Proceedings of twelfth ISMAS symposium cum workshop on mass spectrometry

International Nuclear Information System (INIS)

Alamelu, D.; Jaison, P.G.; Aggarwal, S.K.

2007-03-01

Mass Spectrometry is an important analytical tool and has encompassed almost all branches of science and technology including Agricultural, biology, Chemistry, Earth sciences, environment, Forensic Science, Medical Sciences, Hydrology, Nuclear Technology, Oceanography, Physics etc. Recent advancements in the instrumentation of Mass Spectrometry have further strengthened its role for various applications. It is indeed a matter of great pleasure to present this special Issue of ISMAS Bulletin which is brought out on the occasion of the 12th ISMAS Symposium cum Workshop on Mass spectrometry (12th ISMAS-WS 2007) being held at Cidade-de-Goa, Dona Paula, Goa from March 25 to 30, 2007 in association with National Institute of Oceanography, Goa. This Symposium cum Workshop is co-sponsored by Scientific Departments of Government of India. Papers relevant to INIS are indexed separately

Gravitational Jaynes–Cummings model beyond the rotating wave

Indian Academy of Sciences (India)

In this paper, the quantum properties of a two-level atom and the cavity-field in the Jaynes–Cummings model with the gravity beyond the rotating wave approximation are investigated. For this purpose, by solving the Schrödinger equation in the interaction picture, the evolving state of the system is found by which the ...

Advanced adsorption cooling cum desalination cycle: A thermodynamic framework

KAUST Repository

Chakraborty, Anutosh

2011-01-01

We have developed a thermodynamic framework to calculate adsorption cooling cum desalination cycle performances as a function of pore widths and pore volumes of highly porous adsorbents, which are formulated from the rigor of thermodynamic property surfaces of adsorbent-adsorbate system and the adsorption interaction potential between them. Employing the proposed formulations, the coefficient of performance (COP) and overall performance ratio (OPR) of adsorption cycle are computed for various pore widths of solid adsorbents. These results are compared with experimental data for verifying the proposed thermodynamic formulations. It is found from the present analysis that the COP and OPR of adsorption cooling cum desalination cycle is influenced by (i) the physical characteristics of adsorbents, (ii) characteristics energy and (iii) the surface-structural heterogeneity factor of adsorbent-water system. The present study confirms that there exists a special type of adsorbents having optimal physical characteristics that allows us to obtain the best performance.

Concurrence of three Jaynes-Cummings systems

Science.gov (United States)

Qiang, Wen-Chao; Sun, Guo-Hua; Dong, Qian; Camacho-Nieto, Oscar; Dong, Shi-Hai

2018-04-01

We apply genuine multipartite concurrence to investigate entanglement properties of three Jaynes-Cummings systems. Three atoms are initially put in GHZ-like state and locally interact with three independent cavities, respectively. We present analytical concurrence expressions for various subsystems including three-atom, three-cavity and some atom-cavity mixed systems. We also examine the global system and illustrate the evolution of its concurrence. Except for the sudden death of entanglement, we find for some initial entanglement parameter θ , the concurrence of the global system may maintain unchanged in some time intervals.

Collision dynamics of the coherent Jaynes-Cummings model

International Nuclear Information System (INIS)

Rabello, M.L.C.; Toledo Piza, A.F.R. de.

1985-01-01

The anatomy of the dynamics of quantum correlations of two interacting subsystems described by the Jaynes-Cummings Model is studied, making use of a natural states decomposition, following an old suggestion by Schroedinger. The amplitude modulation of the fast Rabi oscillations which occur for a strong, coherent initial field is obtained from the spin intrinsic depolarization resulting from corrections to the mean field approximation. (Author) [pt

Plea bargaining and the religious cum socio-cultural concept of ...

African Journals Online (AJOL)

Plea bargaining and the religious cum socio-cultural concept of Yoruba ọmọlúàbí in the Nigerian political landscape. ... Ilorin Journal of Religious Studies ... It therefore, attempts to define what is meant by plea bargaining, introduction as to its ...

Chronic antidepressant administration alleviates frontal and hippocampal BDNF deficits in CUMS rat.

Science.gov (United States)

Zhang, Yang; Gu, Fenghua; Chen, Jia; Dong, Wenxin

2010-12-17

Stress activates the hypothalamo-pituitary-adrenal (HPA) axis, regulates the expression of brain-derived neurotrophic factor (BDNF) in the brain, and mediates mood. Antidepressants alleviate stress and up-regulate BDNF gene expression. In this study, we investigated the effect of chronic unpredictable mild stress (CUMS) and the different kinds of antidepressant treatments on the HPA axis and the BDNF expression in the rat brain. Adult Wistar male rats were exposed to a six-week CUMS procedure and received different antidepressant treatments including venlafaxine, mirtazapine, and fluoxetine. Immunohistochemistry and real-time PCR were used to measure BDNF expression levels in the rat brain, and ELISAs were used to investigate the plasma corticosterone (CORT) and adrenocorticotropic hormone (ACTH) levels. CUMS significantly decreased the BDNF protein level in the DG, CA1, and CA3 of the hippocampus and increased plasma CORT level. Chronic antidepressant treatments all significantly increased BDNF protein levels in the hippocampus and the pre-frontal cortex. In addition, venlafaxine and mirtazapine inhibited the increase of plasma CORT level. These results suggested that an increase in the BDNF level in the brain could be a pivotal mechanism of various antidepressants to exert their therapeutic effects. Copyright © 2010 Elsevier B.V. All rights reserved.

Generalized Tavis-Cummings models and quantum networks

Science.gov (United States)

Gorokhov, A. V.

2018-04-01

The properties of quantum networks based on generalized Tavis-Cummings models are theoretically investigated. We have calculated the information transfer success rate from one node to another in a simple model of a quantum network realized with two-level atoms placed in the cavities and interacting with an external laser field and cavity photons. The method of dynamical group of the Hamiltonian and technique of corresponding coherent states were used for investigation of the temporal dynamics of the two nodes model.

Cum se traduce ‘rușinea’. Abordare traductologică (I

Directory of Open Access Journals (Sweden)

Magda Jeanrenaud

2017-03-01

Full Text Available Pornind de la sfera semantică și lexicală a conceptelor honte (limba franceză și, respectiv, rușine (limba română, îmi propun să examinez modul cum se traduce acesta în limba română pornind de la un studiu de caz. În acest scop, voi încerca să elaborez un studiu traductologic comparativ al lucrării lui Boris Cyrulnik, intitulată Mourir de dire. La honte (Éditions Odile Jacob, Paris, 2010 și a traducerii sale în limba română, intitulată Mai bine mor decît să spun. Rușinea (traducere din limba franceză de Valentin Protopopescu, Editura Trei, col. „Psihologia pentru toți”, București, 2012. Textul lui Cyrulnik are o particularitate: oscilează între factura literară și cea a unui text specializat. Din acest punct de vedere, transpunerea lui pune la încercare teoriile funcționaliste ale traducerii și, mai ales, teoria skopos-ului elaborată de Katharina Reiss și Hans Vermeer: este interesant de analizat cum „decodează” traducătorul „intenționalitatea” acestui tip de text, totuși specializat, cum decide el să transpună sfera sa semantică și lexicală în limba română.

Berry phase in a two-atom Jaynes-Cummings model with Kerr medium

International Nuclear Information System (INIS)

Bu Shenping; Zhang Guofeng; Liu Jia; Chen Ziyu

2008-01-01

The Jaynes-Cummings model (JCM) is an very important model for describing interaction between quantized electromagnetic fields and atoms in cavity quantum electrodynamics (QED). This model is generalized in many different directions since it predicts many novel quantum effects that can be verified by modern physics experimental technologies. In this paper, the Berry phase and entropy of the ground state for arbitrary photon number n of a two-atom Jaynes-Cummings model with Kerr-like medium are investigated. It is found that there is some correspondence between their images, especially the existence of a curve in the Δ-ε plane along which the energy, Berry phase and entropy all reach their special values. So it is available for detecting entanglement by applying Berry phase.

Berry phase in a two-atom Jaynes-Cummings model with Kerr medium

Energy Technology Data Exchange (ETDEWEB)

Bu Shenping; Zhang Guofeng; Liu Jia; Chen Ziyu [Department of Physics, School of Science, BeiHang University, Xueyuan Road, Beijing 100083 (China)], E-mail: chenzy@buaa.edu.cn

2008-12-15

The Jaynes-Cummings model (JCM) is an very important model for describing interaction between quantized electromagnetic fields and atoms in cavity quantum electrodynamics (QED). This model is generalized in many different directions since it predicts many novel quantum effects that can be verified by modern physics experimental technologies. In this paper, the Berry phase and entropy of the ground state for arbitrary photon number n of a two-atom Jaynes-Cummings model with Kerr-like medium are investigated. It is found that there is some correspondence between their images, especially the existence of a curve in the {delta}-{epsilon} plane along which the energy, Berry phase and entropy all reach their special values. So it is available for detecting entanglement by applying Berry phase.

The squeezing properties in the Jaynes-Cummings model with arbitrary intensity-dependent coupling

International Nuclear Information System (INIS)

Rhui-Hua, X.; Dun-Huan, L.; Gong-Ou, X.

1996-01-01

It is studied the squeezing properties of the atom and the radiation field in arbitrary intensity-dependent-coupling Jaynes-Cummings model when it is restricted to the following initial condition: the atom in its coherent state and the field in the vacuum state. The influence of virtual-photon processes on the atomic squeezing predicted by the Jaynes-Cummings model (JCM) has been examined. The relationship between the field and atomic squeezing in the resonant multi-photon JCM has been discussed. The symmetry between the field and atomic squeezing (SFAS) has been exposed in the resonant vacuum one-photon JCM, and the influence of non-resonant interaction and virtual-photon processes on the SFAS has also been discussed

Advertisement for the position of “Copy Editor cum Proof Reader ...

Indian Academy of Sciences (India)

user

Advertisement for the position of “Copy Editor cum. Proof Reader”. Indian Academy of Sciences (IASc), an institution under the. Department of Science & Technology, Government of India publishes scholarly journals, thematic books and other publications. The. Academy currently publishes 10 journals in various disciplines ...

General sets of coherent states and the Jaynes-Cummings model

International Nuclear Information System (INIS)

Daoud, M.; Hussin, V.

2002-01-01

General sets of coherent states are constructed for quantum systems admitting a nondegenerate infinite discrete energy spectrum. They are eigenstates of an annihilation operator and satisfy the usual properties of standard coherent states. The application of such a construction to the quantum optics Jaynes-Cummings model leads to a new understanding of the properties of this model. (author)

Qudit quantum computation in the Jaynes-Cummings model

DEFF Research Database (Denmark)

Mischuck, Brian; Mølmer, Klaus

2013-01-01

We have developed methods for performing qudit quantum computation in the Jaynes-Cummings model with the qudits residing in a finite subspace of individual harmonic oscillator modes, resonantly coupled to a spin-1/2 system. The first method determines analytical control sequences for the one......- and two-qudit gates necessary for universal quantum computation by breaking down the desired unitary transformations into a series of state preparations implemented with the Law-Eberly scheme [ Law and Eberly Phys. Rev. Lett. 76 1055 (1996)]. The second method replaces some of the analytical pulse...

Status of air quality in arenas in the Abitibi-Temiscamingue 2004-2005

International Nuclear Information System (INIS)

Gagne, D.

2005-01-01

The air quality was checked in 24 of 26 arenas in Quebec's Abitibi-Temiscamingue region during the intensive tournament season from November 2004 to March 2005. Carbon monoxide (CO) levels were measured in 24 arenas, while nitrogen dioxide (NO 2 ) levels were measured in 22 arenas during and after intensive use of the ice surfacing machine. The air quality respected the public health criteria for CO and NO 2 in 87 and 95 per cent of the arenas, respectively. The main factors that influence the ambient air quality in the arenas included the maintenance of the ice surfacing machine, the system of radiant heating and ventilation of combustion gases. In more than half of the arenas, the ice surfacing machine had been tuned prior to the active season. In 28 per cent of the arenas, maintenance inspections were carried out only twice during the season. Two arenas were equipped with an electric ice surfacing machine. All arenas had a mechanical ventilation system. It was concluded that the proportion of arenas that do not respect public health criteria at the time of monitoring varied between 4 and 23 per cent. While the negligence of operators is often in question, the failures of ventilation systems or a contamination by external sources of CO are often unforeseeable. For these reasons, it was recommended that annual monitoring should be conducted by an external organization. 9 refs., 7 figs.

Dynamics of pairwise entanglement between two Tavis-Cummings atoms

International Nuclear Information System (INIS)

Guo Jinliang; Song Heshan

2008-01-01

We investigate the time evolution of pairwise entanglement between two Tavis-Cummings atoms for various entangled initial states, including pure and mixed states. We find that the phenomenon of entanglement sudden death behaviors is distinct in the evolution of entanglement for different initial states. What deserves mentioning here is that the initial portion of the excited state in the initial state is responsible for the sudden death of entanglement, and the degree of this effect also depends on the initial states

Roles de los Centros Universitarios Municipales (CUM en el desarrollo local de los municipios cubanos

Directory of Open Access Journals (Sweden)

Carlos A. Hernández M.

2012-06-01

Full Text Available Se conceptualiza en el aporte de la Educación Superior al Desarrollo Local en los municipios, cómo se inserta en el proceso, las amenazas a su participación y las oportunidades generadas por su inclusión. Se analiza la situación actual y perspectiva y las Estrategias a seguir por la Educación Superior en los municipios. Se define como se trabaja la seguridad alimentaria en función del Desarrollo Local, la superación de Postgrado en el CUM, la formación y superación de los cuadros, la participación en proyectos pertinentes en energía, medio ambiente, servicios a la población, industrias locales y problemas socio - comunitarios y la formación vocacional y articulación pertinente con la Enseñanza Técnico Profesional. Por último se hace una propuesta de Indicadores y herramientas para medir el impacto de la Gestión del Conocimiento y la Innovación dentro del Programa de Desarrollo Local dividida en 2 grupos: Indicadores de funcionamiento interno del CUM e Indicadores de funcionamiento del CUM hacia el Desarrollo Local del Municipio.

BDNF/TrkB Pathway Mediates the Antidepressant-Like Role of H2S in CUMS-Exposed Rats by Inhibition of Hippocampal ER Stress.

Science.gov (United States)

Wei, Le; Kan, Li-Yuan; Zeng, Hai-Ying; Tang, Yi-Yun; Huang, Hong-Lin; Xie, Ming; Zou, Wei; Wang, Chun-Yan; Zhang, Ping; Tang, Xiao-Qing

2018-06-01

Our previous works have shown that hydrogen sulfide (H 2 S) significantly attenuates chronic unpredictable mild stress (CUMS)-induced depressive-like behaviors and hippocampal endoplasmic reticulum (ER) stress. Brain-derived neurotrophic factor (BDNF) generates an antidepressant-like effect by its receptor tyrosine protein kinase B (TrkB). We have previously found that H 2 S upregulates the expressions of BDNF and p-TrkB in the hippocampus of CUMS-exposed rats. Therefore, the present work was to explore whether BDNF/TrkB pathway mediates the antidepressant-like role of H 2 S by blocking hippocampal ER stress. We found that treatment with K252a (an inhibitor of BDNF/TrkB pathway) significantly increased the immobility time in the forced swim test and tail suspension test and increased the latency to feed in the novelty-suppressed feeding test in the rats cotreated with sodium hydrosulfide (NaHS, a donor of H 2 S) and CUMS. Similarly, K252a reversed the protective effect of NaHS against CUMS-induced hippocampal ER stress, as evidenced by increases in the levels of ER stress-related proteins, glucose-regulated protein 78, CCAAT/enhancer binding protein homologous protein and cleaved caspase-12. Taken together, our results suggest that BDNF/TrkB pathway plays an important mediatory role in the antidepressant-like action of H 2 S in CUMS-exposed rats, which is by suppression of hippocampal ER stress. These data provide a novel mechanism underlying the protection of H 2 S against CUMS-induced depressive-like behaviors.

Enhanced Harnessing of the Graviola Bioactive Components Using a Neoteric Sonication Cum Microwave Coadjuvant Extraction Protocol

Directory of Open Access Journals (Sweden)

Se Chul Chun

2018-02-01

Full Text Available Graviola is one of the most accomplished natural anticancer therapists gaining popularity in recent times. Harnessing the full benefit from tapping all of its rich bioactive reservoirs is absolutely worthy and mandatory. It is in this regard that a well optimized extraction methodology gains paramount importance. In case of Graviola, no sophistication in terms of extraction methods is reported. A neoteric sonication cum microwave combined extraction technology was introduced that maximized the extraction process and minimized (7 min the extraction time. The extraction efficiency was validated based on the significant enrichment of bioactive ingredients in Graviola extracts following the sonication cum microwave combined protocol.

Dynamics of atom-field entanglement for Tavis-Cummings models

Science.gov (United States)

Bashkirov, Eugene K.

2018-04-01

An exact solution of the problem of two-atom one- and two-mode Jaynes-Cummings model with intensity- dependent coupling is presented. Asymptotic solutions for system state vectors are obtained in the approximation of large initial coherent fields. The atom-field entanglement is investigated on the basis of the reduced atomic entropy dynamics. The possibility of the system being initially in a pure disentangled state to revive into this state during the evolution process for both models is shown. Conditions and times of disentanglement are derived.

X-linked ocular albinism in Blacks. Ocular albinism cum pigmento.

Science.gov (United States)

O'Donnell, F E; Green, W R; Fleischman, J A; Hambrick, G W

1978-07-01

X-linked ocular albinism can be an unsuspected cause of congenital nystagmus in blacks. In this study, eight of ten black ocular albinos from two kindreds had nonalbinotic, moderately pigmented fundi and no transillumination of the iris. We refer to this paradoxical condition as "ocular albinism cum pigmento." The only constant ophthalmoscopic feature was a foveal hypoplasia. Biopsy of clinically normal skin to demonstrate giant pigment granules is the most accurate means of diagnosis.

A noble additive cum compatibilizer for dispersion of nanoclay into ethylene octene elastomer

CSIR Research Space (South Africa)

Mondal, S

2016-06-01

Full Text Available This paper introduces a poly(ethylene-co-octene)-poly(ethylene-co-vinyl acetate) double network hybrid as a noble additive cum compatibilizer for poly(ethylene-co-octene) (POE). The addition of only 0.5 mass% of the hybrid into POE has raised...

Status of air quality in arenas in the Abitibi-Temiscamingue 2004-2005; Portrait de la qualite de l'air dans les arenas de l'Abitibi-Temiscamingue 2004-2005

Energy Technology Data Exchange (ETDEWEB)

Gagne, D. (ed.)

2005-09-13

The air quality was checked in 24 of 26 arenas in Quebec's Abitibi-Temiscamingue region during the intensive tournament season from November 2004 to March 2005. Carbon monoxide (CO) levels were measured in 24 arenas, while nitrogen dioxide (NO{sub 2}) levels were measured in 22 arenas during and after intensive use of the ice surfacing machine. The air quality respected the public health criteria for CO and NO{sub 2} in 87 and 95 per cent of the arenas, respectively. The main factors that influence the ambient air quality in the arenas included the maintenance of the ice surfacing machine, the system of radiant heating and ventilation of combustion gases. In more than half of the arenas, the ice surfacing machine had been tuned prior to the active season. In 28 per cent of the arenas, maintenance inspections were carried out only twice during the season. Two arenas were equipped with an electric ice surfacing machine. All arenas had a mechanical ventilation system. It was concluded that the proportion of arenas that do not respect public health criteria at the time of monitoring varied between 4 and 23 per cent. While the negligence of operators is often in question, the failures of ventilation systems or a contamination by external sources of CO are often unforeseeable. For these reasons, it was recommended that annual monitoring should be conducted by an external organization. 9 refs., 7 figs.

Dynamics of Entanglement in Jaynes–Cummings Nodes with Nonidentical Qubit-Field Coupling Strengths

Directory of Open Access Journals (Sweden)

Li-Tuo Shen

2017-07-01

Full Text Available How to analytically deal with the general entanglement dynamics of separate Jaynes–Cummings nodes with continuous-variable fields is still an open question, and few analytical approaches can be used to solve their general entanglement dynamics. Entanglement dynamics between two separate Jaynes–Cummings nodes are examined in this article. Both vacuum state and coherent state in the initial fields are considered through the numerical and analytical methods. The gap between two nonidentical qubit-field coupling strengths shifts the revival period and changes the revival amplitude of two-qubit entanglement. For vacuum-state fields, the maximal entanglement is fully revived after a gap-dependence period, within which the entanglement nonsmoothly decreases to zero and partly recovers without exhibiting sudden death phenomenon. For strong coherent-state fields, the two-qubit entanglement decays exponentially as the evolution time increases, exhibiting sudden death phenomenon, and the increasing gap accelerates the revival period and amplitude decay of the entanglement, where the numerical and analytical results have an excellent coincidence.

Measurement Induced Enhancement of Squeezing in Nondegenerate Two-Photon Jaynes-Cummings Model

International Nuclear Information System (INIS)

Ye Saiyun

2006-01-01

Squeezing properties in the nondegenerate two-photon Jaynes-Cummings model are investigated. The effects of direct selective atomic measurement and the application of the classical field followed by atomic measurement are analyzed. Different values of the parameters of the classical field are taken into account. It is found that the field squeezing can be enhanced by measurement.

Application of Singh et al., unbiased estimator in a dual to ratio-cum ...

African Journals Online (AJOL)

This paper applied an unbiased estimator in a dual to ratio–cum-product estimator in sample surveys to double sampling design. Its efficiency over the conventional biased double sampling design estimator was determined based on the conditions attached to its supremacy. Three different data sets were used to testify to ...

An algebraic method to solve the Tavis-Cummings problem

International Nuclear Information System (INIS)

Vadejko, I.P.; Miroshnichenko, G.P.; Rybin, A.V.; Timonen, J.

2003-01-01

We study cooperative behaviour of the system of two-level atoms coupled to a single mode of the electromagnetic field in the resonator. We have developed a general procedure allowing one to rewrite a polynomial deformed SU(2) algebra in terms of another polynomial deformation. Using these methods, we have constructed a perturbation series for the Tavis-Cummings Hamiltonian and diagonalized it in the third order. Based on the zero-order Hamiltonian we calculate the intensity of spontaneous emission of N two-level atoms inside a cavity, which are in thermal equilibrium with the reservoir. The atom-atom correlation determining superradiance in the system is analyzed

Jaynes-Cummings model and the deformed-oscillator algebra

International Nuclear Information System (INIS)

Crnugelj, J.; Martinis, M.; Mikuta-Martinis, V.

1994-01-01

We study the time evolution of the deformed Jaynes-Cummings model (DJCM). It is shown that the standard JCM and its recent non-linear generalizations involving the intensity-dependent coupling and/or the multiphoton coupling are only particular cases of the DJCM. The time evolution of the mean phonon number and the population inversion are evaluated. A special case of the q-deformed JCM is analyzed explicitly. The long time quasi-periodic revival effects of the q-deformed JCM are observed for q∼1 and an initially large mean photon number. For other values of the deformation parameter q we observe chaotic-like behaviour of the population inversion. Photons are assumed to be initially in the deformed coherent state. ((orig.))

Dynamics of single photon transport in a one-dimensional waveguide two-point coupled with a Jaynes-Cummings system

KAUST Repository

Wang, Yuwen

2016-09-22

We study the dynamics of an ultrafast single photon pulse in a one-dimensional waveguide two-point coupled with a Jaynes-Cummings system. We find that for any single photon input the transmissivity depends periodically on the separation between the two coupling points. For a pulse containing many plane wave components it is almost impossible to suppress transmission, especially when the width of the pulse is less than 20 times the period. In contrast to plane wave input, the waveform of the pulse can be modified by controlling the coupling between the waveguide and Jaynes-Cummings system. Tailoring of the waveform is important for single photon manipulation in quantum informatics. © The Author(s) 2016.

Grassmann phase space theory and the Jaynes–Cummings model

International Nuclear Information System (INIS)

Dalton, B.J.; Garraway, B.M.; Jeffers, J.; Barnett, S.M.

2013-01-01

The Jaynes–Cummings model of a two-level atom in a single mode cavity is of fundamental importance both in quantum optics and in quantum physics generally, involving the interaction of two simple quantum systems—one fermionic system (the TLA), the other bosonic (the cavity mode). Depending on the initial conditions a variety of interesting effects occur, ranging from ongoing oscillations of the atomic population difference at the Rabi frequency when the atom is excited and the cavity is in an n-photon Fock state, to collapses and revivals of these oscillations starting with the atom unexcited and the cavity mode in a coherent state. The observation of revivals for Rydberg atoms in a high-Q microwave cavity is key experimental evidence for quantisation of the EM field. Theoretical treatments of the Jaynes–Cummings model based on expanding the state vector in terms of products of atomic and n-photon states and deriving coupled equations for the amplitudes are a well-known and simple method for determining the effects. In quantum optics however, the behaviour of the bosonic quantum EM field is often treated using phase space methods, where the bosonic mode annihilation and creation operators are represented by c-number phase space variables, with the density operator represented by a distribution function of these variables. Fokker–Planck equations for the distribution function are obtained, and either used directly to determine quantities of experimental interest or used to develop c-number Langevin equations for stochastic versions of the phase space variables from which experimental quantities are obtained as stochastic averages. Phase space methods have also been developed to include atomic systems, with the atomic spin operators being represented by c-number phase space variables, and distribution functions involving these variables and those for any bosonic modes being shown to satisfy Fokker–Planck equations from which c-number Langevin equations are

Seminar Cum Meeting Report: Codata Task Group for Exchangeable Material Data Representation to Support Research and Education

Directory of Open Access Journals (Sweden)

T Ashino

2008-11-01

Full Text Available On March 4-5, 2008, the CODATA Task Group for Exchangeable Material Data Representation to Support Research and Education held a two day seminar cum meeting at the National Physical Laboratory (NPL, New Delhi, India, with NPL materials researchers and task group members representing material activities and databases from seven countries: European Union (The Czech Republic, France, and the Netherlands, India, Korea, Japan, and the United States. The NPL seminar included presentations about the researchers' work. The Task Group meeting included presentations about current data related activities of the members. Joint discussions between NPL researchers and CODATA task group members began an exchange of viewpoints among materials data producers, users, and databases developers. The seminar cum meeting included plans to continue and expand Task Group activities at the 2008 CODATA 21st Meeting in Kyiv, Ukraine.

Bridging the gap between the Jaynes–Cummings and Rabi models using an intermediate rotating wave approximation

International Nuclear Information System (INIS)

Wang, Yimin; Haw, Jing Yan

2015-01-01

Highlights: • The intermediate rotating wave approximation (IRWA) is introduced. • The co-rotating and counter-rotating terms in Rabi model are expressed separately. • IRWA is applied to the near resonance case and the large detuning case. • The continuity between the Jaynes–Cummings model and the Rabi model is established. - Abstract: We present a novel approach called the intermediate rotating wave approximation (IRWA), which employs a time-averaging method to encapsulate the dynamics of light-matter interaction from strong to ultrastrong coupling regime. In contrast to the ordinary rotating wave approximation, this method addresses the co-rotating and counter-rotating terms separately to trace their physical consequences individually, and thus establishes the continuity between the Jaynes–Cummings model and the quantum Rabi model. We investigate IRWA in near resonance and large detuning cases. Our IRWA not only agrees well with both models in their respective coupling strengths, but also offers a good explanation of their differences

A CATASTROPHIC-CUM-RESTORATIVE QUEUING SYSTEM WITH CORRELATED BATCH ARRIVALS AND VARIABLE CAPACITY

Directory of Open Access Journals (Sweden)

Rakesh Kumar

2008-07-01

Full Text Available In this paper, we study a catastrophic-cum-restorative queuing system with correlated batch arrivals and service in batches of variable sizes. We perform the transient analysis of the queuing model. We obtain the Laplace Transform of the probability generating function of system size. Finally, some particular cases of the model have been derived and discussed. Keywords: Queue length, Catastrophes, Correlated batch arrivals, Broadband services, Variable service capacity, and Restoration.

Entre Lilith y Eva: Björk canta E. E. Cummings

Directory of Open Access Journals (Sweden)

Jordi Mas López

2016-05-01

del poeta norteamericano en Sun In My Mouth y el resto de composiciones de Vespertine. Frente a la inequívoca exaltación del héroe solar de Cummings, Björk utiliza una mirada femenina que duda entre los referentes de Lilith, la mujer que encuentra su libertad fuera de la sociedad, y Eva, aquella cuya sumisión es socialmente productiva. El resultado es un discurso de gran valor artístico, pero sujeto, en lo ideológico, a las limitaciones que imponen los motivos de partida

A generalized Jaynes-Cummings model: The relativistic parametric amplifier and a single trapped ion

Energy Technology Data Exchange (ETDEWEB)

Ojeda-Guillén, D., E-mail: dojedag@ipn.mx [Escuela Superior de Cómputo, Instituto Politécnico Nacional, Av. Juan de Dios Bátiz esq. Av. Miguel Othón de Mendizábal, Col. Lindavista, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico); Mota, R. D. [Escuela Superior de Ingeniería Mecánica y Eléctrica, Unidad Culhuacán, Instituto Politécnico Nacional, Av. Santa Ana No. 1000, Col. San Francisco Culhuacán, Delegación Coyoacán, C.P. 04430 Ciudad de México (Mexico); Granados, V. D. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico)

2016-06-15

We introduce a generalization of the Jaynes-Cummings model and study some of its properties. We obtain the energy spectrum and eigenfunctions of this model by using the tilting transformation and the squeezed number states of the one-dimensional harmonic oscillator. As physical applications, we connect this new model to two important and novelty problems: the relativistic parametric amplifier and the quantum simulation of a single trapped ion.

Cavity losses for the dissipative Jaynes-Cummings Hamiltonian beyond rotating wave approximation

International Nuclear Information System (INIS)

Scala, M; Militello, B; Messina, A; Maniscalco, S; Piilo, J; Suominen, K-A

2007-01-01

A microscopic derivation of the master equation for the Jaynes-Cummings model with cavity losses is given, taking into account the terms in the dissipator which vary with frequencies of the order of the vacuum Rabi frequency. Our approach allows us to single out physical contexts wherein the usual phenomenological dissipator turns out to be fully justified and constitutes an extension of our previous analysis (Scala et al 2007 Phys. Rev. A 75 013811), where a microscopic derivation was given in the framework of the rotating wave approximation

Design, construction and experimental study of Electric Cum Solar Oven-II

International Nuclear Information System (INIS)

Nandwani, S.S.

