freon R – 22 dan Freon R - 134a sebagai perbandingan dan untuk mengetahui performance evaporator ( COP pada mesin refrigerasi untuk rumah tangga. Lemari pendingin yang dianalisa berukuran tinggi = 1 m, panjang = 0,55 m dan lebar 0,5 m. Temperatur evaporasi = -5°C dan temperature kondensasi = 40°C.
Energy Technology Data Exchange (ETDEWEB)
Ford, B C; Jester, W A; Griffith, S M; Morse, R A; Zall, R R; Lisk, D J; Burgett, D M; Bodyfelt, F W
1988-01-01
As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence.
Energy Technology Data Exchange (ETDEWEB)
Gao Mingzhang; Wang Min [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States); Zheng Qihuang [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States)], E-mail: qzheng@iupui.edu
2008-02-15
Small conductance Ca{sup 2+}-activated K{sup +} (SK{sub Ca}) channels play an important role in many functions such as neuronal communication and behavioral plasticity, secretion, and cell proliferation. SK{sub Ca} channel modulation is associated with various brain, heart, and cancer diseases. N-methyl-laudanosine and its structurally related derivatives, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums, are reversible and selective SK{sub Ca} channel blockers. Carbon-11 labeled N-methyl-laudanosine and its tetrahydroisoquinolinium derivatives may serve as new probes for positron emission tomography (PET) to image SK{sub Ca} channels in the brain, heart, and cancer. The key intermediates, substituted isoquinolines (3a-c), were synthesized using a modification of the Pomeranz-Fritsch procedure. The precursors, substituted 1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinolines (8a-c), and their corresponding reference standards, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums (9a-c), were synthesized from compounds 3a-c with 3,4-dimethoxybenzyl chloride (2) in multiple steps with moderate to excellent chemical yields. The precursor 6,7-dimethoxy-1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3, 4-tetrahydroisoquinoline (10) was commercially available, and the methylation of compound 10 with methyl iodide provided N-methyl-laudanosine (11). The target quaternary ammonium tracers, carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums ([{sup 11}C]9a-c and [{sup 11}C]11), were prepared by N-[{sup 11}C]methylation of the tertiary amine precursors (8a-c and 10) with [{sup 11}C]methyl triflate and isolated by a simplified solid-phase extraction (SPE) purification using a SiO{sub 2} or cation-exchange CM Sep-Pak cartridge in 40-65% radiochemical yields.
Directory of Open Access Journals (Sweden)
Shalinder Singh
2012-01-01
Full Text Available Insertional translocations in which a duplicated region of one chromosome is inserted into another chromosome are very rare. We report a 16.5-year-old girl with a terminal duplication at 9q34.3 of paternal origin inserted into 19q13.4. Chromosomal analysis revealed the karyotype 46,XX,der(19ins(19;9(q13.4;q34.3q34.3pat. Cytogenetic microarray analysis (CMA identified a ~2.3Mb duplication of 9q, which was confirmed by Fluorescence in situ hybridisation (FISH. The duplication at 9q34.3 is the smallest among the cases reported so far. The proband exhibits similar clinical features to those previously reported cases with larger duplication events.
International Nuclear Information System (INIS)
Labrecque, J.J.; Rosales, P.A.
1990-01-01
Two sets of calibration standards for 134 Cs and 137 Cs were prepared by small serial dilution of a natural matrix standard reference material, IAEA-154 whey powder. The first set was intended to screen imported milk powders which were suspected to be contaminated with 134 Cs and 137 Cs. Their concentration ranged from 40 to 400 Bq/kg. The other set of calibration standards was prepared to measure the environmental levels of 137 Cs in commercial Venezuelan milk powders. Their concentration ranged from 3 to 10 Bq/kg of 137 Cs. The accuracy of these calibration curves was checked by IAEA-152 and A-14 milk powders. Their measured values were in good agreement with their certified values. Finally, it is shown that these preparation techniques using serial dilution of a standard reference material were simple, rapid, precise, accurate and cost-effective. (author) 5 refs.; 5 figs.; 3 tabs