1987-11-01

As in many developing countries, 35-40% of the population of Costa Rica still use firewood for domestic cooking. Considering the fact that Costa Rica is blessed with good sunshine, good hydroelectric potential, and a good electric network, a hybrid solar oven was thought to be useful. In the present paper the construction and working of a new type of Electric Cum Solar Oven (ECSO) has been described. This oven can be used for cooking and baking any type of meal at any time during the year employing solar and/or electric energy but consuming the minimum quantity of electric energy in case it is required. (author). 9 refs, 6 figs, 1 tab

Nonlinear Jaynes–Cummings model for two interacting two-level atoms

International Nuclear Information System (INIS)

Santos-Sánchez, O de los; González-Gutiérrez, C; Récamier, J

2016-01-01

In this work we examine a nonlinear version of the Jaynes–Cummings model for two identical two-level atoms allowing for Ising-like and dipole–dipole interplays between them. The model is said to be nonlinear in the sense that it can incorporate both a general intensity-dependent interaction between the atomic system and the cavity field and/or the presence of a nonlinear medium inside the cavity. As an example, we consider a particular type of atom-field coupling based upon the so-called Buck–Sukumar model and a lossless Kerr-like cavity. We describe the possible effects of such features on the evolution of some quantities of current interest, such as atomic excitation, purity, concurrence, the entropy of the field and the evolution of the latter in phase space. (paper)

E. E. Cummings: From Parenthesis to Personality (Part II

Directory of Open Access Journals (Sweden)

Uroš Mozetič

2007-06-01

Full Text Available The paper presents the unique oeuvre of E.E. Cummings; who claims an outstanding position in the heritage of American poetry; as a case of Bildungsdichtung. This status is largely due to his highly innovative and iconoclastic approach to poetic composition; starting from his early rebellious endeavours drawing on an astounding variety of non-standard and downright shocking potentialities of the English language (including such peculiar linguistic and stylistic idiosyncracies as drastic changes of the syntactic English word order; shifts at the morphology and word-formation level; unorthodox use of punctuation; extravagant typography and spacing or arrangement of space between the lines; a diversity of meters and rhymes; as well as seemingly eccentric imagery; to his later and invariably maturer poetic diction – the diction of one who has apparently come to terms with the world and his fellow-beings; realising that genuine wisdom resides in the understanding and forgiveness of the inherently fallible human nature rather than in its continuous sardonic scrutiny.

A quantum heat engine based on Tavis-Cummings model

Science.gov (United States)

Sun, Kai-Wei; Li, Ran; Zhang, Guo-Feng

2017-09-01

This paper will investigate a four-stroke quantum heat engine based on the Tavis-Cummings model. The cycle of the heat engine is similar to the Otto cycle in classical thermodynamics. The relationship between output power as well as cycle efficiency and external physical system parameters are given. Under this condition, the entanglement behavior of the system will be studied. The system can show considerable entanglement by strictly controlling relevant parameters. Unlike common two-level quantum heat engines, efficiency is a function of temperature, showing interesting and unexpected phenomena. Several ways to adjust engine properties by external parameters are proposed, with which the output power and efficiency can be optimized. The heat engine model exhibits high efficiency and output power with the participation of a small number of photons, and decay rapidly as the number of photons increases in entangled area but shows interesting behaviors in non-entangled area of photon numbers.

Entropy exchange and entanglement in the Jaynes-Cummings model

International Nuclear Information System (INIS)

Boukobza, E.; Tannor, D.J.

2005-01-01

The Jaynes-Cummings model (JCM) is the simplest fully quantum model that describes the interaction between light and matter. We extend a previous analysis by Phoenix and Knight [Ann. Phys. 186, 381 (1988)] of the JCM by considering mixed states of both the light and matter. We present examples of qualitatively different entropic correlations. In particular, we explore the regime of entropy exchange between light and matter, i.e., where the rate of change of the two are anticorrelated. This behavior contrasts with the case of pure light-matter states in which the rate of change of the two entropies are positively correlated and in fact identical. We give an analytical derivation of the anticorrelation phenomenon and discuss the regime of its validity. Finally, we show a strong correlation between the region of the Bloch sphere characterized by entropy exchange and that characterized by minimal entanglement as measured by the negative eigenvalues of the partially transposed density matrix

A simple LC-MS/MS method for quantitative analysis of underivatized neurotransmitters in rats urine: assay development, validation and application in the CUMS rat model.

Science.gov (United States)

Zhai, Xue-jia; Chen, Fen; Zhu, Chao-ran; Lu, Yong-ning

2015-11-01

Many amino acid neurotransmitters in urine are associated with chronic stress as well as major depressive disorders. To better understand depression, an analytical LC-MS/MS method for the simultaneous determination of 11 underivatized neurotransmitters (4-aminohippurate, 5-HIAA, glutamate, glutamine, hippurate, pimelate, proline, tryptophan, tyramine, tyrosine and valine) in a single analytical run was developed. The advantage of this method is the simple preparation in that there is no need to deconjugate the urine samples. The quantification range was 25-12,800 ng mL(-1) with >85.8% recovery for all analytes. The nocturnal urine concentrations of the 11 neurotransmitters in chronic unpredictable mild stress (CUMS) model rats and control group (n = 12) were analyzed. A series of significant changes in urinary excretion of neurotransmitters could be detected: the urinary glutamate, glutamine, hippurate and tyramine concentrations were significantly lower in the CUMS group. In addition, the urinary concentrations of tryptophan as well as tyrosine were significantly higher in chronically stressed rats. This method allows the assessment of the neurotransmitters associated with CUMS in rat urine in a single analytical run, making it suitable for implementation as a routine technique in depression research. Copyright © 2015 John Wiley & Sons, Ltd.

Entanglement dynamics of a double two-photon Jaynes–Cummings model with Kerr-like medium

International Nuclear Information System (INIS)

Xi-Cheng, Ouyang; Mao-Fa, Fang; Guo-Dong, Kang; Xiao-Juan, Deng; Li-Yuan, Huang

2010-01-01

In this paper, the entanglement dynamics of a double two-photon Jaynes–Cummings model with Kerr-like medium is investigated. It is shown that initial entanglement has an interesting subsequent time evolution, including the so-called entanglement sudden death effect. It is also shown analytically that the Kerr-like medium can repress entanglement sudden death and enhance the degree of atom-atom entanglement. A more interesting fact is that the Kerr effect is more obvious when each of the two cavities with have the Kerr-like medium than only one of them with the Kerr-like medium

Design and Development of Maize Dehusker cum Sheller: A Technology for Northern Transition Zone of Karnataka, India

Science.gov (United States)

Chilur, Rudragouda; Kumar, Sushilendra

2018-06-01

The Maize ( Zea mays L.) crop is one of the most important cereal in agricultural production systems of Northern Transition Zone (Hyderabad-Karnataka region) in India. These Hyderabad Karnataka farmers (small-medium) are lack of economic technologies with maize dehusking and shelling, which fulfils the two major needs as crops and as livestock in farming. The portable medium size (600 kg/h capacity) electric motor (2.23 kW) operated Maize Dehusker cum Sheller (MDS) was designed to resolve the issue by considering engineering properties of maize. The developed trapezium shaped MDS machine having overall dimensions (length × (top and bottom) × height) of 1200 × (500 and 610) × 810 mm. The selected operational parameters viz, cylinder peripheral speed (7.1 m/s), concave clearance (25 mm) and feed rate (600 kg/h) were studied for machine-performance and seed-quality parameters. The performance of machine under these parameters showed the dehusking efficiency of 99.56%, shelling efficiency of 98.01%, cleaning efficiency of 99.11%, total loss of 3.63% machine capacity of 527.11 kg/kW-h and germination percentage of 98.93%. Overall machine performance was found satisfactory for maize dehusking cum shelling operation as well as to produce the maize grains for seeding purpose.

Design and Development of Maize Dehusker cum Sheller: A Technology for Northern Transition Zone of Karnataka, India

Science.gov (United States)

Chilur, Rudragouda; Kumar, Sushilendra

2018-02-01

The Maize (Zea mays L.) crop is one of the most important cereal in agricultural production systems of Northern Transition Zone (Hyderabad-Karnataka region) in India. These Hyderabad Karnataka farmers (small-medium) are lack of economic technologies with maize dehusking and shelling, which fulfils the two major needs as crops and as livestock in farming. The portable medium size (600 kg/h capacity) electric motor (2.23 kW) operated Maize Dehusker cum Sheller (MDS) was designed to resolve the issue by considering engineering properties of maize. The developed trapezium shaped MDS machine having overall dimensions (length × (top and bottom) × height) of 1200 × (500 and 610) × 810 mm. The selected operational parameters viz, cylinder peripheral speed (7.1 m/s), concave clearance (25 mm) and feed rate (600 kg/h) were studied for machine-performance and seed-quality parameters. The performance of machine under these parameters showed the dehusking efficiency of 99.56%, shelling efficiency of 98.01%, cleaning efficiency of 99.11%, total loss of 3.63% machine capacity of 527.11 kg/kW-h and germination percentage of 98.93%. Overall machine performance was found satisfactory for maize dehusking cum shelling operation as well as to produce the maize grains for seeding purpose.

Design and fabrication of a Czerny-Turner monochromator-cum-spectrograph

International Nuclear Information System (INIS)

Murty, M.V.R.K.; Shukla, R.P.; Bhattacharya, S.S.; Krishnamurthy, G.

1987-01-01

The design and fabrication of a Czerny-Turner monochromator cum spectrograph is described. It consists of a classically ruled grating having 1200 grooves/mm. The collimator is a concave spherical mirror having a radius of curvature 1.025 metre while the focusing element is a concave spherical mirror of radius of curvature 0.925 metre. The design of two unequal radii of curvature for collimating and focusing mirrors is chosen to eliminate the chromatic aberration at the wavelength of 5000A. The linear reciprocal dispersion on the focal surface is about 8A/mm. The resolution of the instrument at the coma corrected wavelength i.e. 5000A is 0.1A. The resolution at the other wavelengths is limited by the residual chromatic aberration which increases linearly with wavelength on either side of the 5000A. Therefore the resolution at the wavelength 2000A and 8000A is about 0.2A. 7 figures. (author)

Effect of atomic spontaneous decay on entanglement in the generalized Jaynes-Cummings model

International Nuclear Information System (INIS)

Hessian, H.A.; Obada, A.-S.F.; Mohamed, A.-B.A.

2010-01-01

Some aspects of the irreversible dynamics of a generalized Jaynes-Cummings model are addressed. By working in the dressed-state representation, it is possible to split the dynamics of the entanglement and coherence. The exact solution of the master equation in the case of a high-Q cavity with atomic decay is found. Effects of the atomic spontaneous decay on the temporal evolution of partial entropies of the atom or the field and the total entropy as a quantitative measure entanglement are elucidated. The degree of entanglement, through the sum of the negative eigenvalues of the partially transposed density matrix and the negative mutual information has been studied and compared with other measures.

Influence of relaxation on emission and excitation of coherent states of electromagnetic field in the Jaynes-Cummings model

International Nuclear Information System (INIS)

Verlan, E.M.

2003-01-01

A two-level atom interacting with a field mode is considered. The field frequency is assumed to be equal to the atom transition frequency. The relaxation equations of the atom - field system are written in the basis of dressed states of the Jaynes - Cummings model taking into account quasi-resonant pumping. Their solutions are derived for a stationary regime. The average amplitude of a coherent electromagnetic field is found

Competitive-cum-cooperative interfirm relations and dynamics in the Japanese semiconductor industry

CERN Document Server

Okada, Yoshitaka

2000-01-01

Japanese semiconductor firms are well known for obtaining dynamics in a short period of time and achieving even global leadership. A significant portion of their success are attributable to cooperative interfirm relations and the development of intermediate organizational structure based on long-term relationship between firms. The purpose of this book is to explain how interfirm relations contributed to their dynamics during the golden age of the semiconductor industry. Meanwhile this book clarifies the real source of dynamics in interfirm relations and how the firms have interacted. The author concludes that the competitive-cum-cooperative (CCC) interfirm interaction are observed. Quantitative and qualitative findings show that firms enjoy not only flexible cooperation based synergy effects, but also dynamics market-like effects by creating competition among partners through CCC interaction.

[Correlation research of photosynthetic characteristics and medicinal materials production with 4 Uncariae Cum Uncis].

Science.gov (United States)

Luo, Min; Song, Zhi-Qin; Yang, Ping-Fei; Liu, Hai; Yang, Zai-Gang; Wu, Ming-Kai

2017-01-01

Using four Uncariae Cum Uncis materials including Uncaria sinensis (HGT), U. hirsutea (MGT), Jianhe U. rhynchophylla (JHGT) and U. rhynchophylla(GT) as the research objects, the correlations between medicinal materials' yield and photosynthetic ecophysiology-factors in the plant exuberant growth period were studied. Results showed that the Uncaria plants net photosynthetic rate (Pn) changed by unimodal curve. There was not "midday depression" phenomenon. There was a different relationship among the photosynthetic ecophysiology-factors and between photosynthetic ecophysiology-factors and medicinal materials' yield. Pn,Tl,Gs had a significant correlation with medicinal materials' yield（M）and were the most important factors of growth. Copyright© by the Chinese Pharmaceutical Association.

Vacuum Rabi Splitting and Dynamics of the Jaynes—Cummings Model for Arbitrary Coupling

International Nuclear Information System (INIS)

Zhang Yu-Yu; Chen Qing-Hu; Zhu Shi-Yao

2013-01-01

The effects of counter-rotating terms (CRTs) on Rabi splitting and the dynamic evolution of atomic population in the Jaynes—Cummings model are studied with a coherent-state approach. When the coupling strength increases, the Rabi splitting becomes of multi-Rabi frequencies for the initial state of an excited atom in a vacuum field, and the collapses and revivals gradually disappear, and then reappear with quite good periodicity. Without the rotating-wave approximation (RWA), the initial excited state contains many eigenstates rather than two eigenstates under the RWA, which results in the multi-peak emission spectrum. An analytical approximate solution for the strong coupling regime is obtained, which gives a new oscillation frequency and explains the recovery of collapses and revivals due to the equal energy spacing

Petrogenetic and geodynamic origin of the Neoarchean Doré Lake Complex, Abitibi subprovince, Superior Province, Canada

DEFF Research Database (Denmark)

Polat, Ali; Frei, Robert; Longstaffe, Fred J.

2018-01-01

Group, which is composed of two cycles of tholeiitic-to-calc-alkaline volcanic and volcaniclastic rocks, siliciclastic and chemical sedimentary rocks, and layered mafic-to-ultramafic sills. In this study, we report major and trace element results, and Nd, Sr, Pb and O isotope data for anorthosites......, leucogabbros, gabbros and mafic dykes from the Doré Lake Complex and spatially associated basalts and gabbros of the Obatogamau Formation to assess their petrogenetic origin and geodynamic setting. Field and petrographic observations indicate that the Doré Lake Complex and associated volcanic rocks underwent...... extensive metamorphic alteration under greenschist facies conditions, resulting in widespread epidotization (20–40%) and chloritization (10–40%) of many rock types. Plagioclase recrystallized mainly to anorthite and albite endmembers, erasing intermediate compositions. Metamorphic alteration also led...

76 FR 2115 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

Science.gov (United States)

2011-01-12

... American Indian Holdings, LLC. G Pride Rock Holding Company, Inc. G First Advantage Philippines, Inc. G... Fairfax Financial Holdings Limited. G AbitibiBowater Inc. G AbitibiBowater Inc. [[Page 2117

Dynamics of the Jaynes-Cummings and Rabi models: old wine in new bottles

Energy Technology Data Exchange (ETDEWEB)

Larson, Jonas [ICFO-Institut de Ciencies Fotoniques, E-08860 Castelldefels, Barcelona (Spain)

2007-08-15

By using a wavepacket approach, this paper reviews the Jaynes-Cummings model with and without the rotating wave approximation (RWA) in a non-standard way. This gives new insight, not only of the two models themselves, but of the RWA as well. Expressing the models by field quadrature operators, instead of the typically used boson ladder operators, wavepacket simulations are presented. Several known phenomena of these systems, such as collapse-revivals, Rabi oscillation, squeezing and entanglement, are reviewed and explained in this new picture, either in an adiabatic or diabatic frame. The harmonic shape of the potential curves that the wavepackets evolve on and the existence of a level crossing make these results interesting in a broader sense not only for models in quantum optics, but especially in atomic and molecular physics.

Entropy squeezing for a two-level atom in the Jaynes-Cummings model with an intensity-depend coupling

Institute of Scientific and Technical Information of China (English)

李春先; 方卯发

2003-01-01

We study the squeezing for a two-level atom in the Jaynes-Cummings model with intensity-dependent coupling using quantum information entropy, and examine the influences of the initial state of the system on the squeezed component number and direction of the information entropy squeezing. Our results show that, the squeezed component number depends on the atomic initial distribution angle, while the squeezed direction is determined by both the phases of the atom and the field for the information entropy squeezing. Quantum information entropy is shown to be a remarkable precision measure for atomic squeezing.

Actes des Journees de linguistique (Proceedings of the Linguistics Conference) (12th, Quebec City, Canada, March 26-27, 1998).

Science.gov (United States)

Boissonneault, Chantal, Ed.

Papers on language research include: "L'expression de l'opposition en Latin" ("The Expression of Opposition in Latin" (Claude Begin); "Le francais de l'Abitibi: characteristiques phonetiques et origine socio-geographique des locuteurs" ("The French of Abitibi: Phonetic Characteristics and Socio-Geographic Origin…

Sexual behaviour and HIV knowledge among Dermatology cum Genitourinary Clinic attendees, Johor Bahru, Malaysia.

Science.gov (United States)

Choon, S E; Sapiah, W; Ismail, Z; Balan, V

1997-12-01

A study was conducted in the Dermatology cum Genitourinary Clinic, Hospital Sultanah Aminah Johor Bahru to determine a local population's knowledge of HIV and their sexual behaviour in relation to it. A total of 231 men and 217 women were interviewed. The sexual culture seen is one of relatively late age of first sexual intercourse, low level of partner change and low level of condom use. Men reported a higher involvement in risk behaviour. Nearly all the respondents (95.8%) have heard of HIV/AIDS but had incorrect perceptions of its mode of transmission and its associations with risk groups. This study enable us to gain background information about our patients sexual behaviour and HIV knowledge. There is a need to continue HIV education to improve our public's HIV knowledge and the results of this study provides a baseline against which future educational interventions can be gauged.

Entanglement generation and entropy growth due to intrinsic decoherence in the Jaynes-Cummings model

International Nuclear Information System (INIS)

Obada, A.-S.F.; Hessian, Hosny A.

2004-01-01

We study how intrinsic decoherence leads to growing entropy and a strong degradation of the maximal generated entanglement in the multiquanta Jaynes-Cummings model. We find an exact solution of the Milburn equation in multiquanta precesses and calculate the partial entropy of the particle (atom or trapped ion) and field subsystem as well as total entropy. As the total entropy is not conserved, and it is shown to increase as time develops, one cannot use the partial field or atomic entropy as a direct measure of particle-field entanglement. For a good entropy measure, we also calculate the negativity of the eigenvalues of the partially transposed density matrix. We find that, at least qualitatively, the difference of the total entropy to the sum of field and atom partial entropies can be also used as an entanglement measure. Our results show that the degree of entanglement is very sensitive to any change in the intrinsic decoherence parameter

Effects of cavity-cavity interaction on the entanglement dynamics of a generalized double Jaynes-Cummings model

Science.gov (United States)

Pandit, Mahasweta; Das, Sreetama; Singha Roy, Sudipto; Shekhar Dhar, Himadri; Sen, Ujjwal

2018-02-01

We consider a generalized double Jaynes-Cummings model consisting of two isolated two-level atoms, each contained in a lossless cavity that interact with each other through a controlled photon-hopping mechanism. We analytically show that at low values of such a mediated cavity-cavity interaction, the temporal evolution of entanglement between the atoms, under the effects of cavity perturbation, exhibits the well-known phenomenon of entanglement sudden death (ESD). Interestingly, for moderately large interaction values, a complete preclusion of ESD is achieved, irrespective of its value in the initial atomic state. Our results provide a model to sustain entanglement between two atomic qubits, under the adverse effect of cavity induced perturbation, by introducing a non-intrusive inter-cavity photon exchange that can be physically realized through cavity-QED setups in contemporary experiments.

Isolation and identification of flavonoids, including flavone rotamers, from the herbal drug 'Crataegi folium cum flore' (hawthorn).

Science.gov (United States)

Rayyan, S; Fossen, T; Solheim Nateland, H; Andersen, O M

2005-01-01

Twelve flavonoids, including seven flavones, four flavonols and one flavanone, were isolated from methanolic extract of the herbal drug 'Crataegi folium cum flore' (hawthorn leaves and flowers) by a combination of CC (over Amberlite XAD-7 and Sephadex LH-20) and preparative HPLC. Their structures, including that of the novel flavonol 8-methoxykaempferol 3-O-(6"-malonyl-beta-glucopyranoside), were elucidated by homo- and heteronuclear NMR and electrospray/MS. The 1H- and 13C-NMR of all compounds, including rotameric pairs of five flavone C-glycosides, were assigned. The presence and relative proportion of each rotamer was shown by various NMR experiments, including two-dimensional nuclear Overhauser and exchange spectroscopy, to depend on solvent, linkage position and structure of the C-glycosyl substituent.

Properties of Linear Entropy in k-Photon Jaynes-Cummings Model with Stark Shift and Kerr-Like Medium

International Nuclear Information System (INIS)

Liao Qinghong; Wang Yueyuan; Liu Shutian; Ahmad, Muhammad Ashfaq

2010-01-01

The time evolution of the linear entropy of an atom in k-photon Jaynes-Cummings model is investigated taking into consideration Stark shift and Kerr-like medium. The effect of both the Stark shift and Kerr-like medium on the linear entropy is analyzed using a numerical technique for the field initially in coherent state and in even coherent state. The results show that the presence of the Kerr-like medium and Stark shift has an important effect on the properties of the entropy and entanglement. It is also shown that the setting of the initial state plays a significant role in the evolution of the linear entropy and entanglement. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

Proceedings of the workshop cum symposium on applications of neural networks in nuclear science and industry

International Nuclear Information System (INIS)

1993-01-01

The Workshop cum Symposium on Application of Neural Networks in Nuclear Science and Industry was held at Bombay during November 24-26. 1993. The past decade has seen many important advances in the design and technology of artificial neural networks in research and industry. Neural networks is an interdisciplinary field covering a broad spectrum of applications in surveillance, diagnosis of nuclear power plants, nuclear spectroscopy, speech and written text recognition, robotic control, signal processing etc. The objective of the symposium was to promote awareness of advances in neural network research and applications. It was also aimed at conducting the review of the present status and giving direction for future technological developments. Contributed papers have been organized into the following groups: a) neural network architectures, learning algorithms and modelling, b) computer vision and image processing, c) signal processing, d) neural networks and fuzzy systems, e) nuclear applications and f) neural networks and allied applications. Papers relevant to INIS are indexed separately. (M.K.V.)

A novel magnetic suspension cum linear actuator system for satellite cryo coolers

International Nuclear Information System (INIS)

Sivadasan, K.K.

1994-01-01

Stirling cycle cryogenic coolers have been widely used for device cooling in satellites. Various types of magnetic bearings and linear actuators find application in such systems. The most widely used configurations have two-axis-radially-active suspension stations placed at either ends of a reciprocating shaft in the compression and expansion sections. Separate or integral liner motors are provided in each section for axial shaft movement. It may be noted that such configurations are rather complicated and less reliable because of the presence of numerous electro-mechanical components, sensors and electronic servo channels. In this paper, a simple and reliable scheme is suggested which axially stabilizes and linearly perturbs the piston so that the need for a separate motor for axial actuation can be totally dispensed with. The piston is radially supported by passive repulsive bearings. In the axial direction, a servo actuator ''balances'' the piston and also actuates it bi-directionally. Implemented of this ''bearing cum motor theme,'' reduces the number of electromechanical and electronic components required to operate the system and hence minimizes the chances of system failure. Apart from this, the system's power consumption is reduced and efficiency is improved as electrical heating losses caused by quiescent-operating currents are removed and electromagnetic losses on the moving parts are minimized. The necessary system parameters have been derived using finite element analysis techniques. Finally, the proposed design is validated by computer-aided system simulation

Infinite set of relevant operators for an exact solution of the time-dependent Jaynes-Cummings Hamiltonian

International Nuclear Information System (INIS)

Gruver, J.L.; Aliaga, J.; Cerdeira, H.A.; Proto, A.N.

1995-03-01

The dynamics and thermodynamics of a quantum time-dependent field coupled to a two-level system, well known as the Jaynes-Cummings Hamiltonian, is studied, using the maximum entropy principle. In the framework of this approach we found three different infinite sets of relevant operators that describe the dynamics of the system for any temporal dependence. These sets of relevant operators are connected by isomorphisms, which allow us to consider the case of mixed initial conditions. A consistent set of initial conditions is established using the maximum entropy principle density operator, obtaining restrictions to the physically feasible initial conditions of the system. The behaviour of the population inversion is shown for different time dependencies of the Hamiltonian and initial conditions. For the time-independent case, an explicit solution for the population inversion in terms of the relevant operators of one of the sets is given. It is also shown how the well-known formulas for the population inversion are recovered for the special cases where the initial conditions correspond to a pure, coherent, and thermal field. (author). 35 refs, 9 figs

中药钩藤不同药用部位异钩藤碱含量分析%Analysis of the contents of isorhynchophylline in different medicinal parts of Ramulus Uncariae Cum Uncis

Institute of Scientific and Technical Information of China (English)

王盟; 赵亚鑫

2015-01-01

目的：测定钩藤的不同药用部位中异钩藤碱的含量。方法应用高效液相色谱法(HPLC)测定8批不同产地钩藤的不同药用部位中异钩藤碱含量。采用Waters Symmetry C18色谱柱（250 mm×4.6 mm，5μm），流动相为甲醇-0.01 mol/L醋酸铵缓冲液（pH 8.0）（60∶40），柱温25℃，进样量20μl，流速1.0 ml/min，检测波长246 nm。结果8批不同产地钩藤药材中均能检测出异钩藤碱，但产地间差异较大；不同药用部位中异钩藤碱的含量：主杆＞带钩茎枝＞无钩茎枝＞无茎枝钩＞叶。结论钩藤不同药用部位大部分含异钩藤碱成分，为扩展钩藤植物的药用部位提供试验依据。%ObjectiveTo explore the content of isorhynchophylline in different medicinal parts of Ramulus Uncariae Cum Uncis.MethodsHPLC was adopted to determine 8 batches of different Ramulus Uncariae Cum Uncis of different origin and different medicinal parts. The Waters Symmetry C18 color(4.6 mm×250 mm, 5μm) was used with mobile phase of methanol -0.01 mol/L ammonium acetate buffer(pH 8.0)(60∶40), column temperature of 25℃ , 20μl sample volume, velocity of 1.0 ml/min, and detection wavelength of 246 nm. ResultsIsorhynchophylline can be detected in all 8 batchs of Ramulus Uncariae Cum Uncis in different regions, and different content were found among different origins. The content of isorhynchophylline in different parts of the same origin showed a decreasing sequence of the rhabd, stem with hook, stem without hook, and twig without hook and leaves.ConclusionMost of medicinal part of Ramulus Uncariae Cum Uncis contains isorhynchophylline, which provide a lab basis for exploring medicinal parts of this herbal medicine.

"Sentire cum Ecclesia" –Archbishop Oscar Romero in a crossfire of dissent

Directory of Open Access Journals (Sweden)

Andrzej Dobrzyński

2006-12-01

Full Text Available The article Sentire cum Ecclesia Archbishop Romero caught between the fires of division: presents a clear picture of the difficult situation the Archbishop was involved in while ministering the war torn politically explosive Archdiocese of San Salvador (1977-1998 and the importance of maintaining his relationship with Rome. He lived his life between two burning fires: the cold war and the revolution, right and left wing factions, the unity of the Church and Liberation theology, and at the same time bearing within the strain of the dichotomy between the tendency for the mystic and his prophetic gift. The Archbishop was committed to put into practice the teaching of Vatican II, the social doctrine of the Church, and to the documents written by the Latin American Bishops in the conferences of Medellin (1968 and Puebla (1979. Paying attention to the circumstances of the Archdiocese and to the needs of Salvadorian society as a whole, Romero searched for solutions, taking into account his conscience and the Magisterium of the Church, while living a deeply spiritual life. His Episcopal motto, “To be of one mind with the Church” signifies his dedication and compassion with the suffering poor and disenfranchised, and the Church as an institution. Proof of this stems from always referring his feelings back to Rome and his dedication to the poor and persecuted. Even though it is not easy to draw any conclusions or make any judgments regarding Oscar Romero’s mission of the Church in the midst of the countries crisis, the article underlines the Historical-Ecclesiastical perspective that allows the avoidance of myths that continue to exist, in both liberal and conservative Catholic surroundings.

Desigualdades de género en la medicación: un tortuoso recorrido por el Vademécum

Directory of Open Access Journals (Sweden)

Lourdes Pérez González

2010-12-01

Full Text Available Análisis de las diferencias de género en la medicalización —entendida como la apropiación de parcelas de la vida cotidiana por el ámbito médico/farmacéutico— y sus repercusiones en la vida y la salud de las mujeres. Este análisis utiliza como referencia fundamental el Vademécum, base de datos que nos ha permitido la búsqueda de los fármacos (centrándonos en los efectos adversos y las interacciones que se expiden sin receta y están destinados fundamentalmente, o únicamente, a las mujeres ―sanas Analysis of gender differences in medicalization - understood as the appropriation of daily life areas by the medical/pharmaceutical field - and their impact on women’s health and lives. This study relies on the Vademecum as the main reference, database that has allowed us the search of drugs (focusing on the adverse effects and the interactions that are given without a prescription and are basically, or only, addressed to ―healthy‖ women.

Quasiperiodicity in time evolution of the Bloch vector under the thermal Jaynes-Cummings model

Science.gov (United States)

Azuma, Hiroo; Ban, Masashi

2014-07-01

We study a quasiperiodic structure in the time evolution of the Bloch vector, whose dynamics is governed by the thermal Jaynes-Cummings model (JCM). Putting the two-level atom into a certain pure state and the cavity field into a mixed state in thermal equilibrium at initial time, we let the whole system evolve according to the JCM Hamiltonian. During this time evolution, motion of the Bloch vector seems to be in disorder. Because of the thermal photon distribution, both a norm and a direction of the Bloch vector change hard at random. In this paper, taking a different viewpoint compared with ones that we have been used to, we investigate quasiperiodicity of the Bloch vector’s trajectories. Introducing the concept of the quasiperiodic motion, we can explain the confused behaviour of the system as an intermediate state between periodic and chaotic motions. More specifically, we discuss the following two facts: (1) If we adjust the time interval Δt properly, figures consisting of plotted dots at the constant time interval acquire scale invariance under replacement of Δt by sΔt, where s(>1) is an arbitrary real but not transcendental number. (2) We can compute values of the time variable t, which let |Sz(t)| (the absolute value of the z-component of the Bloch vector) be very small, with the Diophantine approximation (a rational approximation of an irrational number).

Multi-atom Jaynes-Cummings model with nonlinear effects

International Nuclear Information System (INIS)

Aleixo, Armando Nazareno Faria; Balantekin, Akif Baha; Ribeiro, Marco Antonio Candido

2001-01-01

The standard Jaynes-Cummings (JC) model and its extensions, normally used in quantum optics, idealizes the interaction of matter with electromagnetic radiation by a simple Hamiltonian of a two-level atom coupled to a single bosonic mode. This Hamiltonian has a fundamental importance to the field of quantum optics and it is a central ingredient in the quantized description of any optical system involving the interaction between light and atoms. The JC Hamiltonian defines a molecule, a composite system formed from the coupling of a two-state system and a quantized harmonic oscillator. For this Hamiltonian, mostly the single-particle situation has been studied. This model can also be extended for the situation where one has N two-level systems, which interact only with the electromagnetic radiation. In this case the effects of the spatial distribution of the particles it is not taken into account and the spin angular momentum S-circumflex i of each particle contributes to form a total angular momentum J-circumflex of the system. When one considers the effects due to the spatial variation in the field intensity in a nonlinear medium it is necessary to further add a Kerr term to the standard JC Hamiltonian. This kind of nonlinear JC Hamiltonian is used in the study of micro masers. Another nonlinear variant of the JC model takes the coupling between matter and the radiation to depend on the intensity of the electromagnetic field. This model is interesting since this kind of interaction means that effectively the coupling is proportional to the amplitude of the field representing a very simple case of a nonlinear interaction corresponding to a more realistic physical situation. In this work we solve exactly the problem of the interaction of a N two-level atoms with an electromagnetic radiation when nonlinear effects due to the spatial variation in the field intensity in a nonlinear Kerr medium and the dependence on the intensity of the electromagnetic field on the matter

Extraction Optimization, Characterization, and Bioactivities of Polysaccharides from Pinelliae Rhizoma Praeparatum Cum Alumine Employing Ultrasound-Assisted Extraction.

Science.gov (United States)

Liu, Yu-Jie; Mo, Xue-Lin; Tang, Xiao-Zhang; Li, Jiang-Hua; Hu, Mei-Bian; Yan, Dan; Peng, Wei; Wu, Chun-Jie

2017-06-09

In this study, the ultrasound-assisted extraction of polysaccharides (PSA) from Pinelliae Rhizoma Praeparatum Cum Alumine (PRPCA) was optimized by response surface methodology (RSM). The structural characteristics of PSA were analyzed by UV-vis spectroscopy, infrared spectroscopy, scanning electron microscopy, high performance gel permeation chromatography and high performance liquid chromatography, respectively. In addition, antioxidant and antimicrobial activities of PSA were studied by different in vitro assays. Results indicated that the optimal extraction conditions were as follows: the ratio of water to raw of 30 mL/g, extraction time of 46.50 min, ultrasonic temperature of 72.00 °C, and ultrasonic power of 230 W. Under these conditions, the obtained PSA yield (13.21 ± 0.37%) was closely agreed with the predicted yield by the model. The average molecular weights of the PSA were estimated to be 5.34 × 10³ and 6.27 × 10⁵ Da. Monosaccharide composition analysis indicated that PSA consisted of mannose, galactose uronic acid, glucose, galactose, arabinose with a molar ratio of 1.83:0.55:75.75:1.94:0.45. Furthermore, PSA exhibited moderate antioxidant and antibacterial activities in vitro. Collectively, this study provides a promising strategy to obtain bioactive polysaccharides from processed products of herbal medicines.

Theoria cum Praxi? The (In- Compatibility of Demands in Science and Business World

Directory of Open Access Journals (Sweden)

Monika Kritzmöller

2004-05-01

Full Text Available The necessity for co-operation between (scientific theory and (management praxis is apparent more than ever. There are countless parallels in the goals and objectives of social and marketing research, for example, learning more about communities—respectively customers—and explaining their behavior. Extending social research services to businesses can create synergistic effects. On the one hand, the scientists can benefit financially in dimensions not feasible at universities and have a fruitful dialogue with business practitioners. On the other hand, the business management have access to the latest scientific results of high quality before these results are available to competitors as official publications. These opportunities and advantages can no longer permit a prejudice-based, mutual ideological rejection, which can still be found in both spheres. In the course of my "Habilitation" at the University of St. Gallen (Switzerland, I created a successful method for combining theory with practice. I developed a sociological theory of social structure, which can be put into practice in order to analyze and comprehend the behavior of target groups in marketing. I co-operated with selected furniture manufacturers and received advanced payments during the entire period of my research. In return, these manufacturers received my consulting services. I applied the research findings directly to their business demands after the end of my project. On the one hand, this procedure requires that a scientist is experienced in business affairs and has the ability and readiness for transferring scientific results into every-day practice. On the other hand, management needs to give up short-term thinking of "KISS" (keep it short and simple and care about understanding things instead of merely describing them. My co-operation in the project and the implementation of "theoria cum praxi" approach was a positive experience, which I will continue using in future

Report on the inquiry into sale price fluctuations of gasoline and diesel fuel in the regions of Abitibi-Temiscamingue, Saguenay-Lac Saint Jean and the Upper Mauricie, October 1998 to 31 December 1999

International Nuclear Information System (INIS)

Lambert, L.; Dumais, M. A.

2000-01-01

An inquiry was initiated by the President of the Quebec Energy Board (Regie de l'energie) on October 7, 1999 to review the reasons for the wide fluctuations in the retail sale prices of gasoline and diesel fuel in the regions of Abitibi-Temiscamingue, Saguenay/Lac-Saint-Jean and the Upper Mauricie, although the Board has no jurisdiction over the prices charged for petroleum products or anti-competitive practices. Consequently, the inquiry confined itself to an analysis of the information pertaining to the structure and forces driving the petroleum products market, and an examination of price mechanisms and consumer reactions in these regions. The inquiry reviewed the relevant legislation and regulation, the social, economic and energy situations in the affected regions, and the structure and functioning of the market for gasoline and diesel fuel. The inquiry came to the conclusion that the price fluctuations during the period under review reflected the wholesale prices recorded at Montreal and Quebec, which are determined by national and international market forces over which Quebec has no significant control. Furthermore, the inquiry concluded that although market forces are present and functioning in the regions, there are relatively few outlets affiliated with major oil companies, and a large number of independent retail outlets with relatively small volumes of annual sales. They essentially set their own prices at a level that reflect their cost of operation. Appendices contain the Inquiry's mandate, a list of those who testified before the Inquiry, a map showing the geographic profile of the regions surveyed and a list of figures and tables. 18 tabs., 31 figs

Revivals and entanglement from initially entangled mixed states of a damped Jaynes-Cummings model

International Nuclear Information System (INIS)

Rendell, R.W.; Rajagopal, A.K.

2003-01-01

An exact density matrix of a phase-damped Jaynes-Cummings model (JCM) with entangled Bell-like initial states formed from a model two-state atom and sets of adjacent photon number states of a single-mode radiation field is presented. The entanglement of the initial states and the subsequent time evolution is assured by finding a positive lower bound on the concurrence of local 2x2 projections of the full 2x∞ JCM density matrix. It is found that the time evolution of the lower bound of the concurrence systematically captures the corresponding collapse and revival features in atomic inversion, relative entropies of atomic and radiation, mutual entropy, and quantum deficit. The atom and radiation subsystems exhibit alternating sets of collapses and revivals in a complementary fashion due to the initially mixed states of the atom and radiation employed here. This is in contrast with the result obtained when the initial state of the dissipationless system is a factored pure state of the atom and radiation, where the atomic and radiation entropies are necessarily the same. The magnitudes of the entanglement lower bound and the atomic and radiation revivals become larger as both the magnitude and phase of the Bell-like initial state contribution increase. The time evolution of the entropy difference of the total system and that of the radiation subsystem exhibit negative regions called 'supercorrelated' states which do not appear in the atomic subsystem. Entangled initial states are found to enhance this supercorrelated feature. Finally, the effect of phase damping is to randomize both the subsystems for asymptotically long times. It may be feasible to experimentally investigate the results presented here using the Rabi oscillation methods of microwave and optical cavity quantum electrodynamics since pure photon number states have recently been produced and observed

In search of ancient biomarkers: Using femtosecond - Laser Desorption Post Ionization - Mass Spectrometry (fs-LDPI-MS) to map organic compounds within ca. 2.7 Ga samples from the Abitibi greenstone belt, Ontario, Canada

Science.gov (United States)

Pasterski, M. J.; Barry, G.; Hanley, L.; Kenig, F. P. H.

2016-12-01

One of the major challenges within the field of organic geochemistry is to determine whether an observed biomarker signature was emplaced during sedimentation (indigenous), after sedimentation via the post-depositional migration of fluids (non-indigenous), or during sampling, storage, or analysis (contaminant). Current geochemical techniques (e.g. gas chromatography-mass spectrometry, GC-MS and GCxGC-MS) can effectively determine the composition and structure of the organic constituents of a sample. However, because of the multiple preparatory steps necessary prior to GC-MS analysis (sample crushing, solvent extraction, organic fraction separation) it is impossible to precisely determine the spatial relationship between the host sample and the organic molecules within. We used an MS imaging method developed by Prof. Luke Hanley at the University of Illinois at Chicago, femtosecond-laser desorption post ionization-MS (fs-LDPI-MS), to map the organics within previously characterized ca.2.7 billion year old (Ga) metasediments from the Abitibi greenstone belt near Timmins, ON, Canada. We then compared the MS images to petrographic observations that displayed the distribution of mineral species with well constrained mineralization ages as well as fluid inclusions within the samples. Fluid inclusions are formed during mineralization and have the ability to remain intact over long timescales (up to billions of years), protecting the fluids inside from the introduction of non-indigenous and contaminant biomarkers. Although migrating post-depositional fluids can remineralize sediments, fluid inclusions associated with secondary additions are focused along grain boundaries and microfractures (secondary inclusions), thus, inclusions which are located within grain boundaries can be considered primary and the age of their formation can be determined relative to the host rock. Preliminary results indicate that previously observed biomarkers may be linked to a series of

What can we learn from the dynamics of entanglement and quantum discord in the Tavis-Cummings model?

Science.gov (United States)

Restrepo, Juliana; Rodriguez, Boris A.

We revisit the problem of the dynamics of quantum correlations in the exact Tavis-Cummings model. We show that many of the dynamical features of quantum discord attributed to dissipation are already present in the exact framework and are due to the well known non-linearities in the model and to the choice of initial conditions. Through a comprehensive analysis, supported by explicit analytical calculations, we find that the dynamics of entanglement and quantum discord are far from being trivial or intuitive. In this context, we find states that are indistinguishable from the point of view of entanglement and distinguishable from the point of view of quantum discord, states where the two quantifiers give opposite information and states where they give roughly the same information about correlations at a certain time. Depending on the initial conditions, this model exhibits a fascinating range of phenomena that can be used for experimental purposes such as: Robust states against change of manifold or dissipation, tunable entanglement states and states with a counterintuitive sudden birth as the number of photons increase. We furthermore propose an experiment called quantum discord gates where discord is zero or non-zero depending on the number of photons. This work was supported by the Vicerrectoria de Investigacion of the Universidad Antonio Narino, Colombia under Project Number 20141031 and by the Departamento Administrativo de Ciencia, Tecnologia e Innovacion (COLCIENCIAS) of Colombia under Grant Number.

Water Management and Water Governance in a Changing Climate. Experiences and insights on climate change adaptation in Europe, Africa, Asia and Australia

NARCIS (Netherlands)

Huntjens, P.

2011-01-01

This book is based on his PhD research (magna cum laude, 2010) in Complex System Sciences from the University of Osnabrück, Germany. Modern societies are confronted with persistent problems of great complexity and unpredictability. These problems lead to critical situations, such as water and

Using computational fluid dynamics to address fish passage concerns at the Grand Falls-Windsor hydroelectric development

International Nuclear Information System (INIS)

Woolgar, R.; Eddy, W.

2006-01-01

As a result of replacing the penstocks used to divert water to the generating station with a power canal, the study of out-migration survival of Atlantic salmon at Abitibi-Consolidated Company of Canada's (Abitibi) Grand Falls-Windsor Hydroelectric Development began in 1997. Using a behavioral louvre system, a fish bypass diversion system was implemented within the power canal. When the power canal first commenced operation in 1997 and after a new 30 MW Unit was installed in 2003, the efficiency of the system to divert the migrating smolt was low. In order to test improvements to the system, physical modeling was conducted at the University of Waterloo between 1997 and 2002. This led to increased efficiencies of fish passage before the new unit was installed. However, recent results of the physical modeling, including the new unit, did not detail the extent of changes required to the system to increase fish bypass efficiency. Abitibi then engaged SGE Acres Limited in the winter of 2004 to investigate alternatives for increasing the effectiveness of the Grand Falls Power Canal Fish Bypass Diversion System. Abitibi then re-engaged SGE Acres in July 2005 for follow-up work after the collection of physical data in the power canal by Environment Canada in June 2005. This paper presented documentation on the original analysis conducted in 2004 and 2005, and the follow-up work conducted in 2005 and 2006. Specifically, the paper discussed the development of a computational fluid dynamics model (FLOW-3D) to represent the existing condition of the power canal; simulations of the existing condition for various flows; review of model results to confirm if the model is representing overall canal hydraulics; simulation of various alternatives to increase fish bypass efficiency; and, selection of a preferred alternative. As part of the follow-up work, the paper presented a review of Environment Canada measurements and comparison with FLOW-3D model results, and additional

SU-G-TeP3-11: Radiobiological-Cum-Dosimetric Quality Assurance of Complex Radiotherapy Plans

Energy Technology Data Exchange (ETDEWEB)

Paudel, N; Narayanasamy, G; Zhang, X; Penagaricano, J; Morrill, S [University of Arkansas for Medical Sciences, Little Rock, AR (United States); Mavroidis, P [University North Carolina, Chapel Hill, NC (United States); Pyakuryal, A [National Cancer Institute, Rockville, MD (United States); Han, E [UT MD Anderson Cancer Center, Houston, TX (United States); Liang, X [University of Florida Health Proton Therapy Institute, Jacksonville, FL (United States); Kim, D [Kyung Hee University Hospital, Seol (Korea, Republic of)

2016-06-15

Purpose: Dosimetric gamma-analysis used for QA of complex radiotherapy plans tests the dosimetric equivalence of a delivered plan with the treatment planning system (TPS) optimized plan. It does not examine whether a dosimetric difference results in any radiobiological difference. This study introduces a method to test the radiobiological and dosimetric equivalence between a delivered and the TPS optimized plan. Methods: Six head and neck and seven lung cancer VMAT or IMRT plans optimized for patient treatment were calculated and delivered to an ArcCheck phantom. ArcCheck measured dose distributions were compared with the TPS calculated dose distributions using a 2-D gamma-analysis. Dose volume histograms (DVHs) for various patient structures were obtained by using measured data in 3DVH software and compared against the TPS calculated DVHs using 3-D gamma analysis. DVH data were used in the Poisson model to calculate tumor control probability (TCP) for the treatment targets and in the sigmoid dose response model to calculate normal tissue complication probability (NTCP) for the normal structures. Results: Two-D and three-D gamma passing rates among six H&N patient plans differed by 0 to 2.7% and among seven lung plans by 0.1 to 4.5%. Average ± SD TCPs based on measurement and TPS were 0.665±0.018 and 0.674±0.044 for H&N, and 0.791±0.027 and 0.733±0.031 for lung plans, respectively. Differences in NTCPs were usually negligible. The differences in dosimetric results, TCPs and NTCPs were insignificant. Conclusion: The 2-D and 3-D gamma-analysis based agreement between measured and planned dose distributions may indicate their dosimetric equivalence. Small and insignificant differences in TCPs and NTCPs based on measured and planned dose distributions indicate the radiobiological equivalence between the measured and optimized plans. However, patient plans showing larger differences between 2-D and 3-D gamma-analysis can help us make a more definite conclusion

Cummings, Merrill, and Borrelli’s Inquiry into Small Screen Use by Academic Library Users: Timing is Everything

Directory of Open Access Journals (Sweden)

Catharine Bomhold

2018-01-01

Full Text Available A Review of: Cummings, J., Merrill, A., & Borrelli, S. (2010. The use of handheld mobile devices: Their impact and implications for library services. Library Hi Tech, (281, 22-40. https://doi.org/10.1108/07378831011026670 Abstract Objective – The authors undertook this study to understand the relatively new phenomenon of handheld computing and the use of small-screen devices among academic library users. They sought to determine if users would be inclined to search the online library catalogue on their devices and, by extension, if there would be a growing demand for small-screen compatible library services. Design – Online and paper surveys were used with both closed and open questions. Respondents included students, faculty, and staff at Washington State University (WSU. Setting – Washington State University Library, Pullman, Washington, United States of America. Subjects – The survey was open to any user of the Washington State University (Pullman Library. The 206 respondents included 126 (61.2% undergraduates, 26 (12.6% graduate or professional students, 32 (15.3% WSU employees, and 15 (7.3% faculty members. Methods – A survey was distributed both online and on paper. The online version used Surveymonkey.com and participation was solicited through various social media. It was open for three months during the Spring semester, 2007. The paper version was distributed to all library users on two days in June 2007. Eighty-four online and 122 paper responses were received. Main Results – Most of the respondents (58.4% who owned a personal digital assistant (PDA or Web-enabled cell phone (WECP indicated that they would search the library catalogue on a small-screen device. Responses to the open question “How would you use the OPAC [online public access catalogue] if it was available on a PDA or WECP?” were mixed, both positive and negative. The positive responders noted the possible time savings associated with the availability of

21st Century Military Operations in a Complex Electromagnetic Environment

Science.gov (United States)

2015-07-01

Natalie Crawford RAND Corporation RDML Jon P. Cryer, USN (ret) Northrop Grumman Mr. Stephen Cummings Raytheon Dr. Eric Evans MIT Lincoln...Heyer U.S. Navy Ms. Leslie Litton U.S. Army Dr. Charles Perkins National Reconnaissance Office Mr. Marvin Potts U.S. Air Force Dr. Stephen ...Neil Fox Virginia Tech Applied Research Corporation Ms. Hannah Freeman Strategic Analysis, Inc. Mr. Marcus Hawkins Strategic Analysis, Inc. Dr

Properties influencing cracking and separation of palm nuts in a mechanical cracker cum separator

Directory of Open Access Journals (Sweden)

JOSHUA OLANREWAJU OLAOYE

2018-01-01

Full Text Available Experimental studies of some properties influencing cracking and separation of palm kernel from the shell was conducted in a palm kernel dual processing machine. A mechanical cracking cum separating machine was developed for the study. The cracking unit consists of feed hopper, impeller shaft, cracking drum and impeller blade. The nut falls by gravity through the hopper channel into the cracking drum where the cracking process takes place through the help of impeller blades that flip the palm nut against the walls of cylindrical cracking drum. The mass of cracked nut flows through the separating unit that separates the kernel from the shell. The separation is induced by high current of air mass generated by an axial fan. A dura palm variety was selected and a total sample of eighteen thousand (18000 palm nuts were obtained and divided into two groups (feed rates, A and B, of eight thousand and ten thousand palm nuts respectively. Sample groups A and B were further divided into five sub – groups of four hundred (400 and five hundred (500 palm kernel nuts. Each sub group (feed rate was replicated four times at different shaft speeds (600, 900, 1200, 1500 and 1800 rpm. Results showed that cracking efficiencies increased with respect to speed. Un-cracked nuts percentage ranged from 1.3 to 5.3% at 7.1% moisture content, and 1.6 to 4.5% for 400 and 500 feed rates, respectively. Cracking time for both feed rates decreased with shaft speed. Throughput capacity of 11.49 kg/h was observed to be the lowest at 600 rpm and moisture content of 7.1% for both 400 feed rates and the highest throughput capacity of 37.16 kg/h was recorded at 1800 rpm at moisture contents of 9.3% and 16.1%. The results of this study shows that moisture content, engine speed and feed rate are significant parameters that influence cracking of nuts and separation of palm kernel from the shell.

Development of a mixed seawater-hydrothermal fluid geochemical signature during alteration of volcanic rocks in the Archean (∼2.7 Ga) Abitibi Greenstone Belt, Canada

Science.gov (United States)

Brengman, Latisha A.; Fedo, Christopher M.

2018-04-01

We investigated a group of silicified volcanic rocks from the ∼2.72 Ga Hunter Mine Group (HMG), Abitibi Greenstone Belt, Canada, in order to document progressive compositional change associated with alteration in a subaqueous caldera system. Rocks of the HMG divide into three groups based on mineralogy and texture for petrographic and geochemical analyses. Volcanic features (phenocrysts, pseudomorphs after primary glass shards, lapilli, volcanic clasts) are preserved in all groups, despite changing mineralogy from primarily quartz, feldspar, chlorite (Groups 1 and 2), to quartz, hematite and carbonate (Groups 2 and 3). Compositionally, Group 1 rocks resemble volcanic rocks in the region, while Group 2 and 3 rocks show a change in mineralogy to iron, silica, and carbonate minerals, which is associated with depletion of many major and trace elements associated with volcanic rocks (Al2O3, Na2O, K2O, Zr). In addition, rare earth elements display a clear progression from volcanic signatures in Group 1 (PrSN/YbSN = 1.7-2.96, EuSN/EuSN∗ = 0.84-1.72, Y/Ho = 25.20-27.41, LaSN/LaSN∗ = 0.97-1.29, and Zr/Hf = 38.38-42.09) to transitional mixed volcanic, hydrothermal, and seawater signatures in Group 2 (PrSN/YbSN 1.33-2.89, EuSN/EuSN∗ 1.33-2.5, Y/Ho = 23.94-30, LaSN/LaSN∗ 0.93-1.34, and Zr/Hf = 40-70), to mixed hydrothermal and seawater signatures in Group 3 (PrSN/YbSN 0.62-2.88, EuSN/EuSN∗ 1.30-7.15, LaSN/LaSN∗ 1.02-1.86, Y/Ho = 25.56-55, and Zr/Hf = 35-50). We interpret that silicification of volcanic rocks (Group 1) produced transitional altered volcanic rocks (Group 2), and siliceous and jaspilitic rocks (Group 3), based on preservation of delicate volcanic features. Building on this explanation, we interpret that major, trace- and rare-earth element mobility occurred during the process of silicification, during which siliceous and jaspilitic rocks (Group 3) acquired aspects of the rare-earth element geochemical signatures of marine chemical precipitates. We

Integration of ¹H NMR and UPLC-Q-TOF/MS for a comprehensive urinary metabonomics study on a rat model of depression induced by chronic unpredictable mild stress.

Directory of Open Access Journals (Sweden)

Hong-Mei Jia

Full Text Available Depression is a type of complex psychiatric disorder with long-term, recurrent bouts, and its etiology remains largely unknown. Here, an integrated approach utilizing (1H NMR and UPLC-Q-TOF/MS together was firstly used for a comprehensive urinary metabonomics study on chronic unpredictable mild stress (CUMS treated rats. More than twenty-nine metabolic pathways were disturbed after CUMS treatment and thirty-six potential biomarkers were identified by using two complementary analytical technologies. Among the identified biomarkers, nineteen (10, 11, 16, 17, 21-25, and 27-36 were firstly reported as potential biomarkers of CUMS-induced depression. Obviously, this paper presented a comprehensive map of the metabolic pathways perturbed by CUMS and expanded on the multitude of potential biomarkers that have been previously reported in the CUMS model. Four metabolic pathways, including valine, leucine and isoleucine biosynthesis; phenylalanine, tyrosine and tryptophan biosynthesis; tryptophan metabolism; synthesis and degradation of ketone bodies had the deepest influence in the pathophysiologic process of depression. Fifteen potential biomarkers (1-2, 4-6, 15, 18, 20-23, 27, 32, 35-36 involved in the above four metabolic pathways might become the screening criteria in clinical diagnosis and predict the development of depression. Moreover, the results of Western blot analysis of aromatic L-amino acid decarboxylase (DDC and indoleamine 2, 3-dioxygenase (IDO in the hippocampus of CUMS-treated rats indicated that depletion of 5-HT and tryptophan, production of 5-MT and altered expression of DDC and IDO together played a key role in the initiation and progression of depression. In addition, none of the potential biomarkers were detected by NMR and LC-MS simultaneously which indicated the complementary of the two kinds of detection technologies. Therefore, the integration of (1H NMR and UPLC-Q-TOF/MS in metabonomics study provided an approach to identify

The Role of Musk in Relieving the Neurodegenerative Changes Induced After Exposure to Chronic Stress.

Science.gov (United States)

Abd El Wahab, Manal Galal; Ali, Soad Shaker; Ayuob, Nasra Naeim

2018-06-01

This study aimed to evaluate the effect induced by musk on Alzheimer's disease-such as neurodegenerative changes in mice exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice were divided into 4 groups (n = 10); control, CUMS, CUMS + fluoxetine, CUMS + musk. At the end of the experiment, behavior of the mice was assessed. Serum corticosterone level, hippocampal protein level of the glucocorticoid receptors, and brain-derived neurotropic factor were also assessed. Hippocampus was histopathologically examined. Musk improved depressive status induced after exposure to CUMS as evidenced by the forced swimming and open field tests and improved the short-term memory as evidenced by the elevated plus maze test. Musk reduced both corticosterone levels and the hippocampal neurodegenerative changes observed after exposure to CUMS. These improvements were comparable to those induced by fluoxetine. Musk alleviated the memory impairment and neurodegenerative changes induced after exposure to the chronic stress.

The Blood-Brain Barrier Permeability of Six Indole Alkaloids from Uncariae Ramulus Cum Uncis in the MDCK-pHaMDR Cell Monolayer Model

Directory of Open Access Journals (Sweden)

Yi-Nan Zhang

2017-11-01

Full Text Available Uncariae Ramulus Cum Uncis (URCU is a widely used traditional Chinese medicine, and is reported to have various central nervous system effects. Alkaloids have been demonstrated to be the predominant pharmacological active components of URCU. In order to evaluate the blood-brain barrier (BBB permeability and transport mechanism of six typical indole alkaloids from URCU, the MDCK-pHaMDR cell monolayer model was used as an in vitro surrogate model for BBB. The samples were analyzed by high-performance liquid chromatography, and the apparent permeability coefficients (Papp were calculated. Among the six alkaloids, isorhynchophylline (2, isocorynoxeine (4, hirsutine (5 and hirsuteine (6 showed high permeability, with Papp values at 10−5 cm/s level in bidirectional transport. For rhynchophylline (1 and corynoxeine (3, they showed moderate permeability, with Papp values from the apical (AP side to the basolateral (BL side at 10−6 cm/s level and efflux ratio (Papp BL→AP/Papp AP→BL above 2. The time- and concentration-dependency experiments indicated that the main mechanism for 2, 4, 5 and 6 through BBB was passive diffusion. The efflux mechanism involved in the transports of compounds 1 and 3 could be reduced significantly by verapamil, and molecular docking screening also showed that 1 and 3 had strong bindings to P-glycoprotein. This study provides useful information for predicting the BBB permeability for 1–6, as well as better understanding of their central nervous system pharmacological activities.

Demographic characteristics and prevalence of other sexually transmitted diseases in HIV-positive patients seen in the Dermatology cum Genitourinary Clinic, Hospital Sultanah Aminah, Johor Bahru.

Science.gov (United States)

Choon, S E; Mathew, M; Othman, B S

2000-06-01

The demographic characteristics, risk behaviourand prevalence of other sexually transmitted diseases (STDs) were determined in 132 HIV-infected individuals seen in a Dermatology cum Genitourinary Clinic, Hospital Sultanah Aminah Johor Bahru. Sixty-one (46.2%) were Malays, 37.9% Chinese, 10.6% Indians and 5.3% were of other ethnic groups. The male to female ratio was 4.5:1. Most of the patients (82.5%) were between 20 to 40 years-old. Seventy (53.0%) were single, 34.1% were married and 7.5% were divorcees. The majority of them (97.7%) were heterosexual. Fifty seven (53.3%) of our male patients patronised commercial workers. Eighty-one (61.8%) were not intravenous drug users (IVDU). Of the 50 IVDUs, 24 had multiple sexual exposures. Fifty-three (48.2%) of the 109 patients screened for STDs had one or more other STDs. Thirty-four patients (31.9%) reported one STD in the past and 3.6% reported two STDs in the past. Fifty-six patients (42.4%) had developed AIDS. Thirteen had passed away. The main mode of transmission of HIV infection in this population is through heterosexual intercourse and the prevalence of STDs is high. These findings indicate a need to advocate responsible sexual behaviour and to detect as well as treat STDs early to prevent the sexual transmission of HIV.

Relationship between Chlamydia – Mycoplasma – Ureaplasma genital detection and semen concentration and motility among Greek men.

Directory of Open Access Journals (Sweden)

Ageliki Gerovassili

2017-03-01

Full Text Available One hundred and seventy two men at the State of Thessaly, Greece, inquiring semen analysis were enrolled in the study in order to investigate the incidence of Chlamydia, Ureaplasma and Mycoplasma (C-U-M genera in respect to total sperm number (TSN, progressive motility (grades a and b and total motility (grades a, b and c. Putative relation of C-U-M acquirement with sexual behavior was also investigated. Incidence of C-U-M among non-oligozoospermic and oligozoospermic men was similar. Νο correlation of C-U-M carriage to either oligozoospermia or asthenozoospermia was found. The tested semen parameters were negatively correlated to the age of sexual intercourse initiation and positively correlated to the number of sex partners. Early age of sexual intercourse initiation or high number of sexual partners was not statistical significantly correlated to C-U-M acquirement. Overall, TSN and motility (either progressive or total were not influenced by the presence of C-U-M genera in a sample of Greek population undergoing semen evaluation. To distinguish the role of C-U-M in male infertility and clarify the so far controversial scarce literature, large control case studies are needed using nucleic acid amplification techniques to detect these pathogens.

[Open-field behavioral study in rat hyperlipidemia combined with chronic unpredictable mild stress model].

Science.gov (United States)

Hu, Hua; Zhang, Yingchun; Xu, Yeqing; Liu, Chunfeng; Wang, Liwei

2015-06-16

To investigate behavioral changes in a rat hyperlipidemia model induced by high lipid feed combined with depression by Chronic Unpredictable Mild Stress (CUMS). A total of 40 rats were randomly divided into control (CON), control feed for 9 weeks followed by CUMS for 4 weeks (CON + CUMS), high fat diet (HFD) and high lipid feed for 9 weeks followed by CUMS for 4 weeks (HFD + CUMS) (n = 10 each). Open-field test was individually measured at baseline, week 9 and week 13. (1) Serum lipids: total cholesterol [(2.67 ± 0.04) mmol/L, (2.68 ± 0.02) mmol/L] and low density lipoprotein [(1.08 ± 0.03) mmol/L, (1.06 ± 0.01) mmol/L] of HFD and HFD + CUMS were both significantly higher than those of CON and CON + CUMS [(1.78 ± 0.12) mmol/L, (0.79 ± 0.04) mmol/L; (1.76 ± 0.09) mmol/L, (0.76 ± 0.06) mmol/L, all P Open-field test: at week 13, compared to CON rats, CON + CUMS rats exhibited enhanced locomotor activity during the first minute, reduced activity in the center squares and rearing, and increased the number of grooming and defecation (all P < 0.05). In comparison to the CON rats, a decrease in total squares in 5 min, central squares and peripheral squares was observed in HFD rats at week 13 (all P < 0.05). However, compared with HFD, CON, CON + CUMS rats, when high lipid feed for 9 weeks combined with depression, significant decrease activities in total squares in 5 min, central squares and peripheral squares were observed in HFD + CUMS rats at week 13. Besides these, the number of rearing was reduced, however, locomotor activity during the first minute and the number of grooming and defecation was significantly increased (all P < 0.001). Under uncontrolled hyperlipidemia, severe depressive symptoms will present more early once exposure to a series of chronic stressors followed by significant autonomic nervous dysfunctional symptoms.

Predictive Value of Cumulative Blood Pressure for All-Cause Mortality and Cardiovascular Events

Science.gov (United States)

Wang, Yan Xiu; Song, Lu; Xing, Ai Jun; Gao, Ming; Zhao, Hai Yan; Li, Chun Hui; Zhao, Hua Ling; Chen, Shuo Hua; Lu, Cheng Zhi; Wu, Shou Ling

2017-02-01

The predictive value of cumulative blood pressure (BP) on all-cause mortality and cardiovascular and cerebrovascular events (CCE) has hardly been studied. In this prospective cohort study including 52,385 participants from the Kailuan Group who attended three medical examinations and without CCE, the impact of cumulative systolic BP (cumSBP) and cumulative diastolic BP (cumDBP) on all-cause mortality and CCEs was investigated. For the study population, the mean (standard deviation) age was 48.82 (11.77) years of which 40,141 (76.6%) were male. The follow-up for all-cause mortality and CCEs was 3.96 (0.48) and 2.98 (0.41) years, respectively. Multivariate Cox proportional hazards regression analysis showed that for every 10 mm Hg·year increase in cumSBP and 5 mm Hg·year increase in cumDBP, the hazard ratio for all-cause mortality were 1.013 (1.006, 1.021) and 1.012 (1.006, 1.018); for CCEs, 1.018 (1.010, 1.027) and 1.017 (1.010, 1.024); for stroke, 1.021 (1.011, 1.031) and 1.018 (1.010, 1.026); and for MI, 1.013 (0.996, 1.030) and 1.015 (1.000, 1.029). Using natural spline function analysis, cumSBP and cumDBP showed a J-curve relationship with CCEs; and a U-curve relationship with stroke (ischemic stroke and hemorrhagic stroke). Therefore, increases in cumSBP and cumDBP were predictive for all-cause mortality, CCEs, and stroke.

Enhanced Radiosensitization Effect of Curcumin Delivered by PVP-PCL Nanoparticle in Lung Cancer

Directory of Open Access Journals (Sweden)

Cuixia Wen

2017-01-01

Full Text Available Curcumin, the principal polyphenolic curcuminoid, has been reported in numerous studies for its antitumor effect in a series of cancers. It is also reported that curcumin possesses radiosensitization effect in some cancers. However, the poor solubility and unsatisfied bioavailability of curcumin significantly undermine its potential application. Here we prepared curcumin loaded nanoparticles by employing PVP-PCL as drug carrier. Characterization studies indicated the satisfied drug loading efficiency and a sustained in vitro release pattern. Quantification uptake study showed that the uptake efficiency of Cum-NPs by lung cancer cells was time- and dose-dependent. In vitro anticancer study demonstrated the superior cytotoxic effect of Cum-NPs with stronger apoptotic induction over free Cum. Most importantly, there is almost no report on the radiosensitization effect of curcumin loaded nanoparticles. Here, Cum-NPs led to more inhibition of the colony forming ability of A549 cells as compared to the equivalent concentration of free Cum as shown in clonogenic assay. Furthermore, Cum-NPs are much more effective in enhancing the tumor growth inhibitory effect of radiation therapy in a A549 xenograft model. Therefore, results from the current study seem to be the first report on the radiosensitization effect of Cum-NPs and paved the way for a curcumin nanodrug delivery system as a potential radiation adjuvant.

Changes in tau phosphorylation levels in the hippocampus and frontal cortex following chronic stress

Energy Technology Data Exchange (ETDEWEB)

Yang, C.; Guo, X. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wang, G.H. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wuhan University, Institute of Neuropsychiatry, Wuhan, China, Institute of Neuropsychiatry, Wuhan University, Wuhan (China); Wang, H.L.; Liu, Z.C.; Liu, H.; Zhu, Z.X.; Li, Y. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China)

2014-03-03

Studies have indicated that early-life or early-onset depression is associated with a 2- to 4-fold increased risk of developing Alzheimers disease (AD). In AD, aggregation of an abnormally phosphorylated form of the tau protein may be a key pathological event. Tau is known to play a major role in promoting microtubule assembly and stabilization, and in maintaining the normal morphology of neurons. Several studies have reported that stress may induce tau phosphorylation. The main aim of the present study was to investigate possible alterations in the tau protein in the hippocampus and frontal cortex of 32 male Sprague-Dawley rats exposed to chronic unpredictable mild stress (CUMS) and then re-exposed to CUMS to mimic depression and the recurrence of depression, respectively, in humans. We evaluated the effects of CUMS, fluoxetine, and CUMS re-exposure on tau and phospho-tau. Our results showed that a single exposure to CUMS caused a significant reduction in sucrose preference, indicating a state of anhedonia. The change in behavior was accompanied by specific alterations in phospho-tau protein levels, but fluoxetine treatment reversed the CUMS-induced impairments. Moreover, changes in sucrose preference and phospho-tau were more pronounced in rats re-exposed to CUMS than in those subjected to a single exposure. Our results suggest that changes in tau phosphorylation may contribute to the link between depression and AD.

Changes in tau phosphorylation levels in the hippocampus and frontal cortex following chronic stress

International Nuclear Information System (INIS)

Yang, C.; Guo, X.; Wang, G.H.; Wang, H.L.; Liu, Z.C.; Liu, H.; Zhu, Z.X.; Li, Y.

2014-01-01

Studies have indicated that early-life or early-onset depression is associated with a 2- to 4-fold increased risk of developing Alzheimers disease (AD). In AD, aggregation of an abnormally phosphorylated form of the tau protein may be a key pathological event. Tau is known to play a major role in promoting microtubule assembly and stabilization, and in maintaining the normal morphology of neurons. Several studies have reported that stress may induce tau phosphorylation. The main aim of the present study was to investigate possible alterations in the tau protein in the hippocampus and frontal cortex of 32 male Sprague-Dawley rats exposed to chronic unpredictable mild stress (CUMS) and then re-exposed to CUMS to mimic depression and the recurrence of depression, respectively, in humans. We evaluated the effects of CUMS, fluoxetine, and CUMS re-exposure on tau and phospho-tau. Our results showed that a single exposure to CUMS caused a significant reduction in sucrose preference, indicating a state of anhedonia. The change in behavior was accompanied by specific alterations in phospho-tau protein levels, but fluoxetine treatment reversed the CUMS-induced impairments. Moreover, changes in sucrose preference and phospho-tau were more pronounced in rats re-exposed to CUMS than in those subjected to a single exposure. Our results suggest that changes in tau phosphorylation may contribute to the link between depression and AD

Antidepressant-Like Effect of Lipid Extract of Channa striatus in Chronic Unpredictable Mild Stress Model of Depression in Rats

Directory of Open Access Journals (Sweden)

Mohamed Saleem Abdul Shukkoor

2016-01-01

Full Text Available This study evaluated the antidepressant-like effect of lipid extract of C. striatus in chronic unpredictable mild stress (CUMS model of depression in male rats and its mechanism of action. The animals were subjected to CUMS for six weeks by using variety of stressors. At the end of CUMS protocol, animals were subjected to forced swimming test (FST and open field test followed by biochemical assay. The CUMS protocol produced depressive-like behavior in rats by decreasing the body weight, decreasing the sucrose preference, and increasing the duration of immobility in FST. The CUMS protocol increased plasma corticosterone and decreased hippocampal and prefrontal cortex levels of monoamines (serotonin, noradrenaline, and dopamine and brain-derived neurotrophic factor. Further, the CUMS protocol increased interleukin-6 (in hippocampus and prefrontal cortex and nuclear factor-kappa B (in prefrontal cortex but not in hippocampus. The lipid extract of C. striatus (125, 250, and 500 mg/kg significantly (p<0.05 reversed all the above parameters in rats subjected to CUMS, thus exhibiting antidepressant-like effect. The mechanism was found to be mediated through decrease in plasma corticosterone, increase in serotonin levels in prefrontal cortex, increase in dopamine and noradrenaline levels in hippocampus and prefrontal cortex, increase in BDNF in hippocampus and prefrontal cortex, and decrease in IL-6 and NF-κB in prefrontal cortex.

Socio-Environmental Resilience and Complex Urban Systems Modeling

Science.gov (United States)

Deal, Brian; Petri, Aaron; Pan, Haozhi; Goldenberg, Romain; Kalantari, Zahra; Cvetkovic, Vladimir

2017-04-01

The increasing pressure of climate change has inspired two normative agendas; socio-technical transitions and socio-ecological resilience, both sharing a complex-systems epistemology (Gillard et al. 2016). Socio-technical solutions include a continuous, massive data gathering exercise now underway in urban places under the guise of developing a 'smart'(er) city. This has led to the creation of data-rich environments where large data sets have become central to monitoring and forming a response to anomalies. Some have argued that these kinds of data sets can help in planning for resilient cities (Norberg and Cumming 2008; Batty 2013). In this paper, we focus on a more nuanced, ecologically based, socio-environmental perspective of resilience planning that is often given less consideration. Here, we broadly discuss (and model) the tightly linked, mutually influenced, social and biophysical subsystems that are critical for understanding urban resilience. We argue for the need to incorporate these sub system linkages into the resilience planning lexicon through the integration of systems models and planning support systems. We make our case by first providing a context for urban resilience from a socio-ecological and planning perspective. We highlight the data needs for this type of resilient planning and compare it to currently collected data streams in various smart city efforts. This helps to define an approach for operationalizing socio-environmental resilience planning using robust systems models and planning support systems. For this, we draw from our experiences in coupling a spatio-temporal land use model (the Landuse Evolution and impact Assessment Model (LEAM)) with water quality and quantity models in Stockholm Sweden. We describe the coupling of these systems models using a robust Planning Support System (PSS) structural framework. We use the coupled model simulations and PSS to analyze the connection between urban land use transformation (social) and water

Neomercazole protection against radiation-induced changes in bioamines and testicular metabolism of rats during starvation stress

International Nuclear Information System (INIS)

Hasan, S.S.; Kushwaha, A.K.S.

1987-01-01

Effect of X rays was studied on normally fed and starved rats vis-a-vis neomercazole, a sulfur containing carbimazone as a chemical radioprotector. Levels of 5-hydroxyindoleacetic acid and vinylmandelic acid which were found rising following exposure to X-rays, were significantly curtailed by the treatment with radioprotector in the protected-cum-irradiated rats. Administration of neomercazole offered protection to the testes against radiation injury by increasing alkaline phophatase and cholesterol contents in the testes of drug-treated-cum-irradiated animals. Pretreatment of neomercazole reduced the rate of mortality in the starvation-cum-irradiated animals as compared to the nontreated starvation-cum-irradiated animals. (author)

Ethanol extract of Rehmannia glutinosa exerts antidepressant-like effects on a rat chronic unpredictable mild stress model by involving monoamines and BDNF.

Science.gov (United States)

Wang, Jun-Ming; Pei, Li-Xin; Zhang, Yue-Yue; Cheng, Yong-Xian; Niu, Chun-Ling; Cui, Ying; Feng, Wei-Sheng; Wang, Gui-Fang

2018-06-01

The dried roots of Rehmannia glutinosa Libosch. (Scrophulariaceae) are of both medicinal and nutritional importance. Our previous study has found that the 80% ethanol extract of R. glutinosa (RGEE) produced antidepressant-like activities in mouse behavioral despair depression models. However, its mechanisms are still unclear. The present study aimed to observe the antidepressant-like mechanisms of RGEE on a rat chronic unpredictable mild stress (CUMS) model by involving monoaminergic neurotransmitters and brain-derived neurotrophic factor (BDNF). CUMS-stressed rats were orally given RGEE daily (150, 300, and 600 mg/kg) or fluoxetine hydrochloride (FH) for 3 weeks after starting the CUMS procedure. Sucrose preference test was carried out to observe depression-like behavior, and serum and brain tissues were used for neurochemical and fluorescent quantitative reverse transcription PCR analysis. Results demonstrated that CUMS induced depression-like behavior, whereas RGEE and FH administration inhibited this symptom. Furthermore, CUMS caused excessively elevated levels of serum corticosterone (CORT), an index of hypothalamic-pituitary-adrenal (HPA) axis hyperactivity, in a manner attenuated by RGEE and FH administration. RGEE administration also further elevated monoamine neurotransmitters and BDNF levels, up-regulated the mRNA expression of BDNF and tropomyosin-related kinase B (TrkB) in hippocampus of rats suffering CUMS. Together, our findings suggest that RGEE can improve CUMS-evoked depression-like behavior, and indicate its mechanisms may partially be associated with restoring HPA axis dysfunctions, enhancing monoamineergic nervous systems, and up-regulating BDNF and TrkB expression.

Resveratrol exerts anti-inflammatory and neuroprotective effects to prevent memory deficits in rats exposed to chronic unpredictable mild stress.

Science.gov (United States)

Yazir, Yusufhan; Utkan, Tijen; Gacar, Nejat; Aricioglu, Feyza

2015-01-01

A number of studies have recently focused on the neuroprotective and anti-inflammatory effects of resveratrol. In prior studies, we described its beneficial effects on scopolamine-induced learning deficits in rats. The aim of this study was to investigate the effects of resveratrol on emotional and spatial cognitive functions, neurotropic factor expression, and plasma levels of proinflammatory cytokines in rats exposed to chronic unpredictable mild stress (CUMS), which is known to induce cognitive deficits. Resveratrol (5 or 20mg/kg) was administered intraperitoneally for 35 days. Rats in the CUMS group and in the 5mg/kg resveratrol+CUMS group performed poorly in tasks designed to assess emotional and spatial learning and memory. The 20mg/kg resveratrol+CUMS group showed improved performance compared to the CUMS group. In addition, the CUMS procedure induced lower expression of brain-derived neurotrophic factor and c-Fos in hippocampal CA1 and CA3 and in the amygdala of stressed rats. These effects were reversed by chronic administration of resveratrol (20mg/kg). In addition, plasma levels of tumor necrosis factor-alpha and interleukin-1 beta were increased by CUMS, but were restored to normal by resveratrol. These results indicate that resveratrol significantly attenuates the deficits in emotional learning and spatial memory seen in chronically stressed rats. These effects may be related to resveratrol-mediated changes in neurotrophin factor expression in hippocampus and in levels of proinflammatory cytokines in circulation. Copyright © 2014 Elsevier Inc. All rights reserved.

Antidepressant-like Effect of Bacopaside I in Mice Exposed to Chronic Unpredictable Mild Stress by Modulating the Hypothalamic-Pituitary-Adrenal Axis Function and Activating BDNF Signaling Pathway.

Science.gov (United States)

Zu, Xianpeng; Zhang, Mingjian; Li, Wencai; Xie, Haisheng; Lin, Zhang; Yang, Niao; Liu, Xinru; Zhang, Weidong

2017-11-01

Preliminary studies conducted in our laboratory have confirmed that Bacopaside I (BS-I), a saponin compound isolated from Bacopa monnieri, displayed antidepressant-like activity in the mouse behavioral despair model. The present investigation aimed to verify the antidepressant-like action of BS-I using a mouse model of behavioral deficits induced by chronic unpredictable mild stress (CUMS) and further probe its underlying mechanism of action. Mice were exposed to CUMS for a period of 5 consecutive weeks to induce depression-like behavior. Then, oral gavage administrations with vehicle (model group), fluoxetine (12 mg/kg, positive group) or BS-I (5, 15, 45 mg/kg, treated group) once daily were started during the last two weeks of CUMS procedure. The results showed that BS-I significantly ameliorated CUMS-induced depression-like behaviors in mice, as characterized by an elevated sucrose consumption in the sucrose preference test and reduced immobility time without affecting spontaneous locomotor activity in the forced swimming test, tail suspension test and open field test. It was also found that BS-I treatment reversed the increased level of plasma corticosterone and decreased mRNA and protein expressions of glucocorticoid receptor induced by CUMS exposure, indicating that hypothalamic-pituitary-adrenal (HPA) axis hyperactivity of CUMS-exposed mice was restored by BS-I treatment. Furthermore, chronic administration of BS-I elevated expression levels of brain-derived neurotrophic factor (BDNF) (mRNA and protein) and activated the phosphorylation of extracellular signal-regulated kinase and cAMP response element-binding protein in the hippocampus and prefrontal cortex in mice subjected to CUMS procedure. Taken together, these results indicated that BS-I exhibited an obvious antidepressant-like effect in mouse model of CUMS-induced depression that was mediated, at least in part, by modulating HPA hyperactivity and activating BDNF signaling pathway.

microRNA and mRNA profiles in ventral tegmental area relevant to stress-induced depression and resilience.

Science.gov (United States)

Sun, Xiaoyan; Song, Zhenhua; Si, Yawei; Wang, Jin-Hui

2018-06-01

Chronic stress with lack of reward presumably may impair brain reward circuit, leading to major depressive disorder (MDD). Most individuals experiencing chronic stress do not suffer from MDD, i.e., resilience, implying the presence of endogenous anti-depression in the brain. Molecular mechanisms underlying stress-induced depression versus resilience were investigated. Mice were treated by chronic unpredictable mild stress (CUMS) for four weeks. Their mood state was assessed by behavioral tasks, such as sucrose preference, Y-maze and forced swimming testes. To reveal comprehensive molecular profiles of major depression versus resilience, mRNA and microRNA profiles were analyzed by high-throughput sequencing in the ventral tegmental area (VTA) harvested from control, CUMS-susceptible and CUMS-resilience mice. In data analyses of control versus CUMS-susceptible mice as well as control versus CUMS-resilience mice, 1.5 fold ratio in reads per kilo-base per million reads was set as the threshold to judge the involvement of mRNAs and microRNAs in the CUMS, depression or resilience. The downregulation of synaptic vesicle cycle, neurotrophin, GABAergic synapse and morphine addiction as well as the upregulation of transmitter release, calcium signal and cAMP-dependent response element binding are associated to CUMS-susceptibility. The downregulation of tyrosine metabolism and protein process in endoplasmic reticulum as well as the upregulation of amino acid biosynthesis, neuroactive ligand-receptor interaction and dopaminergic synapse are associated to CUMS-resilience. Therefore, the impairment of neurons and GABA/dopaminergic synapses in the VTA is associated with major depression. The upregulation of these entities is associated with resilience. Consistent results obtained from analyzing mRNAs and microRNAs as well as using different approaches strengthen our finding and conclusion. Copyright © 2018. Published by Elsevier Inc.

Extension of the excitation functions of deuteron induced reactions on {sup nat}Sn up to 50 MeV

Energy Technology Data Exchange (ETDEWEB)

Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Laboratory, Vrije Universiteit Brussel, B1050 Brussels (Belgium); Tárkányi, F.; Ditrói, F.; Takács, S. [Institute of Nuclear Research of the Hungarian Academy of Sciences, H4026 Debrecen (Hungary)

2017-01-15

Using the stacked-foil activation technique, cross-sections of deuteron induced reactions on natural Sn targets were determined up to 50 MeV. Excitation functions are reported for the product nuclides {sup 116m}Sb, {sup 117}Sb, {sup 118m}Sb, {sup 120m}Sb {sup 122m+g}Sb, {sup 124m+g}Sb, {sup 110}Sn(cum), {sup 113m+g}Sn(cum), {sup 117m}Sn, {sup 110m}In(cum), {sup 110g}In, {sup 111m+g}In(cum), {sup 113m}In, {sup 114m}In {sup 115m}In. Comparison with earlier published data at lower energy is discussed. For all excitation functions a theoretical calculation using the TALYS 1.6 (on-line TENDL-2015 library) code is shown.

Some remarks on ‘superradiant’ phase transitions in light-matter systems

International Nuclear Information System (INIS)

Larson, Jonas; Irish, Elinor K

2017-01-01

In this paper we analyze properties of the phase transition that appears in a set of quantum optical models; Dicke, Tavis–Cummings, quantum Rabi, and finally the Jaynes–Cummings model. As the light-matter coupling is increased into the deep strong coupling regime, the ground state turns from vacuum to become a superradiant state characterized by both atomic and photonic excitations. It is pointed out that all four transitions are of the mean-field type, that quantum fluctuations are negligible, and hence these fluctuations cannot be responsible for the corresponding vacuum instability. In this respect, these are not quantum phase transitions. In the case of the Tavis–Cummings and Jaynes–Cummings models, the continuous symmetry of these models implies that quantum fluctuations are not only negligible, but strictly zero. However, all models possess a non-analyticity in the ground state in agreement with a continuous quantum phase transition. As such, it is a matter of taste whether the transitions should be termed quantum or not. In addition, we also consider the modifications of the transitions when photon losses are present. For the Dicke and Rabi models these non-equilibrium steady states remain critical, while the criticality for the open Tavis–Cummings and Jaynes–Cummings models is completely lost, i.e. in realistic settings one cannot expect a true critical behaviour for the two last models. (paper)

REPERE TEORETICE ŞI PRAXIOLOGICE ALE CONSILIERII ONTOLOGICE COMPLEXE A PERSOANEI ŞI FAMILIEI ÎN CONTEXTUL INTER-, PLURI- ŞI TRANSDISCIPLINARITĂŢII

Directory of Open Access Journals (Sweden)

Larisa CUZNEŢOV

2015-12-01

Full Text Available În articol este prezentat un studiu teoretico-aplicativ care iniţiază în Consilierea ontologică complexă a familiei/COCF. Este elucidată fundamentarea ştiinţifică a COCF şi a Modelului sintetic al consilierii ontologice complexe a familiei. Concomitent, studiul reflectă specificul şi caracteristicile COCF, inclusiv descrie componentele şi subcomponentele Modelului sintetic al consilierii ontologice complexe a familiei, după cum urmează: fundamentele epistemologice; perspectivele integrării teoretice; filosofia adoptată de consilier; cunoaşterea ştiinţifică cu cele patru subcomponente: ipotetizarea, cunoaşterea factuală, cunoaşterea nomologică, cunoaşterea tehnologică; procesul consilierii constituit din 20 de etape; factorii comuni privind rezultatele consilierii şi finalităţile COCF. În concluzie se menţionează că modelul expus în studiu şi procesul COCF au fost experimentate cu succes, timp de 11 ani, de către autor şi discipolii ei, ceea ce a permis formarea şi consolidarea unor comportamente şi schimbări conştiente de tip evolutiv şi prospectiv/ strategice.THEORETICAL AND PRAXIOLOGICAL BASES OF COMPLEX ONTHOLOGICAL COUNSELING OF INDIVIDUALS AND FAMILIES IN THE CONTEXT OF INTER-, PLURI- AND TRANSDISCIPLINARITYThis article contains a theoretical and applied study which initiates us into Complex ontological family counseling/ COFC. The author highlights the scientific substantiation of COFC and the Synthetic model of complex ontological family counseling. Simultaneously, study reflects characteristics and features of COCF, including components and subcomponents which describesSynthetic model of complex ontological family counseling, as follows: epistemological foundations; theoretical prospects of integration; philosophy adopted by advisor; scientific knowledge with four sub­components/ hypothesization, factual knowledge, nomological knowledge, technological knowledge, counseling process, consists of

BDNF and COX-2 participate in anti-depressive mechanisms of catalpol in rats undergoing chronic unpredictable mild stress.

Science.gov (United States)

Wang, Jun-Ming; Yang, Lian-He; Zhang, Yue-Yue; Niu, Chun-Ling; Cui, Ying; Feng, Wei-Sheng; Wang, Gui-Fang

2015-11-01

Catalpol, a major compound in Rehmannia glutinosa with both medicinal and nutritional values, has been previously confirmed to shorten the duration of immobility in mice exposed to tail suspension and forced swimming tests. This study attempted to examine the anti-depressive mechanisms of catalpol in rats undergoing chronic unpredictable mild stress (CUMS) by involving brain-derived neurotrophic factor (BDNF) and cyclooxygenase-2 (COX-2). CUMS-exposed rats were given catalpol daily (5, 10, and 20mg/kg, ig) or a reference drug, fluoxetine hydrochloride (FH, 10mg/kg, ig), at 5 weeks after starting the CUMS procedure. Sucrose preference test was performed to observe depression-like behavior, and serum and brain tissues were used for neurochemical and fluorescent quantitative reverse transcription PCR analysis. CUMS induced depression-like behavior, whereas catalpol and FH administration attenuated this symptom. Moreover, CUMS caused excessively elevated levels of serum corticosterone, an index of hypothalamic-pituitary-adrenal (HPA) axis hyperactivation, in a manner attenuated by catalpol and FH administration. Catalpol administration also further decreased BDNF activities, downregulated the mRNA expression of BDNF and tropomyosin-related kinase B (TrkB), and reversed the excessive elevation in the activities and mRNA expression levels of COX-2 and prostaglandin E2 (PGE2) in the hippocampus and frontal cortex of rats undergoing CUMS. Results indicate that catalpol can ameliorate CUMS-induced depression-like behavior, and suggest its mechanisms may partially be ascribed to restoring HPA axis dysfunctions, upregulating BDNF expression and its cognate receptor TrkB, and downregulating COX-2 expression, thereby reducing PGE2 levels in the brain. Copyright © 2015 Elsevier Inc. All rights reserved.

Weekly 24-hour continuous infusion interleukin-2 for metastatic melanoma and renal cell carcinoma: a phase I study.

Science.gov (United States)

Perez, E A; Scudder, S A; Meyers, F A; Tanaka, M S; Paradise, C; Gandara, D R

1991-02-01

Twenty-nine patients with biopsy-confirmed metastatic melanoma (17) or metastatic renal cell carcinoma (12) were treated with escalating doses or recombinant human interleukin-2 (IL-2) administered as weekly 24-h intravenous infusions. Patients received from 3 to 12 x 10(6) C.U./m2 (18-72 x 10(6) I.U./m2) weekly over a treatment period of 1 to 16 weeks, with a median of eight weekly cycles administered. Patients in all treatment groups experienced non-life-threatening systemic side effects consisting of fever, nausea, vomiting, fluid retention, and diarrhea. Grade III hypotension was seen in four of six patients (67%) at 12 x 10(6) C.U./m2, and represented the dose-limiting toxicity. Grade IV hypotension occurred in 1 of 14 patients at 6 x 10(6) C.U./m2; no other grade IV toxicities were observed. Grade III fever occurred in 3 of 11 patients (27%) treated at 3 x 10(6) C.U./m2, 3 of 14 patients (21%) at 6 x 10(6) C.U./m2, and 3 of 6 patients (50%) at 9 x 10(6) C.U./m2. An objective response was observed in 3 of 28 evaluable patients (10%): 1 complete response and 1 partial response in renal cell cancer, and 1 partial response in a melanoma patient. We conclude that for future studies, the recommended dose of IL-2 given as a weekly 24-h infusion is 9 x 10(6) C.U./m2 and that a low rate of objective tumor response can be obtained in patients with melanoma and renal cell carcinoma using this regimen.

Effects of α2A Adrenoceptors on Norepinephrine Secretion from the Locus Coeruleus during Chronic Stress-Induced Depression

Directory of Open Access Journals (Sweden)

Hong-ping Huang

2017-05-01

Full Text Available Chronic stressors can often lead to the development of psychological disorders, such as depression and anxiety. The locus coeruleus (LC is a stress sensitive brain region located in the pons, with noradrenergic neurons that project to the hypothalamus, especially the paraventricular nucleus (PVN of the hypothalamus. The purpose of this paper is to better understand how alpha 2A-adrenoceptors (α2A-ARs and LC-hypothalamus noradrenergic system participate in the pathophysiological mechanism of depression. In vivo norepinephrine (NE release in the PVN triggered by electrical stimulation in the LC was detected with carbon fiber electrodes in depression model of rats induced by chronic unpredictable mild stress (CUMS. Also, the extracellular level of NE in the PVN was measured by microdialysis in vivo without any stimulation in the LC. The alpha 2-adrenoceptor (α2-AR antagonist yohimbine and α2A-ARs antagonist BRL-44408 maleate were systemically administered to rats to determine the effects of α2A-ARs on NE release in the PVN. The peak value of elicited NE release signals in the PVN induced by electrical stimulation in the LC in the CUMS rats were lower than that in the control rats. The extracellular levels of NE in the PVN of the CUMS rats were significantly less than that of the control rats. Intraperitoneal injection of yohimbine or BRL-44408 maleate significantly potentiated NE release in the PVN of the CUMS rats. The CUMS significantly increased protein expression levels of α2A-AR in the hypothalamus, and BRL-44408 maleate significantly reversed the increase of α2A-AR protein expression levels in the CUMS rats. Our results suggest that the CUMS could significantly facilitate the effect of α2-adrenoceptor-mediated presynaptic inhibition and decrease the release of NE in the PVN from LC. Blockade of the inhibitory action of excessive α2A-adrenergic receptors in the CUMS rats could increase the level of NE in the PVN, which is effective in

Time-dependent nonlinear Jaynes-Cummings dynamics of a trapped ion

Science.gov (United States)

Krumm, F.; Vogel, W.

2018-04-01

In quantum interaction problems with explicitly time-dependent interaction Hamiltonians, the time ordering plays a crucial role for describing the quantum evolution of the system under consideration. In such complex scenarios, exact solutions of the dynamics are rarely available. Here we study the nonlinear vibronic dynamics of a trapped ion, driven in the resolved sideband regime with some small frequency mismatch. By describing the pump field in a quantized manner, we are able to derive exact solutions for the dynamics of the system. This eventually allows us to provide analytical solutions for various types of time-dependent quantities. In particular, we study in some detail the electronic and the motional quantum dynamics of the ion, as well as the time evolution of the nonclassicality of the motional quantum state.

Multicenter, prospective, randomized safety and efficacy study of a new atrial-based managed ventricular pacing mode (MVP) in dual chamber ICDs.

Science.gov (United States)

Sweeney, Michael O; Ellenbogen, Kenneth A; Casavant, David; Betzold, Robert; Sheldon, Todd; Tang, Feng; Mueller, Megan; Lingle, John

2005-08-01

Ventricular desynchronization caused by right ventricular pacing may impair ventricular function and increase risk of heart failure (CHF), atrial fibrillation (AF), and death. Conventional DDD/R mode often results in high cumulative percentage ventricular pacing (Cum%VP). We hypothesized that a new managed ventricular pacing mode (MVP) would safely provide AAI/R pacing with ventricular monitoring and DDD/R during AV block (AVB) and reduce Cum%VP compared to DDD/R. MVP RAMware was downloaded in 181 patients with Marquis DR ICDs. Patients were initially randomized to either MVP or DDD/R for 1 month, then crossed over to the opposite mode for 1 month. ICD diagnostics were analyzed for cumulative percentage atrial pacing (Cum%AP), Cum%VP, and duration of DDD/R pacing for spontaneous AVB. Baseline characteristics included age 66 +/- 12 years, EF 36 +/- 14%, and NYHA Class II-III 36%. Baseline PR interval was 190 +/- 53 msec and programmed AV intervals (DDD/R) were 216 +/- 50 (paced)/189 +/- 53 (sensed) msec. Mean Cum%VP was significantly lower in MVP versus DDD/R (4.1 +/- 16.3 vs 73.8 +/- 32.5, P MVP were 85.0 and 99.9, respectively. Mean Cum%AP was not different between MVP versus DDD/R (48.7 +/- 38.5 vs 47.3 +/- 38.4, P = 0.83). During MVP overall time spent in AAI/R was 89.6% (intrinsic conduction), DDD/R 6.7% (intermittent AVB), and DDI/R 3.7% (AF). No adverse events were attributed to MVP. MVP safely achieves functional atrial pacing by limiting ventricular pacing to periods of intermittent AVB and AF in ICD patients, significantly reducing Cum%VP compared to DDD/R. MVP is a universal pacing mode that adapts to AVB and AF, providing both atrial pacing and ventricular pacing support when needed.

Sex differences in the stress response in SD rats.

Science.gov (United States)

Lu, Jing; Wu, Xue-Yan; Zhu, Qiong-Bin; Li, Jia; Shi, Li-Gen; Wu, Juan-Li; Zhang, Qi-Jun; Huang, Man-Li; Bao, Ai-Min

2015-05-01

Sex differences play an important role in depression, the basis of which is an excessive stress response. We aimed at revealing the neurobiological sex differences in the same study in acute- and chronically-stressed rats. Female Sprague-Dawley (SD) rats were randomly divided into 6 groups: chronic unpredictable mild stress (CUMS), acute foot shock (FS) and controls, animals in all 3 groups were sacrificed in proestrus or diestrus. Male SD rats were randomly divided into 3 groups: CUMS, FS and controls. Comparisons were made of behavioral changes in CUMS and control rats, plasma levels of corticosterone (CORT), testosterone (T) and estradiol (E2), and of the hypothalamic mRNA-expression of stress-related molecules, i.e. estrogen receptor α and β, androgen receptor, aromatase, mineralocorticoid receptor, glucocorticoid receptor, corticotropin-releasing hormone, arginine vasopressin and oxytocin. CUMS resulted in disordered estrus cycles, more behavioral and hypothalamic stress-related molecules changes and a stronger CORT response in female rats compared with male rats. Female rats also showed decreased E2 and T levels after FS and CUMS, while male FS rats showed increased E2 and male CUMS rats showed decreased T levels. Stress affects the behavioral, endocrine and the molecular response of the stress systems in the hypothalamus of SD rats in a clear sexual dimorphic way, which has parallels in human data on stress and depression. Copyright © 2015 Elsevier B.V. All rights reserved.

Acoustic Neuroma Educational Video

Medline Plus

Full Text Available ... Cumming, GA 30041 770-205-8211 info@ANAUSA.org The world’s #1 acoustic neuroma resource Click to ... Cumming, GA 30041 770-205-8211 info@ANAUSA.org About ANA Mission, Vision & Values Leadership & Staff Annual ...

Selective Production of 2-Methylfuran by Gas-Phase Hydrogenation of Furfural on Copper Incorporated by Complexation in Mesoporous Silica Catalysts.

Science.gov (United States)

Jiménez-Gómez, Carmen Pilar; Cecilia, Juan A; Moreno-Tost, Ramón; Maireles-Torres, Pedro

2017-04-10

Copper species have been incorporated in mesoporous silica (MS) through complexation with the amine groups of dodecylamine, which was used as a structure-directing agent in the synthesis. A series of Cu/SiO 2 catalysts (xCu-MS) with copper loadings (x) from 2.5 to 20 wt % was synthesized and evaluated in the gas-phase hydrogenation of furfural (FUR). The most suitable catalytic performance in terms of 2-methylfuran yield was obtained with an intermediate copper content (10 wt %). This 10Cu-MS catalyst exhibits a 2-methylfuran yield higher than 95 mol % after 5 h time-on-stream (TOS) at a reaction temperature of 210 °C with a H 2 /FUR molar ratio of 11.5 and a weight hourly space velocity (WHSV) of 1.5 h -1 . After 14 h TOS, this catalyst still showed a yield of 80 mol %. In all cases, carbonaceous deposits on the external surface were the cause of the catalyst deactivation, although sintering of the copper particles was observed for higher copper loadings. This intermediate copper loading (10 wt %) offered a suitable balance between resistance to sintering and tendency to form carbonaceous deposits. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Alpha particle induced reactions on {sup nat}Cr up to 39 MeV: Experimental cross-sections, comparison with theoretical calculations and thick target yields for medically relevant {sup 52g}Fe production

Energy Technology Data Exchange (ETDEWEB)

Hermanne, A.; Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel, Brussel 1090 (Belgium); Tárkányi, F.; Takács, S. [Institute of Nuclear Research, Hungarian Academy of Science, 4026 Debrecen (Hungary)

2015-08-01

Thin {sup nat}Cr targets were obtained by electroplating, using 23.75 μm Cu foils as backings. In five stacked foil irradiations, followed by high resolution gamma spectroscopy, the cross sections for production of {sup 52g}Fe, {sup 49,51cum}Cr, {sup 52cum,54,56cum}Mn and {sup 48cum}V in Cr and {sup 61}Cu,{sup 68}Ga in Cu were measured up to 39 MeV incident α-particle energy. Reduced uncertainty is obtained by simultaneous remeasurement of the {sup nat}Cu(α,x){sup 67,66}Ga monitor reactions over the whole energy range. Comparisons with the scarce literature values and results from the TENDL-2013 on-line library, based on the theoretical code family TALYS-1.6, were made. A discussion of the production routes for {sup 52g}Fe with achievable yields and contamination rates was made.

Emodin opposes chronic unpredictable mild stress induced depressive-like behavior in mice by upregulating the levels of hippocampal glucocorticoid receptor and brain-derived neurotrophic factor.

Science.gov (United States)

Li, Meng; Fu, Qiang; Li, Ying; Li, Shanshan; Xue, Jinsong; Ma, Shiping

2014-10-01

Emodin, the major active component of Rhubarb, has shown neuroprotective activity. This study is attempted to investigate whether emodin possesses beneficial effects on chronic unpredictable mild stress (CUMS)-induced behavioral deficits (depression-like behaviors) and explore the possible mechanisms. ICR mice were subjected to chronic unpredictable mild stress for 42 consecutive days. Then, emodin and fluoxetine (positive control drug) were administered for 21 consecutive days at the last three weeks of CUMS procedure. The classical behavioral tests: open field test (OFT), sucrose preference test (SPT), tail suspension test (TST) and forced swimming test (FST) were applied to evaluate the antidepressant effects of emodin. Then plasma corticosterone concentration, hippocampal glucocorticoid receptor (GR) and brain-derived neurotrophic factor (BDNF) levels were tested to probe the mechanisms. Our results indicated that 6 weeks of CUMS exposure induced significant depression-like behavior, with high, plasma corticosterone concentration and low hippocampal GR and BDNF expression levels. Whereas, chronic emodin (20, 40 and 80 mg/kg) treatments reversed the behavioral deficiency induced by CUMS exposure. Treatment with emodin normalized the change of plasma corticosterone level, which demonstrated that emodin could partially restore CUMS-induced HPA axis impairments. Besides, hippocampal GR (mRNA and protein) and BDNF (mRNA) expressions were also up-regulated after emodin treatments. In conclusion, emodin remarkably improved depression-like behavior in CUMS mice and its antidepressant activity is mediated, at least in part, by the up-regulating GR and BDNF levels in hippocampus. Copyright © 2014 Elsevier B.V. All rights reserved.

Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice?

Science.gov (United States)

Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad

2017-10-01

Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.

Cosmic Complexity

Science.gov (United States)

Mather, John C.

2012-01-01

neutrons, liberating a little energy and creating complexity. Then, the expanding universe cooled some more, and neutrons and protons, no longer kept apart by immense temperatures, found themselves unstable and formed helium nuclei. Then, a little more cooling, and atomic nuclei and electrons were no longer kept apart, and the universe became transparent. Then a little more cooling, and the next instability began: gravitation pulled matter together across cosmic distances to form stars and galaxies. This instability is described as a "negative heat capadty" in which extracting energy from a gravitating system makes it hotter -- clearly the 2nd law of thermodynamics does not apply here! (This is the physicist's part of the answer to e e cummings' question: what is the wonder that's keeping the stars apart?) Then, the next instability is that hydrogen and helium nuclei can fuse together to release energy and make stars burn for billions of years. And then at the end of the fuel source, stars become unstable and explode and liberate the chemical elements back into space. And because of that, on planets like Earth, sustained energy flows support the development of additional instabilities and all kinds of complex patterns. Gravitational instability pulls the densest materials into the core of the Earth, leaving a thin skin of water and air, and makes the interior churn incessantly as heat flows outwards. And the heat from the sun, received mostly near the equator and flowing towards the poles, supports the complex atmospheric and oceanic circulations. And because or that, the physical Earth is full of natural chemical laboratories, concentrating elements here, mixing them there, raising and lowering temperatures, ceaselessly experimenting with uncountable events where new instabilities can arise. At least one of them was the new experiment called life. Now that we know that there are at least as many planets as there are stars, it is hard to imagine that nature's ceasess

Long-term treatment with peony glycosides reverses chronic unpredictable mild stress-induced depressive-like behavior via increasing expression of neurotrophins in rat brain.

Science.gov (United States)

Mao, Qing-Qiu; Xian, Yan-Fang; Ip, Siu-Po; Tsai, Sam-Hip; Che, Chun-Tao

2010-07-11

The root part of Paeonia lactiflora Pall., commonly known as peony, is a commonly used Chinese herb for the treatment of depression-like disorders. Previous studies in our laboratory have showed that total glycosides of peony (TGP) produced antidepressant-like action in various mouse models of behavioral despair. The present study aimed to investigate the mechanism(s) underlying the antidepressant-like action of TGP by measuring neurotrophins including brain-derived neurotrophic factor (BDNF) and nerve growth factor (NGF) in non-stressed and chronic unpredictable mild stress (CUMS)-treated rats. TGP (80 or 160 mg/kg/day) was administered by oral gavage to the animals for 5 weeks. The results showed that CUMS caused depression-like behavior in rats, as indicated by the significant decreases in sucrose consumption and locomotor activity (assessed by open-field test). In addition, it was found that BDNF contents in the hippocampus and frontal cortex were significantly decreased in CUMS-treated rats. CUMS treatment also significantly decreased the level of NGF in the frontal cortex of the animals. Daily intragastric administration of TGP (80 or 160 mg/kg/day) during the five weeks of CUMS significantly suppressed behavioral and biochemical changes induced by CUMS. Treating non-stressed animals with TGP (160 mg/kg) for 5 weeks also significantly increased BDNF contents in the hippocampus and frontal cortex, and NGF contents in the frontal cortex. The results suggest that the antidepressant-like action of TGP is mediated, at least in part, by increasing the expression of BDNF and NGF in selective brain tissues. Copyright 2010 Elsevier B.V. All rights reserved.

An Analytical Study on Evaluating the Performance of Developed ...

African Journals Online (AJOL)

cum-seed drill was 0.46 with CV of 1.8 % and that for conventional seed drill was 0.41 and 1.5 % respectively.The effective field capacity of the cultivator-cum seed drill was 0.537 ha/h with field efficiency of 82.8 % as compared to conventional ...

Ocimum basilicum improve chronic stress-induced neurodegenerative changes in mice hippocampus.

Science.gov (United States)

Ayuob, Nasra Naeim; El Wahab, Manal Galal Abd; Ali, Soad Shaker; Abdel-Tawab, Hanem Saad

2018-01-22

Alzheimer's disease (AD), one of the progressive neurodegenerative diseases might be associated with exposure to stress and altered living conditions. This study aimed to evaluate the effectiveness of Ocimum basilicum (OB) essential oils in improving the neurodegenerative-like changes induced in mice after exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice divided into four groups (n = 10); the control, CUMS, CUMS + Fluoxetine, CUMS + OB were used. Behavioral tests, serum corticosterone level, hippocampus protein level of the glucocorticoid receptors (GRs) and brain-dreived neurotropic factor (BDNF) were determined after exposure to CUMS. Hippocampus was histopathologically examined. Data were analyzed using statistical package for the social sciences (SPSS) and P value of less than 0.05 was considered significant. OB diminished the depression manifestation as well as impaired short term memory observed in the mice after exposure to the CUMS as evidenced by the forced swimming and elevated plus maze test. OB also up-regulated the serum corticosterone level, hippocampal protein level of the glucocorticoid receptor and the brain-derived neurotropic factor and reduced the neurodegenerative and atrophic changes induced in the hippocampus after exposure to CUMS. Essential oils of OB alleviated the memory impairment and hippocampal neurodegenerative changes induced by exposure to the chronic unpredictable stress indicating that it is the time to test its effectiveness on patients suffering from Alzheimer disease.

Institution's Title and Shibboleth: A Construct of Grammatical Relationship in Advertising Plates

Science.gov (United States)

Dalamu, Taofeek

2017-01-01

Institutions are known through the names-cum-titles shown on their signboards, internet websites, letterheads, etc. However, it seems that such cultures could not satisfy the yearning of most organizations. So, they further propagate their core values and traits by constructing short linguistic bursts-cum-contents that can expatiate on what the…

Xiaoyaosan Improves Depressive-Like Behaviors in Mice through Regulating Apelin-APJ System in Hypothalamus.

Science.gov (United States)

Yan, Zhiyi; Jiao, Haiyan; Ding, Xiufang; Ma, Qingyu; Li, Xiaojuan; Pan, Qiuxia; Wang, Tingye; Hou, Yajing; Jiang, Youming; Liu, Yueyun; Chen, Jiaxu

2018-05-03

Background: The apelin-APJ system has been considered to play a crucial role in HPA axis function, and how the traditional Chinese compound prescription Xiaoyaosan regulates the apelin-APJ system as a supplement to treat depressive disorders. Objective: To investigate the depression-like behaviors and expression of apelin and APJ in hypothalamus of chronic unpredictable mild stress (CUMS) mice and study whether these changes related to the regulation of Xiaoyaosan. Methods: 60 adult C57BL/6J mice were randomly divided into four groups, including control group, CUMS group, Xiaoyaosan treatment group and fluoxetine treatment group. Mice in the control group and CUMS group received 0.5 mL physiological saline once a day by intragastric administration. Mice in two treatment groups received Xiaoyaosan (0.25 g/kg/d) and fluoxetine (2.6 mg/kg/d), respectively. After 21 days of modeling with CUMS, the expression of apelin and APJ in hypothalamus were measured by real-time fluorescence quantitative PCR, western blot and immunohistochemical staining. The physical condition, body weight, food intake and behavior tests such as open field test, sucrose preference test and force swimming test were measured to evaluate depressive-like behaviors. Results: In this study, significant behavioral changes were found in CUMS-induced mice, meanwhile the expressions of apelin and APJ in the hypothalamus were changed after modeling. The body weight, food-intake and depressive-like behaviors in CUMS-induced mice could be improved by Xiaoyaosan treatment which is similar with the efficacy of fluoxetine, while the expressions of apelin and APJ in hypothalamus were modified by Xiaoyaosan. Conclusions: The data suggest that apelin-APJ system changes in the hypothalamus may be a target of depressive disorders, and the beneficial effects of Chinese compound prescription Xiaoyaosan on depressive-like behaviors may be mediated by the apelin-APJ system.

Human-Centered Command and Control of Future Autonomous Systems

Science.gov (United States)

2013-06-01

introduce challenges with situation awareness, automation reliance, and accountability (Bainbridge, 1983). If not carefully designed and integrated...into users’ tasks, automation’s costs can quickly outweigh its benefits. A tempting solution to compensate for inherent human cognitive limitations is... Drury & Scott, 2008; Nehme, Scott, Cummings, & Furusho, 2006; Scott & Cummings, 2006). However, there have not been detailed prescriptive task

High-Yield Preparation and Electrochemical Properties of Few-Layer MoS2 Nanosheets by Exfoliating Natural Molybdenite Powders Directly via a Coupled Ultrasonication-Milling Process

Science.gov (United States)

Dong, Huina; Chen, Deliang; Wang, Kai; Zhang, Rui

2016-09-01

Cost-effective and scalable preparation of two-dimensional (2D) molybdenum disulfide (MoS2) has been the bottleneck that limits their applications. This paper reports a novel coupled ultrasonication-milling (CUM) process to exfoliate natural molybdenite powders to achieve few-layer MoS2 (FL-MoS2) nanosheets in the solvent of N-methyl-2-pyrrolidone (NMP) with polyvinylpyrrolidone (PVP) molecules. The synergistic effect of ultrasonication and sand milling highly enhanced the exfoliation efficiency, and the precursor of natural molybdenite powders minimizes the synthetic cost of FL-MoS2 nanosheets. The exfoliation of natural molybdenite powders was conducted in a home-made CUM system, mainly consisting of an ultrasonic cell disruptor and a ceramic sand mill. The samples were characterized by X-ray diffraction, UV-vis spectra, Raman spectra, FT-IR, SEM, TEM, AFM, and N2 adsorption-desorption. The factors that influence the exfoliation in the CUM process, including the initial concentration of natural molybdenite powders ( C in, 15-55 g L-1), ultrasonic power ( P u, 200-350 W), rotation speed of sand mill ( ω s, 1500-2250 r.p.m), exfoliation time ( t ex, 0.5-6 h), and the molar ratio of PVP unit to MoS2 ( R pm, 0-1), were systematically investigated. Under the optimal CUM conditions (i.e., C in = 45 g L-1, P u = 280 W, ω s = 2250 r.p.m and R pm = 0.5), the yield at t ex = 6 h reaches 21.6 %, and the corresponding exfoliation rate is as high as 1.42 g L-1 h-1. The exfoliation efficiency of the CUM mode is much higher than that of either the ultrasonication (U) mode or the milling (M) mode. The synergistic mechanism and influencing rules of the CUM process in exfoliating natural molybdenite powders were elaborated. The as-obtained FL-MoS2 nanosheets have a high specific surface area of 924 m2 g-1 and show highly enhanced electrocatalytic performance in hydrogen evolution reaction and good electrochemical sensing property in detecting ascorbic acid. The CUM process

Leaf insects from Luzon, Philippines, with descriptions of four new species, the new genus Pseudomicrophyllium, and redescription of Phyllium (Phyllium) geryon Gray, 1843, (Phasmida: Phylliidae).

Science.gov (United States)

Cumming, Royce T; Leong, Jing V; Lohman, David J

2017-12-17

Examination of unidentified Phylliidae specimens revealed a number of undescribed species from the island of Luzon, Philippines. Morphological and molecular study of specimens from the obscure phasmid genus Microphyllium Zompro, 2001, revealed a new species, which we describe as Microphyllium haskelli Cumming sp. nov.. It is here described and differentiated from the two other species in the genus, both currently only known from adults of a single sex. Pseudomicrophyllium Cumming gen. nov. is described as a new genus within Phylliidae with the type species Pseudomicrophyllium faulkneri Cumming gen. et sp. nov. as the sole known species in the genus. As is unfortunately often the case in the leaf-mimicking family Phylliidae, this new genus and species is only known from a single specimen. In addition to the new genus, two new Phyllium (Phyllium) species from the siccifolium species-group are named and described as Ph. (Ph.) antonkozlovi Cumming sp. nov. and Ph. (Ph.) bourquei Cumming Le Tirant sp. nov.. In addition to the newly described species, Phyllium (Phyllium) geryon Gray, 1843 is redescribed from a nearly perfect specimen, completing some of the morphological knowledge gaps currently missing because of the severely damaged holotype specimen. A key to all known species of Phylliidae from Luzon is included. Holotype specimens for all four new species will be deposited in the National Museum of the Philippines type collection and paratype specimens will be deposited into the San Diego Natural History Museum collection or retained within the first author's collection.

Thy-1+ dendritic cells in murine epidermis are bone marrow-derived

International Nuclear Information System (INIS)

Breathnach, S.M.; Katz, S.I.

1984-01-01

Thy-1+, Ly-5+ dendritic cells have recently been described as a resident cell population in murine epidermis, but their ontogeny and function are unknown. The origin and turnover of epidermal Thy-1+ cells utilizing chimeric mice were investigated. Lethally x-irradiated AKR/J (Thy-1.1+) and AKR/Cum (Thy-1.2+) mice were reconstituted with allogeneic bone marrow cells with or without thymocytes from congenic AKR/Cum or AKR/J mice, respectively. The density of residual indigenous Thy-1.1+ cells in AKR/J chimeras and Thy-1.2+ cells in AKR/Cum chimeras was substantially reduced following x-irradiation, as determined by immunofluorescence staining of epidermal sheets. Epidermal repopulation by allogeneic Thy-1+ dendritic epidermal cells was first observed at 5 weeks in AKR/J chimeras and at 7 weeks in AKR/Cum chimeras and progressed slowly. Repopulation was not enhanced by increasing the number of allogeneic bone marrow cells injected from 2 X 10(7) to 10(8) cells or by the addition of 8 X 10(7) allogeneic thymocytes to the donor inoculate. Epidermal repopulation by allogeneic Thy-1.2+ cells was not seen in AKR/J mice reconstituted with syngeneic bone marrow cells and allogeneic Thy-1.2+ AKR/Cum thymocytes. Taken together, these results indicate that Thy-1+ dendritic epidermal cells are derived from the bone marrow and suggest that they are not related to conventional peripheral T-lymphocytes

Partition coefficients for Ni, Cu, Pd, Pt, Rh, and Ir between monosulfide solid solution and sulfide liquid and the formation of compositionally zoned Ni-Cu sulfide bodies by fractional crystallization of sulfide liquid

DEFF Research Database (Denmark)

Barnes, S.J.; Makovicky, E.; Makovicky, M.

1996-01-01

of the system. There is a positive correlation between the partition coefficients and sulfur content of the monosulfide solid solution and between the partition coefficients and the sulfur content of the liquid. In sulfur-saturated and sulfur-over-saturated experimental systems, the metals behave in a manner...... (Alexo, Abitibi Greenstone Belt) and a zoned tholeiite-related ore (Oktyabr'sky, Noril'sk region, Siberia). In both cases, the experimental partition coefficients numerically model the composition zones of the actual ores. This supports the model of fractional crystallization of a monosulfide solid...

Mechanism of depression as a risk factor in the development of Alzheimer's disease: the function of AQP4 and the glymphatic system.

Science.gov (United States)

Xia, Maosheng; Yang, Li; Sun, Guangfeng; Qi, Shuang; Li, Baoman

2017-02-01

Many studies have indicated that a history of depression increases the risk of developing Alzheimer's disease (AD); however, the potential pathogenestic mechanism by which depression functions as a high risk factor for AD remains unknown. Recently, a "cerebral lymphatic system" referred to as "glymphatic system" has been demonstrated to be responsible for neuronal extracellular waste protein clearance via a paravascular pathway. However, the function of glymphatic pathway has not been determined in depressive disorders. The present study used an animal model of chronic unpredictable mild stress (CUMS) to determine the function of glymphatic pathway by using fluorescence tracers. Immunohistochemistry was used to assess the accumulation of endogenous mouse and exogenous human amyloid beta 42 (Aβ42) in CUMS-treated mice with or without treatment with antidepressant fluoxetine. Glymphatic pathway circulation was impaired in mice treated with CUMS; moreover, glymphatic pathway dysfunction suppressed Aβ42 metabolism, because the accumulation of endogenous and exogenous Aβ42 was increased in the brains of the CUMS-treated mice. However, treatment with fluoxetine reversed these destructive effects of CUMS on glymphatic system. In anhedonic mice, the expression of the water channel aquaporin 4 (AQP4), a factor in glymphatic pathway dysfunction, was down-regulated in cortex and hippocampus. The dysfunction of glymphatic system suggested why a history of depression may be a strong risk factor for AD in anhedonic mice. We hope our study will contribute to an understanding of the risk mechanism of depressive disorder in the development of AD and the mechanisms of antidepressant therapies in AD.

Antidepressant-Like Effects of Cordycepin in a Mice Model of Chronic Unpredictable Mild Stress

Directory of Open Access Journals (Sweden)

Zhang Tianzhu

2014-01-01

Full Text Available Cordycepin (3′-deoxyadenosine, a major bioactive component isolated from Cordyceps militaris, has multiple pharmacological activities. This study is attempted to investigate whether cordycepin (COR possesses beneficial effects on chronic unpredictable mild stress- (CUMS- induced behavioral deficits (depression-like behaviors and explore the possible mechanisms. ICR mice were subjected to chronic unpredictable mild stress for 42 consecutive days. Then, COR and fluoxetine (FLU, positive control drug were administered for 21 consecutive days at the last three weeks of CUMS procedure. The classical behavioral tests, open field test (OFT, sucrose preference test (SPT, tail suspension test (TST, and forced swimming test (FST, were applied to evaluate the antidepressant effects of COR. Then the serotonin (5-HT and noradrenaline (NE concentrations in hippocampal were evaluated by HPLC; tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6 in hippocampal were evaluated, and the proteins of TNF-α, IL-6, NF-κBP65 5-HT receptor (5-HTR, and brain-derived neurotrophic factor (BDNF in hippocampal were evaluated by Western blot. Our results indicated that 6 weeks of CUMS exposure induced significant depression-like behavior, with low 5-HT and NE levels, high TNF-α and IL-6 in brain and high hippocampal TNF-α, IL-6, P-NF-κBP65, and 5-HTR levels, and low BDNF expression levels. Whereas, chronic COR (20, 40 mg/kg treatments reversed the behavioral deficiency induced by CUMS exposure, treatment with COR normalized the change of TNF-α, IL-6, 5-HT, and NE levels, which demonstrated that COR could partially restore CUMS-induced 5-HT receptor impairments and inflammation. Besides, hippocampal BDNF expressions were also upregulated after COR treatments. In conclusion, COR remarkably improved depression-like behavior in CUMS mice and its antidepressant activity is mediated, at least in part, by the upregulating BDNF and downregulating 5-HTR levels and

Role of proBDNF and BDNF in dendritic spine plasticity and depressive-like behaviors induced by an animal model of depression.

Science.gov (United States)

Qiao, Hui; An, Shu-Cheng; Xu, Chang; Ma, Xin-Ming

2017-05-15

Major depressive disorder (MDD) is one of the most common psychiatric disorder, but the underlying mechanisms are largely unknown. Increasing evidence shows that brain-derived neurotrophic factor (BDNF) plays an important role in the structural plasticity induced by depression. Considering the opposite effects of BDNF and its precursor proBDNF on neural plasticity, we hypothesized that the balance of BDNF and proBDNF plays a critical role in chronic unpredicted mild stress (CUMS)-induced depressive-like behaviors and structural plasticity in the rodent hippocampus. The aims of this study were to compare the functions of BDNF and proBDNF in the CUMS-induced depressive-like behaviors, and determine the effects of BDNF and proBDNF on expressions of kalirin-7, postsynaptic density protein 95 (PSD95) and NMDA receptor subunit NR2B in the hippocampus of stressed and naïve control rats, respectively. Our results showed that CUMS induced depressive-like behaviors, caused a decrease in the ratio of BDNF/proBDNF in the hippocampus and resulted in a reduction in spine density in hippocampal CA1 pyramidal neurons; these alterations were accompanied by a decrease in the levels of kalirin-7, PSD95 and NR2B in the hippocampus. Injection of exogenous BDNF into the CA1 area of stressed rats reversed CUMS-induced depressive-like behaviors and prevented CUMS-induced spine loss and decrease in kalirin-7, NR2B and PSD95 levels. In contrast, injection of exogenous proBDNF into the CA1 region of naïve rats caused depressive-like behavior and an accompanying decrease in both spine density and the levels of kalirin-7, NR2B and PSD95. Taken together, our results suggest that the ratio of BDNF to proBDNF in the hippocampus plays a key role in CUMS-induced depressive-like behaviors and alterations of dendritic spines in hippocampal CA1 pyramidal neurons. Kalirin-7 may play an important role during this process. Copyright © 2017 Elsevier B.V. All rights reserved.

Predicting the denitrification capacity of sandy aquifers from shorter-term incubation experiments and sediment properties

Directory of Open Access Journals (Sweden)

W. Eschenbach

2013-02-01

Full Text Available Knowledge about the spatial variability of denitrification rates and the lifetime of denitrification in nitrate-contaminated aquifers is crucial to predict the development of groundwater quality. Therefore, regression models were derived to estimate the measured cumulative denitrification of aquifer sediments after one year of incubation from initial denitrification rates and several sediment parameters, namely total sulphur, total organic carbon, extractable sulphate, extractable dissolved organic carbon, hot water soluble organic carbon and potassium permanganate labile organic carbon.

For this purpose, we incubated aquifer material from two sandy Pleistocene aquifers in Northern Germany under anaerobic conditions in the laboratory using the ¹⁵N tracer technique. The measured amount of denitrification ranged from 0.19 to 56.2 mg N kg⁻¹ yr⁻¹. The laboratory incubations exhibited high differences between non-sulphidic and sulphidic aquifer material in both aquifers with respect to all investigated sediment parameters. Denitrification rates and the estimated lifetime of denitrification were higher in the sulphidic samples. For these samples, the cumulative denitrification measured during one year of incubation (D_cum(365 exhibited distinct linear regressions with the stock of reduced compounds in the investigated aquifer samples. D_cum(365 was predictable from sediment variables within a range of uncertainty of 0.5 to 2 (calculated D_cum(365/measured D_cum(365 for aquifer material with a D_cum(365 > 20 mg N kg⁻¹ yr⁻¹. Predictions were poor for samples with lower D_cum(365, such as samples from the NO₃⁻ bearing groundwater zone, which includes the non-sulphidic samples, from the upper part of both aquifers where denitrification is not sufficient to

Melatonin mediated antidepressant-like effect in the hippocampus of chronic stress-induced depression rats: Regulating vesicular monoamine transporter 2 and monoamine oxidase A levels.

Science.gov (United States)

Stefanovic, Bojana; Spasojevic, Natasa; Jovanovic, Predrag; Jasnic, Nebojsa; Djordjevic, Jelena; Dronjak, Sladjana

2016-10-01

The hippocampus is sensitive to stress which activates norepinephrine terminals deriving from the locus coeruleus. Melatonin exerts positive effects on the hippocampal neurogenic process and on depressive-like behaviour. Thus, in the present study, an examination was made of the effect of chronic melatonin treatment on norepinephrine content, synthesis, uptake, vesicular transport and degradation in the hippocampus of rats exposed to CUMS. This entailed quantifying the norephinephrine, mRNA and protein levels of DBH, NET, VMAT 2, MAO-A and COMT. The results show that CUMS evoked prolonged immobility. Melatonin treatment decreased immobility in comparison with the placebo group, reflecting an antidepressant-like effect. Compared with the placebo group, a dramatic decrease in norepinephrine content, decreased VMAT2 mRNA and protein and increased MAO-A protein levels in the hippocampus of the CUMS rats were observed. However, no significant differences in the levels of DBH, NET, COMT mRNA and protein and MAO-A mRNA levels between the placebo and the stressed groups were found. The results showed the restorative effects of melatonin on the stress-induced decline in the norepinephrine content of the hippocampus. It was observed that melatonin treatment in the CUMS rats prevented the stress-induced decrease in VMAT2 mRNA and protein levels, whereas it reduced the increase of the mRNA of COMT and protein levels of MAO-A. Chronic treatment with melatonin failed to alter the gene expression of DBH or NET in the hippocampus of the CUMS rats. Additionally, the results show that melatonin enhances VMAT2 expression and norepinephrine storage, whilst it reduces norepinephrine degrading enzymes. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.

The Impacts of Swimming Exercise on Hippocampal Expression of Neurotrophic Factors in Rats Exposed to Chronic Unpredictable Mild Stress

Directory of Open Access Journals (Sweden)

Pei Jiang

2014-01-01

Full Text Available Depression is associated with stress-induced neural atrophy in limbic brain regions, whereas exercise has antidepressant effects as well as increasing hippocampal synaptic plasticity by strengthening neurogenesis, metabolism, and vascular function. A key mechanism mediating these broad benefits of exercise on the brain is induction of neurotrophic factors, which instruct downstream structural and functional changes. To systematically evaluate the potential neurotrophic factors that were involved in the antidepressive effects of exercise, in this study, we assessed the effects of swimming exercise on hippocampal mRNA expression of several classes of the growth factors (BDNF, GDNF, NGF, NT-3, FGF2, VEGF, and IGF-1 and peptides (VGF and NPY in rats exposed to chronic unpredictable mild stress (CUMS. Our study demonstrated that the swimming training paradigm significantly induced the expression of BDNF and BDNF-regulated peptides (VGF and NPY and restored their stress-induced downregulation. Additionally, the exercise protocol also increased the antiapoptotic Bcl-xl expression and normalized the CUMS mediated induction of proapoptotic Bax mRNA level. Overall, our data suggest that swimming exercise has antidepressant effects, increasing the resistance to the neural damage caused by CUMS, and both BDNF and its downstream neurotrophic peptides may exert a major function in the exercise related adaptive processes to CUMS.

Gemfibrozil has antidepressant effects in mice: Involvement of the hippocampal brain-derived neurotrophic factor system.

Science.gov (United States)

Ni, Yu-Fei; Wang, Hao; Gu, Qiu-Yan; Wang, Fei-Ying; Wang, Ying-Jie; Wang, Jin-Liang; Jiang, Bo

2018-04-01

Major depressive disorder has become one of the most serious neuropsychiatric disorders worldwide. However, currently available antidepressants used in clinical practice are ineffective for a substantial proportion of patients and always have side effects. Besides being a lipid-regulating agent, gemfibrozil is an agonist of peroxisome proliferator-activated receptor-α (PPAR-α). We investigated the antidepressant effects of gemfibrozil on C57BL/6J mice using the forced swim test (FST) and tail suspension test (TST), as well as the chronic unpredictable mild stress (CUMS) model of depression. The changes in brain-derived neurotrophic factor (BDNF) signaling cascade in the brain after CUMS and gemfibrozil treatment were further assessed. Pharmacological inhibitors and lentivirus-expressed short hairpin RNA (shRNA) were also used to clarify the antidepressant mechanisms of gemfibrozil. Gemfibrozil exhibited significant antidepressant actions in the FST and TST without affecting the locomotor activity of mice. Chronic gemfibrozil administration fully reversed CUMS-induced depressive-like behaviors in the FST, TST and sucrose preference test. Gemfibrozil treatment also restored CUMS-induced inhibition of the hippocampal BDNF signaling pathway. Blocking PPAR-α and BDNF but not the serotonergic system abolished the antidepressant effects of gemfibrozil on mice. Gemfibrozil produced antidepressant effects in mice by promoting the hippocampal BDNF system.

Integration of borehole and seismic data to unravel complex stratigraphy: Case studies from the Mannville Group, Western Canada

Science.gov (United States)

Sarzalejo Silva, Sabrina Ester

Understanding the stratigraphic architecture of geologically complex reservoirs, such as the heavy oil deposits of Western Canada, is essential to achieve an efficient hydrocarbon recovery. Borehole and 3-D seismic data were integrated to define the stratigraphic architecture and generate 3-dimensional geological models of the Mannville Group in Saskatchewan. The Mannville is a stratigraphically complex unit formed of fluvial to marine deposits. Two areas in west-central and southern Saskatchewan were examined in this study. In west-central Saskatchewan, the area corresponds to a stratigraphically controlled heavy oil reservoir with production from the undifferentiated Dina-Cummings Members of the Lower Cretaceous Mannville Group. The southern area, although non-prospective for hydrocarbons, shares many similarities with time-equivalent strata in areas of heavy oil production. Seismic sequence stratigraphic principles together with log signatures permitted the subdivision of the Mannville into different packages. An initial geological model was generated integrating seismic and well-log data Multiattribute analysis and neural networks were used to generate a pseudo-lithology or gamma-ray volume. The incorporation of borehole core data to the model and the subsequent integration with the lithological prediction were crucial to capture the distribution of reservoir and non-reservoir deposits in the study area. The ability to visualize the 3-D seismic data in a variety of ways, including arbitrary lines and stratal or horizon slicing techniques helped the definition of stratigraphic features such as channels and scroll bars that affect fluid flow in hydrocarbon producing areas. Small-scale heterogeneities in the reservoir were not resolved due to the resolution of the seismic data. Although not undertaken in this study, the resulting stratigraphic framework could be used to help construct a static reservoir model. Because of the small size of the 3-D seismic surveys

The South Carolina Collaborative Undergraduate HBCU Student Summer Training Program

Science.gov (United States)

2016-02-01

found that lack of exercise and high fat and sugar filled diets aid greatly to the aid of AGE pools. Foods containing abundant AGE’s promote... Smoking & Cancer Michael Cummings, PhD July 11 (D) Periodontal Disease – BSB 451 Keith Kirkwood, DDS,PhD July 12 (D) Oral Pharyngeal Cancer – BSB...Materials – ROOM BSB 252 Joe Vuthiganon, DMD July 10 (C) Smoking & Cancer Michael Cummings, PhD July 10 (D) Periodontal Disease – BSB 252

The Impacts of Heating Strategy on Soil Moisture Estimation Using Actively Heated Fiber Optics.

Science.gov (United States)

Dong, Jianzhi; Agliata, Rosa; Steele-Dunne, Susan; Hoes, Olivier; Bogaard, Thom; Greco, Roberto; van de Giesen, Nick

2017-09-13

Several recent studies have highlighted the potential of Actively Heated Fiber Optics (AHFO) for high resolution soil moisture mapping. In AHFO, the soil moisture can be calculated from the cumulative temperature ( T cum ), the maximum temperature ( T max ), or the soil thermal conductivity determined from the cooling phase after heating ( λ ). This study investigates the performance of the T cum , T max and λ methods for different heating strategies, i.e., differences in the duration and input power of the applied heat pulse. The aim is to compare the three approaches and to determine which is best suited to field applications where the power supply is limited. Results show that increasing the input power of the heat pulses makes it easier to differentiate between dry and wet soil conditions, which leads to an improved accuracy. Results suggest that if the power supply is limited, the heating strength is insufficient for the λ method to yield accurate estimates. Generally, the T cum and T max methods have similar accuracy. If the input power is limited, increasing the heat pulse duration can improve the accuracy of the AHFO method for both of these techniques. In particular, extending the heating duration can significantly increase the sensitivity of T cum to soil moisture. Hence, the T cum method is recommended when the input power is limited. Finally, results also show that up to 50% of the cable temperature change during the heat pulse can be attributed to soil background temperature, i.e., soil temperature changed by the net solar radiation. A method is proposed to correct this background temperature change. Without correction, soil moisture information can be completely masked by the background temperature error.

A 1H-NMR-Based Metabonomic Study on the Anti-Depressive Effect of the Total Alkaloid of Corydalis Rhizoma

Directory of Open Access Journals (Sweden)

Hongwei Wu

2015-05-01

Full Text Available Corydalis Rhizoma, named YuanHu in China, is the dried tuber of Corydalis yanhusuo W.T. Wang which is used in Traditional Chinese Medicine for pain relief and blood activation. Previous pharmacological studies showed that apart from analgesics, the alkaloids from YuanHu may be useful in the therapy of depression by acting on the GABA, dopamine and benzodiazepine receptors. In this study, the antidepressive effect of the total alkaloid of YuanHu (YHTA was investigated in a chronic unpredictable mild stress (CUMS rat model using 1H-NMR-based metabonomics. Plasma metabolic profiles were analyzed and multivariate data analysis was applied to discover the metabolic biomarkers in CUMS rats. Thirteen biomarkers of CUMS-introduced depression were identified, which are myo-inositol, glycerol, glycine, creatine, glutamine, glutamate, β-glucose, α-glucose, acetoacetate, 3-hydroxybutyrate, leucine and unsaturated lipids (L7, L9. Moreover, a metabolic network of the potential biomarkers in plasma perturbed by CUMS was detected. After YHTA treatment, clear separation between the model group and YHTA-treated group was achieved. The levels of all the abnormal metabolites mentioned above showed a tendency of restoration to normal levels. The results demonstrated the therapeutic efficacy of YHTA against depression and suggested that NMR-based metabolomics can provide a simple and easy tool for the evaluation of herbal therapeutics.

Recovery of barotrauma injuries in Chinook salmon, Oncorhynchus tshawytscha from exposure to pile driving sound.

Directory of Open Access Journals (Sweden)

Brandon M Casper

Full Text Available Juvenile Chinook salmon, Oncorhynchus tshawytscha, were exposed to simulated high intensity pile driving signals to evaluate their ability to recover from barotrauma injuries. Fish were exposed to one of two cumulative sound exposure levels for 960 pile strikes (217 or 210 dB re 1 µPa(2·s SEL(cum; single strike sound exposure levels of 187 or 180 dB re 1 µPa(2⋅s SEL(ss respectively. This was followed by an immediate assessment of injuries, or assessment 2, 5, or 10 days post-exposure. There were no observed mortalities from the pile driving sound exposure. Fish exposed to 217 dB re 1 µPa(2·s SEL(cum displayed evidence of healing from injuries as post-exposure time increased. Fish exposed to 210 dB re 1 µPa(2·s SEL(cum sustained minimal injuries that were not significantly different from control fish at days 0, 2, and 10. The exposure to 210 dB re 1 µPa(2·s SEL(cum replicated the findings in a previous study that defined this level as the threshold for onset of injury. Furthermore, these data support the hypothesis that one or two Mild injuries resulting from pile driving exposure are unlikely to affect the survival of the exposed animals, at least in a laboratory environment.

Low-temperature VRH conduction through complex materials in the presence of a temperature-dependent voltage threshold: A semi-classical percolative approach

International Nuclear Information System (INIS)

Sen, A.K.; Bhattacharya, S.

2006-12-01

In this paper, we study the variation of low temperature (T) dc conductance, G(T), of a semi-classical percolative Random Resistor cum Tunneling-bond Network (RRTN), in the presence of a linearly temperature-dependent microscopic voltage threshold, υ g (T). This model (proposed by our group in the early 90's) considers a phenomenological semi-classical tunneling (or, hopping through a barrier) process. Just as in our previous constant-υ g case, we find in the present study also that the variable range hopping (VRH) exponent γ varies continuously with the ohmic concentration p in a non-monotonic fashion. In addition, we observe a new shoulder-like behaviour of G(T) in the intermediate temperature range, below the conductance maximum. (author)

Communication complexity and information complexity

Science.gov (United States)

Pankratov, Denis

Information complexity enables the use of information-theoretic tools in communication complexity theory. Prior to the results presented in this thesis, information complexity was mainly used for proving lower bounds and direct-sum theorems in the setting of communication complexity. We present three results that demonstrate new connections between information complexity and communication complexity. In the first contribution we thoroughly study the information complexity of the smallest nontrivial two-party function: the AND function. While computing the communication complexity of AND is trivial, computing its exact information complexity presents a major technical challenge. In overcoming this challenge, we reveal that information complexity gives rise to rich geometrical structures. Our analysis of information complexity relies on new analytic techniques and new characterizations of communication protocols. We also uncover a connection of information complexity to the theory of elliptic partial differential equations. Once we compute the exact information complexity of AND, we can compute exact communication complexity of several related functions on n-bit inputs with some additional technical work. Previous combinatorial and algebraic techniques could only prove bounds of the form theta( n). Interestingly, this level of precision is typical in the area of information theory, so our result demonstrates that this meta-property of precise bounds carries over to information complexity and in certain cases even to communication complexity. Our result does not only strengthen the lower bound on communication complexity of disjointness by making it more exact, but it also shows that information complexity provides the exact upper bound on communication complexity. In fact, this result is more general and applies to a whole class of communication problems. In the second contribution, we use self-reduction methods to prove strong lower bounds on the information

Electromagnetic pump technology

International Nuclear Information System (INIS)

Prabhakar, R.

1994-01-01

Fast Breeder Reactors have an important role to play in our nuclear power programme. Liquid metal sodium is used as the coolant for removing fission heat generated in fast reactors and a distinctive physical property of sodium is its high electrical conductivity. This enables application of electromagnetic (EM) pumps, working on same principle as electric motors, for pumping liquid sodium. Due to its lower efficiency as compared to centrifugal pumps, use of EM pumps has been restricted to reactor auxiliary circuits and experimental facilities. As part of our efforts to manufacture fast reactor components indigenously, work on the development of two types of EM pumps namely flat linear induction pump (FLIP) and annular linear induction pump (ALIP) has been undertaken. Design procedures based on an equivalent circuit approach have been established and results from testing a 5.6 x 10E-3 Cum/s (20 Cum/h) FLIP in a sodium loop were used to validate the procedure. (author). 7 refs., 6 figs

A Model of Chronic Exposure to Unpredictable Mild Socio-Environmental Stressors Replicates Some Spaceflight-Induced Immunological Changes

Directory of Open Access Journals (Sweden)

Fanny Gaignier

2018-05-01

Full Text Available During spaceflight, astronauts face radiations, mechanical, and socio-environmental stressors. To determine the impact of chronic socio-environmental stressors on immunity, we exposed adult male mice to chronic unpredictable mild psychosocial and environmental stressors (CUMS model for 3 weeks. This duration was chosen to simulate a long flight at the human scale. Our data show that this combination of stressors induces an increase of serum IgA, a reduction of normalized splenic mass and tends to reduce the production of pro-inflammatory cytokines, as previously reported during or after space missions. However, CUMS did not modify major splenic lymphocyte sub-populations and the proliferative responses of splenocytes suggesting that these changes could be due to other factors such as gravity changes. Thus, CUMS, which is an easy to implement model, could contribute to deepen our understanding of some spaceflight-associated immune alterations and could be useful to test countermeasures.

inner-sphere complexation of cations at the rutile-water interface: A concise surface structural interpretation with the CD and MUSIC model

Energy Technology Data Exchange (ETDEWEB)

Ridley, Mora K. [Texas Tech University, Lubbock; Hiemstra, T [Oak Ridge National Laboratory (ORNL); Van Riemsdijk, Willem H. [Wageningen University and Research Centre, The Netherlands; Machesky, Michael L. [Illinois State Water Survey, Champaign, IL

2009-01-01

Acid base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multicomponent mineral aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488 508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca2+ and Sr2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 110 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Pr edota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Be ne zeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile water interface: linking molecular and macroscopic

Inner-sphere complexation of cations at the rutile-water interface: A concise surface structural interpretation with the CD and MUSIC model

Science.gov (United States)

Ridley, Moira K.; Hiemstra, Tjisse; van Riemsdijk, Willem H.; Machesky, Michael L.

2009-04-01

Acid-base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multi-component mineral-aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488-508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca 2+ and Sr 2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 1 1 0 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Předota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Bénézeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile-water interface: linking molecular and macroscopic

Portuguese adaptation of the security in the interparental subsystem scales : factor structure and validity studies

OpenAIRE

Lambuça, Ana Rita dos Santos

2014-01-01

Tese de Mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde, Núcleo de Psicologia Clínica Sistémica), 2014 É amplamente reconhecido o impato nocivo que o conflito parental tem sobre os mais diversos aspetos do ajustamento psicológico das crianças (e.g. Cummings & Davies, 2002; Cummings & Keller, 2006). Mais concretamente tipos de conflito destrutivos e hostis, caracterizados pela sua maior frequência e intensidade e fraca ou nenhuma resolução, mostram-se especialmente...

Efecto de la fertilización orgánica, la variedad y la época en el perfil polifenólico de Morus alba (L.

Directory of Open Access Journals (Sweden)

D. E. García

2005-01-01

Full Text Available Con el objetivo de detectar los principales grupos de fenoles en la biomasa de la morera y de-terminar el efecto del abonado (0, 100, 300 y 500 kg N/ha/año, la variedad (Cubana, Indonesia, Tigreada y Acorazonada y la época (periodo lluvioso y poco lluvioso, en el perfil polifenólico, se llevó a cabo una investigación con un diseño de bloques (al azar con arreglo factorial 4 x 4 x 2 y cinco repeticiones. Mediante el tamizaje fitoquímico se evaluó la presencia de siete grupos de compuestos, para posteriormente, determinar sus concentraciones. Únicamente se detectaron fenoles (FT, flavonoides (Flav y cumarinas (Cum, con presencia leve, notable o cuantiosa. Sólo se encontraron interacciones significativas entre los factores fertilización y variedad para los FT y las Cum (P<0,05. Los niveles máximos de FT y Cum encontrados en las hojas fueron de 2,86% MS (Tigreada abonada con 100 kg N/ha/año y 0,65% MS (Cubana e Indonesia fertilizadas con 100 kg N/ha/año, respectivamente. Las mayores concentraciones de FT y Cum en los tallos tiernos se observaron en la variedad Acorazonada con 100 kg N/ha/año (1,55% MS e Indonesia, con la aplicación de 500 kg N/ha/año (0,60% MS. En las hojas de las variedades (los contenidos de FT y Cum tendieron a disminuir con el incremento de los niveles de fertilización, a excepción de las concentraciones de FT, en la variedad Cubana. En el caso de los Flav, no se observó un efecto significativo de los factores fertilización, variedad y época. Solamente en los FT de las hojas, se observó un efecto representativo de la época a favor del PLL. Los resultados permiten concluir que las concentraciones de los FT se ven afectadas por los niveles de fertilización, la variedad y la época. Los contenidos de Cum presentan variaciones significativas entre los niveles de abonado orgánico y las variedades. Los niveles de Flav no muestran fluctuaciones cuantiosas con ninguna de las variables estudiadas.

Variability of African Farming Systems from Phenological Analysis of NDVI Time Series

Science.gov (United States)

Vrieling, Anton; deBeurs, K. M.; Brown, Molly E.

2011-01-01

Food security exists when people have access to sufficient, safe and nutritious food at all times to meet their dietary needs. The natural resource base is one of the many factors affecting food security. Its variability and decline creates problems for local food production. In this study we characterize for sub-Saharan Africa vegetation phenology and assess variability and trends of phenological indicators based on NDVI time series from 1982 to 2006. We focus on cumulated NDVI over the season (cumNDVI) which is a proxy for net primary productivity. Results are aggregated at the level of major farming systems, while determining also spatial variability within farming systems. High temporal variability of cumNDVI occurs in semiarid and subhumid regions. The results show a large area of positive cumNDVI trends between Senegal and South Sudan. These correspond to positive CRU rainfall trends found and relate to recovery after the 1980's droughts. We find significant negative cumNDVI trends near the south-coast of West Africa (Guinea coast) and in Tanzania. For each farming system, causes of change and variability are discussed based on available literature (Appendix A). Although food security comprises more than the local natural resource base, our results can perform an input for food security analysis by identifying zones of high variability or downward trends. Farming systems are found to be a useful level of analysis. Diversity and trends found within farming system boundaries underline that farming systems are dynamic.

Stanley Cavell, Classical Hollywood and the Constitution of the Ordinary (With Notes on Billy Wilder

Directory of Open Access Journals (Sweden)

Tatjana Jukić

2016-04-01

Full Text Available When in his Tanner lectures Stanley Cavell sets out to define Ordinary Language Philosophy or – rather – to explain how it demarcates philosophy as such, he takes up psychoanalytic literary criticism in order to articulate the terms of this task. Yet the constitution of the ordinary, in Cavell, is never quite accessed from within psychoanalysis-cum-literature alone; instead, it takes another relation, that of psychoanalysis and literature to classical Hollywood, for Cavell to address the ordinary in terms of its constitution. I propose to discuss this complex using two films by Billy Wilder as a passageway to Cavell’s analytic procedure.

Targeting Oxidative Stress, Cytokines and Serotonin Interactions Via Indoleamine 2, 3 Dioxygenase by Coenzyme Q10: Role in Suppressing Depressive Like Behavior in Rats.

Science.gov (United States)

Abuelezz, Sally A; Hendawy, Nevien; Magdy, Yosra

2017-06-01

Depression is a major health problem in which oxidative stress and inflammation are inextricably connected in its pathophysiology. Coenzyme Q10 (CoQ10) is an important anti-oxidant compound with anti-inflammatory and neuro-protective properties. This study was designed to investigate the hypothesis that CoQ10 by its anti-oxidant and anti-inflammatory potentials can alleviate depressive- like behavior by restoring the balance of the tryptophan catabolites kynurenine/serotonin toward the serotonin pathway by down-regulation of hippocampal indoleamine 2,3-dioxygenase 1 (IDO-1). Depressive-like behavior was induced by chronic unpredictable mild stress (CUMS) protocol including food or water deprivation, cage tilting, reversed light cycle etc. Male Wistar rats were randomly divided into five groups; Control, CUMS, CUMS and CoQ10 (50,100 and 200 mg/kg/day i.p. respectively) groups. CoQ10 effects on different behavioral and biochemical tests were analyzed. CoQ10 showed significant antidepressant efficacy, as evidenced by significantly decreased stress induced changes to forced swimming challenge and open field test, as well as attenuating raised corticosterone level and adrenal glands weight. The anti-oxidant effect of CoQ10 was exhibited by its ability to significantly reduce hippocampal elevated malondialdehyde and 4-hydroxynonenal levels and elevate the reduced glutathione and catalase levels. CoQ10 significantly reduced different pro-inflammatory cytokines levels including interleukin (IL)-1β, IL-2, IL-6 and tumor necrosis factor-α. It suppressed hippocampal IDO-1 and subsequent production of kynurenine and enhanced the hippocampal contents of tryptophan and serotonin. Immunohistochemical analysis revealed that CoQ10 was able to attenuate the elevated microglial CD68 and elevate the astrocyte glial fibrillary acidic protein compared to CUMS group. CoQ10 exhibited antidepressant-like effects on rats exposed to CUMS. This could be attributed to its ability to reduce

miR-16 and Fluoxetine Both Reverse Autophagic and Apoptotic Change in Chronic Unpredictable Mild Stress Model Rats

Directory of Open Access Journals (Sweden)

Yang Yang

2017-07-01

Full Text Available In the clinic selective serotonin reuptake inhibitors (SSRIs, like Fluoxetine, remain the primary treatment for major depression. It has been suggested that miR-16 regulates serotonin transporters (SERT via raphe nuclei and hippocampal responses to antidepressants. However, the underlying mechanism and regulatory pathways are still obtuse. Here, a chronic unpredicted mild stress (CUMS depression model in rats was established, and then raphe nuclei miR-16 and intragastric Fluoxetine injections were administered for a duration of 3 weeks. An open field test and sucrose preference quantification displayed a significant decrease in the CUMS groups when compare to the control groups, however these changes were attenuated by both miR-16 and Fluoxetine treatments. A dual-luciferase reporter assay system verified that hsa-miR-16 inhibitory effects involve the targeting of 3′UTR on the 5-HTT gene. Expression levels of miR-16 and BDNF in the hippocampus were examined with RT-PCR, and it was found that increased 5-HT2a receptor expression induced by CUMS can be decreased by miR-16 and Fluoxetine administration. Immunofluorescence showed that expression levels of neuron NeuN and MAP-2 in CUMS rats were lower. Apoptosis and autophagy levels were evaluated separately through relative expression of Bcl-2, Caspase-3, Beclin-1, and LC3II. Furthermore, CUMS was found to decrease levels of hippocampal mTOR, PI3K, and AKT. These findings indicate that apoptosis and autophagy related pathways could be involved in the effectiveness of antidepressants, in which miR-16 participates in the regulation of, and is likely to help integrate rapid therapeutic strategies to alleviate depression clinically. These findings indicate that miR-16 participates in the regulation of apoptosis and autophagy and could account for some part of the therapeutic effect of SSRIs. This discovery has the potential to further the understanding of SSRIs and accelerate the development of new

Learning and memory alterations are associated with hippocampal N-acetylaspartate in a rat model of depression as measured by 1H-MRS.

Directory of Open Access Journals (Sweden)

Guangjun Xi

Full Text Available It is generally accepted that cognitive processes, such as learning and memory, are affected in depression. The present study used a rat model of depression, chronic unpredictable mild stress (CUMS, to determine whether hippocampal volume and neurochemical changes were involved in learning and memory alterations. A further aim was to determine whether these effects could be ameliorated by escitalopram treatment, as assessed with the non-invasive techniques of structural magnetic resonance imaging (MRI and magnetic resonance spectroscopy (MRS. Our results demonstrated that CUMS had a dramatic influence on spatial cognitive performance in the Morris water maze task, and CUMS reduced the concentration of neuronal marker N-acetylaspartate (NAA in the hippocampus. These effects could be significantly reversed by repeated administration of escitalopram. However, neither chronic stress nor escitalopram treatment influenced hippocampal volume. Of note, the learning and memory alterations of the rats were associated with right hippocampal NAA concentration. Our results indicate that in depression, NAA may be a more sensitive measure of cognitive function than hippocampal volume.

Potential of EPR spin-trapping to investigate in situ free radicals generation from skin allergens in reconstructed human epidermis: cumene hydroperoxide as proof of concept.

Science.gov (United States)

Kuresepi, Salen; Vileno, Bertrand; Turek, Philippe; Lepoittevin, Jean-Pierre; Giménez-Arnau, Elena

2018-02-01

The first step in the development of skin sensitisation to a chemical, and in the elicitation of further allergic contact dermatitis (ACD), is the binding of the allergen to skin proteins after penetrating into the epidermis. The so-formed antigenic adduct is then recognised by the immune system as foreign to the body. Sensitising organic hydroperoxides derived from autoxidation of natural terpenes are believed to form antigens through radical-mediated mechanisms, although this has not yet been established. So far, in vitro investigations on reactive radical intermediates derived from these skin sensitisers have been conducted in solution, yet with experimental conditions being far away from real-life sensitisation. Herein, we report for the first time, the potential use of EPR spin-trapping to study the in situ generation of free radicals derived from cumene hydroperoxide CumOOH in a 3D reconstructed human epidermis (RHE) model, thus much closer to what may happen in vivo. Among the undesirable effects associated with dermal exposure to CumOOH, it is described to cause allergic and irritant dermatitis, being reported as a significant sensitiser. We considered exploiting the usage of spin-trap DEPMPO as an extensive view of all sort of radicals derived from CumOOH were observed all at once in solution. We showed that in the Episkin TM RHE model, both by incubating in the assay medium and by topical application, carbon radicals are mainly formed by redox reactions suggesting the key role of CumOOH-derived carbon radicals in the antigen formation process.

Ghrelin alleviates anxiety- and depression-like behaviors induced by chronic unpredictable mild stress in rodents.

Science.gov (United States)

Huang, Hui-Jie; Zhu, Xiao-Cang; Han, Qiu-Qin; Wang, Ya-Lin; Yue, Na; Wang, Jing; Yu, Rui; Li, Bing; Wu, Gen-Cheng; Liu, Qiong; Yu, Jin

2017-05-30

As a regulator of food intake, ghrelin also plays a key role in mood disorders. Previous studies reported that acute ghrelin administration defends against depressive symptoms of chronic stress. However, the effects of long-term ghrelin on rodents under chronic stress hasn't been revealed. In this study, we found chronic peripheral administration of ghrelin (5nmol/kg/day for 2 weeks, i.p.) could alleviate anxiety- and depression-like behaviors induced by chronic unpredictable mild stress (CUMS). The depression-like behaviors were assessed by the forced swimming test (FST), and anxiety-like behaviors were assessed by the open field test (OFT) and the elevated plus maze test (EPM). Meanwhile, we observed that peripheral acylated ghrelin, together with gastral and hippocampal ghrelin prepropeptide mRNA level, were significantly up-regulated in CUMS mice. Besides, the increased protein level of growth hormone secretagogue receptor (GHSR) in hippocampus were also detected. These results suggested that the endogenous ghrelin/GHSR pathway activated by CUMS plays a role in homeostasis. Further results showed that central treatment of ghrelin (10μg/rat/day for 2 weeks, i.c.v.) or GHRP-6 (the agonist of GHSR, 10μg/rat/day for 2 weeks, i.c.v.) significantly alleviated the depression-like behaviors induced by CUMS in FST and sucrose preference test (SPT). Based on these results, we concluded that central GHSR is involved in the antidepressant-like effect of exogenous ghrelin treatment, and ghrelin/GHSR may have the inherent neuromodulatory properties against depressive symptoms. Copyright © 2017 Elsevier B.V. All rights reserved.

Etazolate rescues behavioral deficits in chronic unpredictable mild stress model: modulation of hypothalamic-pituitary-adrenal axis activity and brain-derived neurotrophic factor level.

Science.gov (United States)

Jindal, Ankur; Mahesh, Radhakrishnan; Bhatt, Shvetank

2013-11-01

Preliminary study in our laboratory showed that etazolate produced antidepressant- and anxiolytic-like effects in rodent models, however, the ability of etazolate to produce antidepressant- and anxiolytic-like effects and underlying mechanism(s) in chronic unpredictable mild stress (CUMS) model have not been adequately addressed. This study was aimed to investigate the beneficial effects of etazolate on CUMS-induced behavioral deficits (depression- and anxiety-like behaviors). In addition, the possible underlying mechanism(s) of etazolate in CUMS model was also investigated by measuring serum corticosterone (CORT) and brain-derived neurotrophic factor (BDNF) levels. Mice were subjected to a battery of stressors for 28 days. Etazolate (0.5 and 1 mg/kg, p.o.) and fluoxetine (20mg/kg, p.o.) were administered during the last 21 days (8-28th) of the CUMS paradigm. The results showed that 4-weeks CUMS produces significant depression-like behavior in tail suspension test (TST) and partial anxiety-like behavior in elevated plus maze (EPM) and open field test (OFT). Stressed mice have also shown a significant high serum CORT and low BDNF level. Chronic treatment with etazolate (0.5 and 1mg/kg., p.o.) and fluoxetine (20mg/kg., p.o.) produced significant antidepressant-like behavior in TST (decreased duration of immobility), whereas, partial anxiolytic-like behavior in EPM (increased percentage of open arm entries) and OFT (increased % central ambulation score, total ambulation score and time spent in center zone). In addition, etazolate and fluoxetine treatment significantly (pBDNF level and inhibited the hypothalamic-pituitary-adrenocortical (HPA) axis hyperactivity, as evidenced by low serum CORT level in stressed mice. In addition, etazolate and fluoxetine also showed significant antidepressant- and anxiolytic-like effects in normal control mice. In this study no significant changes were observed in locomotor activity in actophotometer test. Moreover, we did not find any

Chronic Stress Contributes to Cognitive Dysfunction and Hippocampal Metabolic Abnormalities in APP/PS1 Mice

Directory of Open Access Journals (Sweden)

Bing Han

2017-03-01

Full Text Available Background/Aims: Stress response is determined by the brain, and the brain is a sensitive target for stress. Our previous experiments have confirmed that once the stress response is beyond the tolerable limit of the brain, particularly that of the hippocampus, it will have deleterious effects on hippocampal structure and function; however, the metabolic mechanisms for this are not well understood. Methods: Here, we used morris water maze, elisa and gas chromatography-time of flight/mass spectrometry to observe the changes in cognition, neuropathology and metabolomics in the hippocampus of APP/PS1 mice and wild-type (C57 mice caused by chronic unpredictable mild stress (CUMS, we also further explored the correlation between cognition and metabolomics. Results: We found that 4 weeks of CUMS aggravated cognitive impairment and increased amyloid-β deposition in APP/PS1 mice, but did not affect C57 mice. Under non-stress conditions, compared with C57 mice, there were 8 different metabolites in APP/PS1 mice. However, following CUMS, 3 different metabolites were changed compared with untreated C57 mice. Compared to APP/PS1 mice, there were 7 different metabolites in APP/PS1+CUMS mice. Among these alterations, 3-hydroxybutyric acid, valine, serine, beta-alanine and o-phosphorylethanolamine, which are involved in sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism. Conclusion: The results indicate that APP/PS1 mice are more vulnerable to stress than C57 mice, and the metabolic mechanisms of stress-related cognitive impairment in APP/PS1 mice are related to multiple pathways and networks, including sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism.

cAMP/PKA-CREB-BDNF signaling pathway in hippocampus mediates cyclooxygenase 2-induced learning/memory deficits of rats subjected to chronic unpredictable mild stress.

Science.gov (United States)

Luo, Ying; Kuang, Shengnan; Li, Huan; Ran, Dongzhi; Yang, Junqing

2017-05-30

To investigate the mechanism of cyclooxygenase 2 (COX2) in learning and memory impairments in rats subjected to chronic unpredictable mild stress (CUMS), meloxicam was used intragastrically to inhibit the activity of cyclooxygenase 2. Moreover, cyclooxygenase 2 over-expressing or RNA interfere lentivirus was injected intraventricularly to increase or decrease the enzyme's expression, respectively. The body weights and sucrose consumption were used to analyze depressive behaviors, while the Morris water maze and step-down-type passive avoidance tests were carried out to evaluate the learning-memory functions. The levels of inflammatory cytokines were measured to estimate inflammation and the contents of cyclic adenosine monophosphate (cAMP) were used to measure the levels of the second messenger. Changes in cyclooxygenase 2 mRNA levels were analyzed using reverse transcription polymerase chain reaction. Moreover, the expression of cyclooxygenase 2, brain-derived neurotrophic factor (BDNF), prostaglandins receptor 3 (EP3), protein kinase A (PKA), cAMP response element binding protein (CREB), and phosphorylated CREB were estimated using immunohistochemical staining or western blotting. The results showed that CUMS led to significant depressive-like behaviors and learning and memory dysfunctions. Also, the cAMP levels decreased significantly, while levels of inflammatory cytokines and prostaglandins E2 increased significantly. The expressions of PKA, BDNF, phosphorylated CREB/CREB declined and cyclooxygenase 2 was increased. Meloxicam and cyclooxygenase 2 RNA interfere lentivirus reversed the changes caused by CUMS while cyclooxygenase 2-overexpressing lentivirus worsened these abnormalities. The findings also showed that CUMS increased cyclooxygenase 2 expression, which can cause learning and memory impairments, mainly through activating the hippocampal neuronal cAMP/PKA-CREB-BDNF signaling pathways.

Elementary Thermal Operations

DEFF Research Database (Denmark)

Lostaglio, Matteo; Alhambra, Álvaro M.; Perry, Christopher

2018-01-01

To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes-Cummings in......To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes......-Cummings interaction in rotating wave approximation and draw a connection to standard descriptions of thermalisation. We then prove that elementary thermal operations present tighter constraints on the allowed transformations than thermal operations. Mathematically, this illustrates the failure at finite temperature...... to do so, including necessary and sufficient conditions for a given change of the population to be possible. As an example, we describe the resource theory of the Jaynes-Cummings model. Finally, we initiate an investigation into how our resource theories can be applied to Heat Bath Algorithmic Cooling...

Complex chemistry

International Nuclear Information System (INIS)

Kim, Bong Gon; Kim, Jae Sang; Kim, Jin Eun; Lee, Boo Yeon

2006-06-01

This book introduces complex chemistry with ten chapters, which include development of complex chemistry on history coordination theory and Warner's coordination theory and new development of complex chemistry, nomenclature on complex with conception and define, chemical formula on coordination compound, symbol of stereochemistry, stereo structure and isomerism, electron structure and bond theory on complex, structure of complex like NMR and XAFS, balance and reaction on solution, an organo-metallic chemistry, biology inorganic chemistry, material chemistry of complex, design of complex and calculation chemistry.

Cum grano salis - NAA of selected salts

International Nuclear Information System (INIS)

Steinhauser, G.; Sterba, J.H.; Poljanc, K.; Bichler, M.; Buchtela, K.

2006-01-01

The aim of this study was to investigate the trace element concentrations of salt samples from different regions, in particular Austria, Germany, Pakistan, Poland, Switzerland, and Ukraine. Investigated types of salt were Rock-, Sea-, Lake-, and Evaporated Salt. The main objective was to find out whether the consumption of salt can contribute significantly to the daily human requirements of trace elements. Therefore, trace element concentrations in the untreated samples were compared to those of specially treated samples, simulating digestive uptake using a simple model. Salt is a non-trivial matrix for Neutron Activation Analysis (NAA) because of very high background activities from 38 Cl and 24 Na, as well as the bremsstrahlung of 32 P (originating from 35 Cl(n,α) 32 P). Because of this fact, detection limits in salt are higher compared to other matrices. Nevertheless, several elements could be detected, namely Al, Ba, Br, (Ca), Ce, Cl, Co, Cr, Cs, Eu, Fe, Hf, La, Mn, Na, Rb, Sb, Sc, Sm, Sr, Ta, Tb, Th, and Zn, some of them only in single samples. In most samples the concentrations of trace elements in salt were too low to show biological effects. Salt can therefore only significantly contribute the essential elements sodium, chlorine, and, if added on purpose, fluorine and iodine to human nutrition. The contribution of all other traces in salt to the average daily human requirements can be neglected. Thus, from an analytical point of view, there is no health reason to use unpurified salt. There are, however, a few drawbacks to the use of unpurified salt, as hygroscopic compounds like MgCl 2 , and even toxic heavy metals like chromium or thorium. Especially rare earth element (REE) concentrations can often be used to obtain a chemical fingerprint, which can be used to identify the origin of an unknown sample. In the case of this study, the sample number from each region was too small to collect significant data. Therefore more analytical information is needed for a conclusive result in this respect. (author)

Thirteenth ISMAS symposium cum workshop on spectrometry

International Nuclear Information System (INIS)

Aggarwal, S.K.; Jaison, P.G.; Alamelu, D.

2008-01-01

Mass spectrometry is an important analytical tool and finds applications in almost all branches of science and technology like Physics, Chemistry, Biology, Material Science, Geology, Nuclear Science, Industry, Oceanography, Environment etc. Innovations in the designs of mass spectrometers coupled with new ionization techniques have further strengthened the capabilities of mass spectrometry for analyzing all types of molecules including thermally labile and non-volatile at concentrations down to femto gram levels. The applications of mass spectrometry to the biomedical sciences have provided a unique, easy and fast approach to genomics, proteomics and metabolomics. The availability of different types of mass spectrometers for inorganic elemental and isotopic composition determination have strengthened the role of mass spectrometry for analyzing all elements starting from hydrogen onwards. It is now possible to carry out speciation analysis using electrospray mass spectrometry. The individual conference papers in the proceedings covers fundamentals of mass spectrometry, qualitative and quantitative aspects and data interpretation, maintenance of mass spectrometers, selection of mass spectrometer, and recent advances in the field. Papers relevant to INIS are indexed separately

Solutions of two-mode Jaynes–Cummings models

Indian Academy of Sciences (India)

variety of problems [2–8] in quantum optics and it predicts many new features in the limit of strong coupling g of the ... mation in quantum mechanics by Sudha Singh and Roy [19,20] can be conveniently used to obtain the ... operators for modes 1 and 2, ˆσii = |i〉〈i| are the level occupation number and. ˆσij = |i〉〈j|(i = j) are the ...

SOCIO CUM LINGUISTIC INTERPLAY IN LANGUAGE CHOICE ...

African Journals Online (AJOL)

Sir George

2016-06-02

Jun 2, 2016 ... learn to speak a language by force, or refuse to speak it. This is a ... circumstances such as the effects of linguistic deprivation, how bilingual children can learn ..... the other; the effects of books, movies and so on. Out.

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Keywords. cytosine methylation; DNA methylation mechanisms; DNA demethylation mechanisms; Darwinian-cum-Lamarckian evolution; epialleles; epigenetic modifications; genetic recombination; heritable induced defence; mutational hotspots; transgenerational inheritance.

Contribution of population growth to per capita income and sectoral output growth in Japan, 1880-1970.

Science.gov (United States)

Yamaguchi, M; Kennedy, G

1984-09-01

The authors measured the positive and negative contributions of population and labor force growth to the growth of per capita income and sectoral output in Japan in the 1880-1970 period. A 2-sector growth accounting model that treats population and labor growth as separate variables was used. 3 alternative methods were used: the Residual method, the Verdoorn method, and the factor augmenting rate method. The total contribution of population cum labor growth to per capita income growth tended to be negative in the 1880-1930 period and positive in the 1930-40 and 1950-70. Over the 1880-1970 period as a whole, population cum labor growth made a positive contribution to per capita income growth under the Residual method (0.35%/year), the factor augmenting rate method (0.29%/year), and the Verdoorn method (0.01%/year). In addition, population cum labor growth contributed positively to sectoral output growth. The average contribution to agricultural output growth ranged from 1.03% (Verdoorn) - 1.46%/year (factor augmenting rate), while the average contribution to nonagricultural output growth ranged from 1.22% (Verdoorn) - 1.60%/year (Residual). Although these results are dependent on the model used, the fact that all 3 methods yielded consistent results suggests that population cum labor growth did make a positive contribution to per capita income and sectoral output growth in Japan. These findings imply that in economies where the rate of technical change in agricultural and nonagricultural sectors exceeds population growth, policies that reduce agricultural elasticities may be preferable; on the other hand, policies that reduce agricultural elasticities are to be avoided in economies with low rates of technical change. Moreover, in the early stages of economic development, policies that increase agricultural income and price elasticities should be considered.

Environ: E00477 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available E00477 Lysimachia foenum-graecum herb Lysimachiae herba Crude drug ... Lysimachia foenum-grae...cum [TAX:213265] ... Primulaceae (primrose family) Lysimachia foenum-graecum herb (dried) ...

The Effects of High-fat-diet Combined with Chronic Unpredictable Mild Stress on Depression-like Behavior and Leptin/LepRb in Male Rats.

Science.gov (United States)

Yang, Jin Ling; Liu, De Xiang; Jiang, Hong; Pan, Fang; Ho, Cyrus Sh; Ho, Roger Cm

2016-10-14

Leptin plays a key role in the pathogenesis of obesity and depression via the long form of leptin receptor (LepRb). An animal model of comorbid obesity and depression induced by high-fat diet (HFD) combined with chronic unpredictable mild stress (CUMS) was developed to study the relationship between depression/anxiety-like behavior, levels of plasma leptin and LepRb in the brains between four groups of rats, the combined obesity and CUMS (Co) group, the obese (Ob) group, the CUMS group and controls. Our results revealed that the Co group exhibited most severe depression-like behavior in the open field test (OFT), anxiety-like behavior in elevated plus maze test (EMT) and cognitive impairment in the Morris water maze (MWM). The Ob group had the highest weight and plasma leptin levels while the Co group had the lowest levels of protein of LepRb in the hypothalamus and hippocampus. Furthermore, depressive and anxiety-like behaviors as well as cognitive impairment were positively correlated with levels of LepRb protein and mRNA in the hippocampus and hypothalamus. The down-regulation of leptin/LepRb signaling might be associated with depressive-like behavior and cognitive impairment in obese rats facing chronic mild stress.

Re-Os systematics of komatiites and komatiitic basalts at Dundonald Beach, Ontario, Canada: Evidence for a complex alteration history and implications of a late-Archean chondritic mantle source

Science.gov (United States)

Gangopadhyay, Amitava; Sproule, Rebecca A.; Walker, Richard J.; Lesher, C. Michael

2005-11-01

Osmium isotopic compositions, and Re and Os concentrations have been examined in one komatiite unit and two komatiitic basalt units at Dundonald Beach, part of the 2.7 Ga Kidd-Munro volcanic assemblage in the Abitibi greenstone belt, Ontario, Canada. The komatiitic rocks in this locality record at least three episodes of alteration of Re-Os elemental and isotope systematics. First, an average of 40% and as much as 75% Re may have been lost due to shallow degassing during eruption and/or hydrothermal leaching during or immediately after emplacement. Second, the Re-Os isotope systematics of whole rock samples with 187Re/ 188Os ratios >1 were reset at ˜2.5 Ga, possibly due to a regional metamorphic event. Third, there is evidence for relatively recent gain and loss of Re in some rocks. Despite the open-system behavior, some aspects of the Re-Os systematics of these rocks can be deciphered. The bulk distribution coefficient for Os (D Ossolid/liquid) for the Dundonald rocks is ˜3 ± 1 and is well within the estimated D values obtained for komatiites from the nearby Alexo area and stratigraphically-equivalent komatiites from Munro Township. This suggests that Os was moderately compatible during crystal-liquid fractionation of the magmas parental to the Kidd-Munro komatiitic rocks. Whole-rock samples and chromite separates with low 187Re/ 188Os ratios (Gorgona Island, arc-related rocks and present-day ocean island basalts. This suggests that the Kidd-Munro komatiites sampled a late-Archean mantle source region that was significantly more homogeneous with respect to Re/Os relative to most modern mantle-derived rocks.

Chronic stress induced cognitive impairment in APP/PS-1 double transgenic mouse model of Alzheimer's disease

Directory of Open Access Journals (Sweden)

Bing HAN

2015-08-01

Full Text Available Objective  To observe the effect of chronic unpredictable mild stress (CUMS on the cognitive function and brain morphological changes in APP/PS-1 mice, one of the genetic mouse models of Alzheimer's disease (AD, and to investigate the possible role of environmental factors in genetic mouse model of AD. Methods  There were 22-week-old wild-type C57BL/6 male mice (control group, N = 15 and APP/PS-1 double transgenic male mice [N = 27: AD group (N = 13 and AD + CUMS group (N = 14] tested in this study. Morris water maze test was used to evaluate spatial learning and memory of the mice. Amyloid deposition in the hippocampus was determined by Congo red staining. The ultrastructure of neurons in hippocampal CA1 region was observed by transmission electron microscope (TEM.  Results  Compared with control group, AD + CUMS group had significantly longer fifth-day escape latency [(33.14 ± 14.37 s vs (21.22 ± 12.16 s; t = -2.701, P = 0.045], and significantly shortened time spent in platform quadrant [(9.74±1.35 s vs (15.02 ± 1.33 s; t = 2.639, P = 0.012] in Morris water maze test. Compared with AD group, the percentage of amyloid plaque area in hippocampal area was increased in AD + CUMS group [(0.59 ± 0.03% vs (0.04 ± 0.03%; t = -2.900, P = 0.005]. The ultrastructure of hippocampal neurons in AD group was slightly damaged: cellular membrane was intact; cell matrix was uniform; intracelluar lipofuscin could be seen; the structure of nucleus and nuclear membrane had no obvious changes; mild fusion of cristae and membrane was seen in mitochondria; Golgi apparatus was partially indistinct; endoplasmic reticulum was mildly expanded. The ultrastructure of hippocampal neurons in AD + CUMS group was obviously damaged, including blurred cell membrane, reduced low-density and high-density granules in cytoplasm, uneven cell matrix, reduced number of organelles, lipofuscin and autophagosome deposition, obvious condensation of chromatin distributing over

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cum USDA ... 110] ... Length = 121 ... Query: 179 FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLE...TTAIIGVARELGA 238 ... FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLETTAII...GVARELGA Sbjct: 1 ... FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLETTAIIGVARELGA 60 ... Query: 299 R 299 ... R Sbjct: 121 R 121

ComplexViewer: visualization of curated macromolecular complexes.

Science.gov (United States)

Combe, Colin W; Sivade, Marine Dumousseau; Hermjakob, Henning; Heimbach, Joshua; Meldal, Birgit H M; Micklem, Gos; Orchard, Sandra; Rappsilber, Juri

2017-11-15

Proteins frequently function as parts of complexes, assemblages of multiple proteins and other biomolecules, yet network visualizations usually only show proteins as parts of binary interactions. ComplexViewer visualizes interactions with more than two participants and thereby avoids the need to first expand these into multiple binary interactions. Furthermore, if binding regions between molecules are known then these can be displayed in the context of the larger complex. freely available under Apache version 2 license; EMBL-EBI Complex Portal: http://www.ebi.ac.uk/complexportal; Source code: https://github.com/MICommunity/ComplexViewer; Package: https://www.npmjs.com/package/complexviewer; http://biojs.io/d/complexviewer. Language: JavaScript; Web technology: Scalable Vector Graphics; Libraries: D3.js. colin.combe@ed.ac.uk or juri.rappsilber@ed.ac.uk. © The Author 2017. Published by Oxford University Press.

Sámuel Gyarmathi "Affinitas" 200-aastane : Vinnugor Világ, 1999, nr 4 / Gábor Zaicz ; refereerinud Kadi Raudalainen

Index Scriptorium Estoniae

Zaicz, Gábor

2000-01-01

Ungari arstiteadlase Sámuel Gyamathi ladinakeelsest uurimusest "Affinitas linguae Hungaricae cum linguis Fennicae originis grammaticae demonstrata" ("Grammatiline tõestus ungari keele ja soome päritolu keelte suguluse kohta")

Synchronization in node of complex networks consist of complex chaotic system

Energy Technology Data Exchange (ETDEWEB)

Wei, Qiang, E-mail: qiangweibeihua@163.com [Beihua University computer and technology College, BeiHua University, Jilin, 132021, Jilin (China); Digital Images Processing Institute of Beihua University, BeiHua University, Jilin, 132011, Jilin (China); Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian, 116024 (China); Xie, Cheng-jun [Beihua University computer and technology College, BeiHua University, Jilin, 132021, Jilin (China); Digital Images Processing Institute of Beihua University, BeiHua University, Jilin, 132011, Jilin (China); Liu, Hong-jun [School of Information Engineering, Weifang Vocational College, Weifang, 261041 (China); Li, Yan-hui [The Library, Weifang Vocational College, Weifang, 261041 (China)

2014-07-15

A new synchronization method is investigated for node of complex networks consists of complex chaotic system. When complex networks realize synchronization, different component of complex state variable synchronize up to different scaling complex function by a designed complex feedback controller. This paper change synchronization scaling function from real field to complex field for synchronization in node of complex networks with complex chaotic system. Synchronization in constant delay and time-varying coupling delay complex networks are investigated, respectively. Numerical simulations are provided to show the effectiveness of the proposed method.

Research Article Special Issue

African Journals Online (AJOL)

pc

2018-03-07

Mar 7, 2018 ... imbalance, polysaccharide changes, infection and allergy as factors implicated in its development. [6]. ..... World Health Organization to use traditional medicine of different countries and its integration ... Cummings.

Plaadid / Mirjam Tally

Index Scriptorium Estoniae

Tally, Mirjam, 1976-

2003-01-01

Uutest plaatidest "Mirjam Tally", Jennifer Love Hewitt "Barenaked", Sam "Being Under The Influence", Slade "Cum On Let's Party", The Dandy Warhols "Welcome To The Monkey House", Audio Bullys "Ego War"

La Mystagogie de Saint Maxime le Confesseur

Directory of Open Access Journals (Sweden)

Florin Crismareanu

2011-12-01

Full Text Available Review of: Maximi Confessoris, Mystagogia: una cum Latina interpretatione Anastasii Bibliothecarii, edita a Christian Boudignon, Turnhout: Brepols, Corpus Christianorum. Series Graeca, nr. 69, 2011, 187 + 99 p.

Monte Carlo simulation methods in moment-based scale-bridging algorithms for thermal radiative-transfer problems

Energy Technology Data Exchange (ETDEWEB)

Densmore, J.D., E-mail: jeffery.densmore@unnpp.gov [Bettis Atomic Power Laboratory, P.O. Box 79, West Mifflin, PA 15122 (United States); Park, H., E-mail: hkpark@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States); Wollaber, A.B., E-mail: wollaber@lanl.gov [Computational Physics and Methods Group, Los Alamos National Laboratory, P.O. Box 1663, MS D409, Los Alamos, NM 87545 (United States); Rauenzahn, R.M., E-mail: rick@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States); Knoll, D.A., E-mail: nol@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States)

2015-03-01

We present a moment-based acceleration algorithm applied to Monte Carlo simulation of thermal radiative-transfer problems. Our acceleration algorithm employs a continuum system of moments to accelerate convergence of stiff absorption–emission physics. The combination of energy-conserving tallies and the use of an asymptotic approximation in optically thick regions remedy the difficulties of local energy conservation and mitigation of statistical noise in such regions. We demonstrate the efficiency and accuracy of the developed method. We also compare directly to the standard linearization-based method of Fleck and Cummings [1]. A factor of 40 reduction in total computational time is achieved with the new algorithm for an equivalent (or more accurate) solution as compared with the Fleck–Cummings algorithm.

Monte Carlo simulation methods in moment-based scale-bridging algorithms for thermal radiative-transfer problems

International Nuclear Information System (INIS)

Densmore, J.D.; Park, H.; Wollaber, A.B.; Rauenzahn, R.M.; Knoll, D.A.

2015-01-01

We present a moment-based acceleration algorithm applied to Monte Carlo simulation of thermal radiative-transfer problems. Our acceleration algorithm employs a continuum system of moments to accelerate convergence of stiff absorption–emission physics. The combination of energy-conserving tallies and the use of an asymptotic approximation in optically thick regions remedy the difficulties of local energy conservation and mitigation of statistical noise in such regions. We demonstrate the efficiency and accuracy of the developed method. We also compare directly to the standard linearization-based method of Fleck and Cummings [1]. A factor of 40 reduction in total computational time is achieved with the new algorithm for an equivalent (or more accurate) solution as compared with the Fleck–Cummings algorithm

Generalized Combination Complex Synchronization for Fractional-Order Chaotic Complex Systems

Directory of Open Access Journals (Sweden)

Cuimei Jiang

2015-07-01

Full Text Available Based on two fractional-order chaotic complex drive systems and one fractional-order chaotic complex response system with different dimensions, we propose generalized combination complex synchronization. In this new synchronization scheme, there are two complex scaling matrices that are non-square matrices. On the basis of the stability theory of fractional-order linear systems, we design a general controller via active control. Additionally, by virtue of two complex scaling matrices, generalized combination complex synchronization between fractional-order chaotic complex systems and real systems is investigated. Finally, three typical examples are given to demonstrate the effectiveness and feasibility of the schemes.

Complexity explained

CERN Document Server

Erdi, Peter

2008-01-01

This book explains why complex systems research is important in understanding the structure, function and dynamics of complex natural and social phenomena. Readers will learn the basic concepts and methods of complex system research.

On Measuring the Complexity of Networks: Kolmogorov Complexity versus Entropy

Directory of Open Access Journals (Sweden)

Mikołaj Morzy

2017-01-01

Full Text Available One of the most popular methods of estimating the complexity of networks is to measure the entropy of network invariants, such as adjacency matrices or degree sequences. Unfortunately, entropy and all entropy-based information-theoretic measures have several vulnerabilities. These measures neither are independent of a particular representation of the network nor can capture the properties of the generative process, which produces the network. Instead, we advocate the use of the algorithmic entropy as the basis for complexity definition for networks. Algorithmic entropy (also known as Kolmogorov complexity or K-complexity for short evaluates the complexity of the description required for a lossless recreation of the network. This measure is not affected by a particular choice of network features and it does not depend on the method of network representation. We perform experiments on Shannon entropy and K-complexity for gradually evolving networks. The results of these experiments point to K-complexity as the more robust and reliable measure of network complexity. The original contribution of the paper includes the introduction of several new entropy-deceiving networks and the empirical comparison of entropy and K-complexity as fundamental quantities for constructing complexity measures for networks.

Complex dynamical invariants for two-dimensional complex potentials

Indian Academy of Sciences (India)

Abstract. Complex dynamical invariants are searched out for two-dimensional complex poten- tials using rationalization method within the framework of an extended complex phase space characterized by x = x1 + ip3, y = x2 + ip4, px = p1 + ix3, py = p2 + ix4. It is found that the cubic oscillator and shifted harmonic oscillator ...

Complex Fuzzy Set-Valued Complex Fuzzy Measures and Their Properties

Science.gov (United States)

Ma, Shengquan; Li, Shenggang

2014-01-01

Let F*(K) be the set of all fuzzy complex numbers. In this paper some classical and measure-theoretical notions are extended to the case of complex fuzzy sets. They are fuzzy complex number-valued distance on F*(K), fuzzy complex number-valued measure on F*(K), and some related notions, such as null-additivity, pseudo-null-additivity, null-subtraction, pseudo-null-subtraction, autocontionuous from above, autocontionuous from below, and autocontinuity of the defined fuzzy complex number-valued measures. Properties of fuzzy complex number-valued measures are studied in detail. PMID:25093202

The complex portal--an encyclopaedia of macromolecular complexes.

Science.gov (United States)

Meldal, Birgit H M; Forner-Martinez, Oscar; Costanzo, Maria C; Dana, Jose; Demeter, Janos; Dumousseau, Marine; Dwight, Selina S; Gaulton, Anna; Licata, Luana; Melidoni, Anna N; Ricard-Blum, Sylvie; Roechert, Bernd; Skyzypek, Marek S; Tiwari, Manu; Velankar, Sameer; Wong, Edith D; Hermjakob, Henning; Orchard, Sandra

2015-01-01

The IntAct molecular interaction database has created a new, free, open-source, manually curated resource, the Complex Portal (www.ebi.ac.uk/intact/complex), through which protein complexes from major model organisms are being collated and made available for search, viewing and download. It has been built in close collaboration with other bioinformatics services and populated with data from ChEMBL, MatrixDB, PDBe, Reactome and UniProtKB. Each entry contains information about the participating molecules (including small molecules and nucleic acids), their stoichiometry, topology and structural assembly. Complexes are annotated with details about their function, properties and complex-specific Gene Ontology (GO) terms. Consistent nomenclature is used throughout the resource with systematic names, recommended names and a list of synonyms all provided. The use of the Evidence Code Ontology allows us to indicate for which entries direct experimental evidence is available or if the complex has been inferred based on homology or orthology. The data are searchable using standard identifiers, such as UniProt, ChEBI and GO IDs, protein, gene and complex names or synonyms. This reference resource will be maintained and grow to encompass an increasing number of organisms. Input from groups and individuals with specific areas of expertise is welcome. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

Complexity Plots

KAUST Repository

Thiyagalingam, Jeyarajan

2013-06-01

In this paper, we present a novel visualization technique for assisting the observation and analysis of algorithmic complexity. In comparison with conventional line graphs, this new technique is not sensitive to the units of measurement, allowing multivariate data series of different physical qualities (e.g., time, space and energy) to be juxtaposed together conveniently and consistently. It supports multivariate visualization as well as uncertainty visualization. It enables users to focus on algorithm categorization by complexity classes, while reducing visual impact caused by constants and algorithmic components that are insignificant to complexity analysis. It provides an effective means for observing the algorithmic complexity of programs with a mixture of algorithms and black-box software through visualization. Through two case studies, we demonstrate the effectiveness of complexity plots in complexity analysis in research, education and application. © 2013 The Author(s) Computer Graphics Forum © 2013 The Eurographics Association and Blackwell Publishing Ltd.

Xiao Yao San Improves Depressive-Like Behavior in Rats through Modulation of β-Arrestin 2-Mediated Pathways in Hippocampus

Directory of Open Access Journals (Sweden)

Xiaoxia Zhu

2014-01-01

Full Text Available Xiao Yao San (XYS is a classical Chinese medicine formula that has been widely used to treat mood disorders for hundreds of years. To confirm the effect of XYS and better understand its underlying mechanism, high-performance liquid chromatography-mass spectrometry analysis-based quality control of XYS extracts and proteomics-based identification of differential proteins in the hippocampus were adopted in social isolation and chronic unpredictable mild stress- (CUMS- treated rats. The depressive-like behavior of rats induced by CUMS resembled the manifestation of human depression. The upregulated corticosterone (CORT and urocortin 2 (UCN2 levels demonstrated the existence of hypothalamic-pituitary-adrenal (HPA axis hyperactivity. XYS was effective in ameliorating the depressive-like behavior and downregulating UCN2 and CORT. XYS decreased the expression of serine/threonine-protein phosphatase 2A subunit B and increased the expression of β-arrestin 2. The expressions of brain-derived neurotrophic factor (BDNF, tyrosine receptor kinase B (TrkB, and mammalian target of rapamycin (mTOR were also elevated by XYS. In conclusion, XYS improves social isolation and CUMS-induced depressive-like behavior and ameliorates HPA hyperactivation through the downregulation of corticotrophin releasing hormone (CRH receptor 2. The upregulation of BDNF/TrkB and the phosphorylation of mTOR require β-arrestin 2 as a scaffold to regulate stress signaling.

Deciphering the Differential Effective and Toxic Responses of Bupleuri Radix following the Induction of Chronic Unpredictable Mild Stress and in Healthy Rats Based on Serum Metabolic Profiles

Directory of Open Access Journals (Sweden)

Xiaoxia Gao

2018-01-01

Full Text Available The petroleum ether fraction of Bupleuri Radix which is contained in the traditional Chinese medicine prescription of Xiaoyaosan (XYS may have a therapeutic effect in depressed subjects based on the results of our previous study. It has been reported that Bupleuri Radix can cause liver toxicity following overdosing or long-term use. Therefore, this study aimed to decipher the differential effective and toxic responses of Bupleuri Radix in chronic unpredictable mild stress (CUMS (with depression and healthy rats based on serum metabolic profiles. Serum metabolic profiles were obtained using the UHPLC- Q Exactive Orbitrap-MS technique. Our results demonstrated that the petroleum ether fraction of Bupleuri Radix (PBR produces an antidepressant effect through regulating glycometabolism, amino acid metabolism, sphingolipid metabolism, glycerophospholipid metabolism, and fatty acid metabolism. It also induces more severe toxic reactions in the liver or kidney in healthy rats than in CUMS rats, which exhibited a comparatively mild drug-induced toxic reaction. The altered lysine degradation, sphingolipid metabolism, glycerophospholipid metabolism, fatty acid metabolism, and bile acid metabolism could be at least partly responsible for the PBR toxic responses in healthy rats. The differential effective and toxic response of PBR in CUMS rats and healthy rats provide a new standard for the more rational and safer application of clinical drugs in the future.

Quantitative Study of Biogas Generation Potential from Different Landfill Sites of Nepal

Directory of Open Access Journals (Sweden)

Bikash Adhikari

2015-01-01

Full Text Available This research paper was study of waste composition and quantitative analysis of biogas generation potential with its recovery at Sisdole, Pokhara and Karaute Dada landfill sites (LFS of Nepal. The waste management practice in LFS are significant deciding factors for the assessment of environmental impacts caused including the release of green house gases like methane, carbondioxide etc to the atmosphere, that could contribute significantly to global warming and climate change. The total waste disposed to Sisdole LFS, Pokhara LFS and Karaute Dada LFS are 410, 80 and 7.8 tons respectively.  The waste composition was studied onsite with waste reduction method and analyzed for their composition. The organic component of wastes was found high as 61.6%, 52.5% and 65% at Sisdole, Pokhara and Karaute Dada LFS respectively. The biogas potential at these landfill sites were 12157.78 cum, 851.99 cum and 169 cum of biogas per day in Sisdole, Pokhara and Karaute Dada LFS respectively. 4.68, 0.33 and 0.07 MW energy per day can be generated from these amounts of biogas produced in Sisdole, Pokhara and Karaute Dada LFS respectively. Proper gas collection system can be the source of income from these landfill sites and help to mitigate the adverse impact of methane that is being released from these landfill sites

Agmatine attenuates chronic unpredictable mild stress induced behavioral alteration in mice.

Science.gov (United States)

Taksande, Brijesh G; Faldu, Dharmesh S; Dixit, Madhura P; Sakaria, Jay N; Aglawe, Manish M; Umekar, Milind J; Kotagale, Nandkishor R

2013-11-15

Chronic stress exposure and resulting dysregulation of the hypothalamic pituitary adrenal axis develops susceptibility to variety of neurological and psychiatric disorders. Agmatine, a putative neurotransmitter has been reported to be released in response to various stressful stimuli to maintain the homeostasis. Present study investigated the role of agmatine on chronic unpredictable mild stress (CUMS) induced behavioral and biochemical alteration in mice. Exposure of mice to CUMS protocol for 28 days resulted in diminished performance in sucrose preference test, splash test, forced swim test and marked elevation in plasma corticosterone levels. Chronic agmatine (5 and 10 mg/kg, ip, once daily) treatment started on day-15 and continued till the end of the CUMS protocol significantly increased sucrose preference, improved self-care and motivational behavior in the splash test and decreased duration of immobility in the forced swim test. Agmatine treatment also normalized the elevated corticosterone levels and prevented the body weight changes in chronically stressed animals. The pharmacological effect of agmatine was comparable to selective serotonin reuptake inhibitor, fluoxetine (10mg/kg, ip). Results of present study clearly demonstrated the anti-depressant like effect of agmatine in chronic unpredictable mild stress induced depression in mice. Thus the development of drugs based on brain agmatinergic modulation may represent a new potential approach for the treatment of stress related mood disorders like depression. © 2013 Published by Elsevier B.V.

Metabolomic Profiling of Post-Mortem Brain Reveals Changes in Amino Acid and Glucose Metabolism in Mental Illness Compared with Controls

Directory of Open Access Journals (Sweden)

Rong Zhang

2016-01-01

Full Text Available Metabolomic profiling was carried out on 53 post-mortem brain samples from subjects diagnosed with schizophrenia, depression, bipolar disorder (SDB, diabetes, and controls. Chromatography on a ZICpHILIC column was used with detection by Orbitrap mass spectrometry. Data extraction was carried out with m/z Mine 2.14 with metabolite searching against an in-house database. There was no clear discrimination between the controls and the SDB samples on the basis of a principal components analysis (PCA model of 755 identified or putatively identified metabolites. Orthogonal partial least square discriminant analysis (OPLSDA produced clear separation between 17 of the controls and 19 of the SDB samples (R2CUM 0.976, Q2 0.671, p-value of the cross-validated ANOVA score 0.0024. The most important metabolites producing discrimination were the lipophilic amino acids leucine/isoleucine, proline, methionine, phenylalanine, and tyrosine; the neurotransmitters GABA and NAAG and sugar metabolites sorbitol, gluconic acid, xylitol, ribitol, arabinotol, and erythritol. Eight samples from diabetic brains were analysed, six of which grouped with the SDB samples without compromising the model (R2 CUM 0.850, Q2 CUM 0.534, p-value for cross-validated ANOVA score 0.00087. There appears on the basis of this small sample set to be some commonality between metabolic perturbations resulting from diabetes and from SDB.

Complex differential geometry

CERN Document Server

Zheng, Fangyang

2002-01-01

The theory of complex manifolds overlaps with several branches of mathematics, including differential geometry, algebraic geometry, several complex variables, global analysis, topology, algebraic number theory, and mathematical physics. Complex manifolds provide a rich class of geometric objects, for example the (common) zero locus of any generic set of complex polynomials is always a complex manifold. Yet complex manifolds behave differently than generic smooth manifolds; they are more coherent and fragile. The rich yet restrictive character of complex manifolds makes them a special and interesting object of study. This book is a self-contained graduate textbook that discusses the differential geometric aspects of complex manifolds. The first part contains standard materials from general topology, differentiable manifolds, and basic Riemannian geometry. The second part discusses complex manifolds and analytic varieties, sheaves and holomorphic vector bundles, and gives a brief account of the surface classifi...

Double trisomy with 48, XXX+21 karyotype in a Down's syndrome ...

Indian Academy of Sciences (India)

Author Affiliations. Wahied Khawar Balwan1 Parvinder Kumar1 T. R. Raina1 Subash Gupta1. Human Genetic Research cum Counselling Centre, University of Jammu, Government Medical College, Jammu 180 006, India ...

Surfactant-assisted sacrificial template-mediated synthesis ...

Indian Academy of Sciences (India)

Heena Khajuria

Lanthanide ion based nanomaterials have gained much attention due to their ... A number of studies on the synthesis .... cum Steady State Luminescence Spectrometer, Edinburgh ..... and their application in lithium-ion batteries Adv. Mater.

Ramon Rask võitleb põhimõtte pärast / Marian Männi

Index Scriptorium Estoniae

Männi, Marian

2007-01-01

Portreelugu Tartu Ülikooli õigusteaduskonna cum laude lõpetanud Ramon Raskist, tema kohtuvõitlusest ülikooliga; professionaalse tasuta õigusabi võimalustest tudengitele Paul Varuli advokaadibüroo poolt Eesti Üliõpilasliidu juures

(II) complexes

African Journals Online (AJOL)

activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

Local Community Perceptions of Mine Site Restoration Using Phytoremediation in Abitibi-Temiscamingue (Quebec).

Science.gov (United States)

Vodouhe, Fifanou G; Khasa, Damase P

2015-01-01

This work explores factors supporting people perception about mine site restoration and phytoremediation. Phytoremediation is one of the most eco-friendly restoration strategy emerged since the last two decades but studies on local people perception on this restoration strategy are scarce. To fill in this gap, data were collected from mining stakeholders using a structured questionnaire administered through snowball sampling method. We used Multiple Correspondence Analysis as implemented in the software XLSTAT to visualize relationship between participants' characteristics, their view on mine site restoration and phytoremediation. Results clearly show out that people perception on mine site restoration is influenced by mining activities effects on health and region attractiveness. Phytoremediation (65.21%) was rated positively with regard to its environment potential, aesthetic and consideration for future generation followed by fillings and excavating. Restoration strategy costs have no effect on people choice and participants prefer use of shrubs as vegetation component of phytoremediation to reach their restoration objective.

Resveratrol ameliorates chronic unpredictable mild stress-induced depression-like behavior: involvement of the HPA axis, inflammatory markers, BDNF, and Wnt/β-catenin pathway in rats.

Science.gov (United States)

Yang, Xin-Hua; Song, Su-Qi; Xu, Yun

2017-01-01

Classic antidepressant drugs are modestly effective across the population and most are associated with intolerable side effects. Recently, numerous lines of evidence suggest that resveratrol (RES), a natural polyphenol, possesses beneficial therapeutic activity for depression. The aim of the present study was to explore whether RES exhibits an antidepressant-like effect in a depression model and to explore the possible mechanism. A depression model was established via chronic unpredictable mild stress (CUMS), after which the model rats in the RES and fluoxetine groups received a daily injection of RES or fluoxetine, respectively. The sucrose preference test, open field test, and forced swimming test were used to explore the antidepressant-like effects of RES. The activity of the hypothalamic-pituitary-adrenal (HPA) axis was evaluated by detecting the plasma corticosterone concentration and hypothalamic mRNA expression of corticotrophin-releasing hormone. The plasma interleukin-6 (IL-6), C-reactive protein (CRP), and tumor necrosis factor-α (TNF-α) concentrations were measured by enzyme-linked immunosorbent assay. Hippocampal protein expression of brain-derived neurotrophic factor (BDNF) and the Wnt/β-catenin pathway were analyzed by western blot. The results showed that RES relieved depression-like behavior of CUMS rats, as indicated by the increased sucrose preference and the decreased immobile time. Rats that received RES treatment exhibited reduced plasma corticosterone levels and corticotrophin-releasing hormone mRNA expression in the hypothalamus, suggesting that the hyperactivity of the HPA axis in CUMS rats was reversed by RES. Moreover, after RES treatment, the rats exhibited increased plasma IL-6, CRP, and TNF-α concentrations. Furthermore, RES treatment upregulated the hippocampal protein levels of BDNF and the relative ratio of p-β-catenin/β-catenin while downregulating the relative ratio of p-GSK-3β/GSK-3β. Our findings suggest that RES improved

Antidepressant-like effect of essential oil of Perilla frutescens in a chronic, unpredictable, mild stress-induced depression model mice.

Science.gov (United States)

Ji, Wei-Wei; Li, Rui-Peng; Li, Meng; Wang, Shu-Yuan; Zhang, Xian; Niu, Xing-Xing; Li, Wei; Yan, Lu; Wang, Yang; Fu, Qiang; Ma, Shi-Ping

2014-10-01

Perilla frutescens (Perilla leaf), a garnishing vegetable in East Asian countries, as well as a plant-based medicine, has been used for centuries to treat various conditions, including depression. Several studies have demonstrated that the essential oil of P. frutescens (EOPF) attenuated the depressive-like behavior in mice. The present study was designed to test the anti-depressant effects of EOPF and the possible mechanisms in an chronic, unpredictable, mild stress (CUMS)-induced mouse model. With the exposure to stressor once daily for five consecutive weeks, EOPF (3, 6, and 9 mg·kg(-1)) and a positive control drug fluoxetine (20 mg·kg(-1)) were administered through gastric intubation to mice once daily for three consecutive weeks from the 3(rd) week. Open-field test, sucrose consumption test, tail suspension test (TST), and forced swimming test (FST) were used to evaluate the behavioral activity. The contents of 5-hydroxytryptamine (5-HT) and its metabolite, 5-hydroxyindoleacetic acid (5-HIAA), in mouse hippocampus were determined by HPLC-ECD. Serum interleukin (IL)-1, IL-6, and tumor necrosis factor (TNF)-α levels were evaluated by enzyme-linked immunosorbent assay (ELISA). The results showed that CUMS significantly decreased the levels of 5-HT and 5-HIAA in the hippocampus, with an increase in plasma IL-6, IL-1β, and TNF-α levels. CUMS also reduced open-field activity, sucrose consumption, as well as increased immobility duration in FST and TST. EOPF administration could effectively reverse the alterations in the concentrations of 5-HT and 5-HIAA; reduce the IL-6, IL-1β, and TNF-α levels. Moreover, EOPF could effectively reverse alterations in immobility duration, sucrose consumption, and open-field activity. However, the effect was not dose-dependent. In conclusion, EOPF administration exhibited significant antidepressant-like effects in mice with CUMS-induced depression. The antidepressant activity of EOPF might be related to the relation between

Elemental characterization of New Year's Day PM10 and PM2.2 particulates matter at several sites in Metro Manila

International Nuclear Information System (INIS)

Santos, Flora L.; Pabroa, Preciosa Corazon B.; Morco, Ryan P.; Racho, Joseph Michael D.

2007-01-01

In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project P articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques . Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the air

Workshop on Recommendation in Complex Scenarios (ComplexRec 2017)

DEFF Research Database (Denmark)

Bogers, Toine; Koolen, Marijn; Mobasher, Bamshad

2017-01-01

Recommendation algorithms for ratings prediction and item ranking have steadily matured during the past decade. However, these state-of-the-art algorithms are typically applied in relatively straightforward scenarios. In reality, recommendation is often a more complex problem: it is usually just...... a single step in the user's more complex background need. These background needs can often place a variety of constraints on which recommendations are interesting to the user and when they are appropriate. However, relatively little research has been done on these complex recommendation scenarios....... The ComplexRec 2017 workshop addressed this by providing an interactive venue for discussing approaches to recommendation in complex scenarios that have no simple one-size-fits-all-solution....

When apparent schizophrenia is excluded

African Journals Online (AJOL)

Subsequently, the MRI in May 2010 showed only nonspecific changes. Finally, in July ... Town to instruct the development of the predictive .... Cummings JL. ... World Health Organization, and Global Health Observatory Data Repository. Global ...

The Orchestra as a Laboratory

DEFF Research Database (Denmark)

Paunova, Minna; Velikova, Silviya Svejenova

with learning in these and other organizations. Zooming in on a critical case of a performance arts’ organization–an orchestra-cum-laboratory–our study seeks to advance understanding of generative forms of organizing for individual and organizational learning and creativity. Unlike traditional orchestras...... for which performance is an end and rehearsing a means, for the orchestra-cum-laboratory rehearsing is an end in itself, satisfying musicians’ drives to learn and create. We are interested to advance understanding of why and how a creative collective operates as a learning-driven performance arts......Orchestras and other performing arts organizations exist to deliver superior performance of artistic and cultural works. While performing arts organizations often serve as analytical templates to understand collective learning, creativity, and innovation, performance is not always concerted...

Dynamic complexity: plant receptor complexes at the plasma membrane.

Science.gov (United States)

Burkart, Rebecca C; Stahl, Yvonne

2017-12-01

Plant receptor complexes at the cell surface perceive many different external and internal signalling molecules and relay these signals into the cell to regulate development, growth and immunity. Recent progress in the analyses of receptor complexes using different live cell imaging approaches have shown that receptor complex formation and composition are dynamic and take place at specific microdomains at the plasma membrane. In this review we focus on three prominent examples of Arabidopsis thaliana receptor complexes and how their dynamic spatio-temporal distribution at the PM has been studied recently. We will elaborate on the newly emerging concept of plasma membrane microdomains as potential hubs for specific receptor complex assembly and signalling outputs. Copyright © 2017 Elsevier Ltd. All rights reserved.

Accardi contra Bell (cum mundi) : the impossible coupling

NARCIS (Netherlands)

Gill, R.D.

2001-01-01

An experimentally observed violation of Bell s inequality is supposed to show the failure of local realism to deal with quantum reality. However, finite statistics and the time sequential nature of real experiments still allows a loophole for local realism. We show that the randomised design of

31 PLEA BARGAINING AND THE RELIGIOUS CUM SOCIO ...

African Journals Online (AJOL)

HP

2016-07-09

Jul 9, 2016 ... eradicating corruption in the country will not be a mere political ... have plea bargaining systems, albeit in different stages of development. .... dying as a result of socio-cultural disintegration being witnessed as a bye product.

Performance Of Animal-drawn, Ripper Attached Maize-Cum ...

African Journals Online (AJOL)

በፊት ከተሰራው በእርፍና ሞፈር ሊይ ታስሮ ከሚሰራ መዝሪያ (sweeper attached planter, SAP) እና መሬቱን. በነባሩ የአስተራረስ ዘዴ አዘጋጅቶ የሰው ሃይሌ (በእጅ) ዘር ...

HISTORIOGRAPHY OF THE PRINT MEDIA: A GLOBAL-CUM ...

African Journals Online (AJOL)

user

2012-07-01

Jul 1, 2012 ... longer were societies composed of rulers and subjects; printing sped the rise of democracy. No longer ..... As a nationalist,. Zik never ... These categories of newspapers constitute a new dimension in newspaper production.

Status and prospects of fish farming in Goa

Digital Repository Service at National Institute of Oceanography (India)

Parulekar, A.H.; Verlecar, X.N.

-cum-prawn culture. Relevant information on the indigenous methods of cultivating common species, their annual yield and economics of aquaculture are discussed in the paper with reference to future prospects of fish farming in Goa...

PROTECTING CRITICAL DATABASES – TOWARDS A RISK BASED ...

African Journals Online (AJOL)

njotim

LLB, (Vista University), LLM Cum Laude: Information Technology Law, ... information14 by or between governments, businesses or individual ICT users, thus .... web user into surrendering private information that will be used for identity theft ...

Revitalizing Complex Analysis: A Transition-to-Proof Course Centered on Complex Topics

Science.gov (United States)

Sachs, Robert

2017-01-01

A new transition course centered on complex topics would help in revitalizing complex analysis in two ways: first, provide early exposure to complex functions, sparking greater interest in the complex analysis course; second, create extra time in the complex analysis course by eliminating the "complex precalculus" part of the course. In…

3D complex: a structural classification of protein complexes.

Directory of Open Access Journals (Sweden)

Emmanuel D Levy

2006-11-01

Full Text Available Most of the proteins in a cell assemble into complexes to carry out their function. It is therefore crucial to understand the physicochemical properties as well as the evolution of interactions between proteins. The Protein Data Bank represents an important source of information for such studies, because more than half of the structures are homo- or heteromeric protein complexes. Here we propose the first hierarchical classification of whole protein complexes of known 3-D structure, based on representing their fundamental structural features as a graph. This classification provides the first overview of all the complexes in the Protein Data Bank and allows nonredundant sets to be derived at different levels of detail. This reveals that between one-half and two-thirds of known structures are multimeric, depending on the level of redundancy accepted. We also analyse the structures in terms of the topological arrangement of their subunits and find that they form a small number of arrangements compared with all theoretically possible ones. This is because most complexes contain four subunits or less, and the large majority are homomeric. In addition, there is a strong tendency for symmetry in complexes, even for heteromeric complexes. Finally, through comparison of Biological Units in the Protein Data Bank with the Protein Quaternary Structure database, we identified many possible errors in quaternary structure assignments. Our classification, available as a database and Web server at http://www.3Dcomplex.org, will be a starting point for future work aimed at understanding the structure and evolution of protein complexes.

Unraveling chaotic attractors by complex networks and measurements of stock market complexity

International Nuclear Information System (INIS)

Cao, Hongduo; Li, Ying

2014-01-01

We present a novel method for measuring the complexity of a time series by unraveling a chaotic attractor modeled on complex networks. The complexity index R, which can potentially be exploited for prediction, has a similar meaning to the Kolmogorov complexity (calculated from the Lempel–Ziv complexity), and is an appropriate measure of a series' complexity. The proposed method is used to research the complexity of the world's major capital markets. None of these markets are completely random, and they have different degrees of complexity, both over the entire length of their time series and at a level of detail. However, developing markets differ significantly from mature markets. Specifically, the complexity of mature stock markets is stronger and more stable over time, whereas developing markets exhibit relatively low and unstable complexity over certain time periods, implying a stronger long-term price memory process

Unraveling chaotic attractors by complex networks and measurements of stock market complexity.

Science.gov (United States)

Cao, Hongduo; Li, Ying

2014-03-01

We present a novel method for measuring the complexity of a time series by unraveling a chaotic attractor modeled on complex networks. The complexity index R, which can potentially be exploited for prediction, has a similar meaning to the Kolmogorov complexity (calculated from the Lempel-Ziv complexity), and is an appropriate measure of a series' complexity. The proposed method is used to research the complexity of the world's major capital markets. None of these markets are completely random, and they have different degrees of complexity, both over the entire length of their time series and at a level of detail. However, developing markets differ significantly from mature markets. Specifically, the complexity of mature stock markets is stronger and more stable over time, whereas developing markets exhibit relatively low and unstable complexity over certain time periods, implying a stronger long-term price memory process.

AJET VOL. 9. NO. 1 arrangement Backup New Correction

African Journals Online (AJOL)

Ayodele Azeez A

making them a force for profound change. Therefore, any ... has a significant effect on the development of individuals and on his/her ... that affect behaviour are spatial organization, Visual character, site ..... Cummings, N. G. (2012). Fostering.

Research Article Special Issue

African Journals Online (AJOL)

2017-02-15

Feb 15, 2017 ... The study population consisted of all employees of Tehran Bank ...... Deci, E.L., Connell, J.P., Ryan, R.M. (1989), "Self-determination in a work ... employeeempowerment", in Cummings, T. (Ed.), Handbook of Organizational.

Complex Correspondence Principle

International Nuclear Information System (INIS)

Bender, Carl M.; Meisinger, Peter N.; Hook, Daniel W.; Wang Qinghai

2010-01-01

Quantum mechanics and classical mechanics are distinctly different theories, but the correspondence principle states that quantum particles behave classically in the limit of high quantum number. In recent years much research has been done on extending both quantum and classical mechanics into the complex domain. These complex extensions continue to exhibit a correspondence, and this correspondence becomes more pronounced in the complex domain. The association between complex quantum mechanics and complex classical mechanics is subtle and demonstrating this relationship requires the use of asymptotics beyond all orders.

NCBI nr-aa BLAST: CBRC-XTRO-01-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0267 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 8e-16 18% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0132 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0132 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 1e-21 25% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0470 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0470 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 1e-13 24% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-2513 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-2513 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 2e-12 28% ...

Animal Research International - Vol 9, No 2 (2012)

African Journals Online (AJOL)

Effects of Piliostigma thonningii ethyl acetate leaf extract on aluminium-cum extract treated wistar rats · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Macdonald O Ighodaro, JO Omole, SO Fadipe ...

ISSN 2073 East Cent. Afr. j. surg.

African Journals Online (AJOL)

DELL

2009-02-27

Feb 27, 2009 ... Bladder Tumours at Tikur Anbessa Hospital in Ethiopia. ... The most common presenting symptoms were hematuria in 89(91.8%). cystoscopy ..... West DA, Cummings JM, Longo WE, et al; Role of chronic catheterization in the.

Uranium thiolate complexes

International Nuclear Information System (INIS)

Leverd, Pascal C.

1994-01-01

This research thesis proposes a new approach to the chemistry of uranium thiolate complexes as these compounds are very promising for various uses (in bio-inorganic chemistry, in some industrial processes like oil desulphurization). It more particularly addresses the U-S bond or more generally bonds between polarizable materials and hard metals. The author thus reports the study of uranium organometallic thiolates (tricyclo-penta-dienic and mono-cyclo-octa-tetraenylic complexes), and of uranium homoleptic thiolates (tetra-thiolate complexes, hexa-thiolate complexes, reactivity of homoleptic thiolate complexes) [fr

Clinical Complexity in Medicine: A Measurement Model of Task and Patient Complexity.

Science.gov (United States)

Islam, R; Weir, C; Del Fiol, G

2016-01-01

Complexity in medicine needs to be reduced to simple components in a way that is comprehensible to researchers and clinicians. Few studies in the current literature propose a measurement model that addresses both task and patient complexity in medicine. The objective of this paper is to develop an integrated approach to understand and measure clinical complexity by incorporating both task and patient complexity components focusing on the infectious disease domain. The measurement model was adapted and modified for the healthcare domain. Three clinical infectious disease teams were observed, audio-recorded and transcribed. Each team included an infectious diseases expert, one infectious diseases fellow, one physician assistant and one pharmacy resident fellow. The transcripts were parsed and the authors independently coded complexity attributes. This baseline measurement model of clinical complexity was modified in an initial set of coding processes and further validated in a consensus-based iterative process that included several meetings and email discussions by three clinical experts from diverse backgrounds from the Department of Biomedical Informatics at the University of Utah. Inter-rater reliability was calculated using Cohen's kappa. The proposed clinical complexity model consists of two separate components. The first is a clinical task complexity model with 13 clinical complexity-contributing factors and 7 dimensions. The second is the patient complexity model with 11 complexity-contributing factors and 5 dimensions. The measurement model for complexity encompassing both task and patient complexity will be a valuable resource for future researchers and industry to measure and understand complexity in healthcare.

Thinking Forbidden Thoughts: The Oedipus Complex as a Complex of Knowing.

Science.gov (United States)

Schein, Michael

2016-04-01

The Oedipus complex, considered by Freud the "nuclear complex of development," played a central role in the evolution of psychoanalytic thought. This paper returns to the point of transition from the seduction theory, Freud's initial theorem, to the oedipal model, and suggests that the Oedipus complex is first and foremost a text and as such contains a multiplicity of narratives. In particular, the author articulates the close relation between the Oedipus complex and the subject of knowing, postulating that underlying its surface level, the deep-level structure of this complex is one of knowing. As a complex of knowing it is of dual quality, both promoting and impeding the ability to know.

AFRREV, 9(1), S/NO 36, JANUARY, 2015

African Journals Online (AJOL)

EMILIA

from the seizure of ivory (from ivory raids) buying of tusks from the interior or through direct .... products like textile, footwear, cigarette, processed foods and beverages cum cement .... preferences and behaviour of warring parties. This type of ...

Complexity-management in SME : organization of complex relationships

NARCIS (Netherlands)

Gregus, M.; Mandorf, S.

2009-01-01

The complexity of companies' environment IS growmg. Complexity management and restructuring of small and medium-sized enterprises (SME) become big challenges of business studies in the next future. A chance could be seen in the use of e-business strategies and the implementation of information

Pierluigi Cuzzolin. Sull'origine della costruzione dicere quod: aspetti sintattici e se­ mantici; Firenze 1994, Pubblicazioni della Facolta di Lettere e Filosofia dell'Università di Pavia, 72, Dipartimento di Lingue e Letterature Straniere Moderne

Directory of Open Access Journals (Sweden)

Matjaž Babič

1995-12-01

Full Text Available Das Buch ist eine überarbeitete und verbesserte Version der Doktordissertation, die an der Universität von Pavia vorgelegt wurde. Es wird darin ein vielbesprochenes Prob­ lem der lateinischen Sprache erneut aufgegriffen, es wird eine neue Antwort auf die Frage über das Verhaltnis zwischen Accusativus cum infinitivo (Acl und Nebensätzen mit quod/quia dargeboten. Der Accusativus cum infinitivo, regiert von Verben wie 'sagen, denken', gilt als eine Besonderheit des Lateinischen und Altgriechischen im Verhältnis zu den modernen indogermanischen Sprachen. Für den Ursprung und Sinn dieser Infinitivkonstruktion wurden verschiedene Erklärungen vorgeschlagen oder zu­ mindest Richtungen für eine mögliche Lösung angezeigt. Der Verfasser dieses Buches versucht, die vorhandenen Losungen mit Hilfe der allgemeinlinguistischen Erkentnisse zu erganzen und sie in eine neue Lösung zu vereinen.

Comment on ‘Initial states of qubit–environment models leading to conserved quantities’

International Nuclear Information System (INIS)

Lo, C F

2014-01-01

Recently, Gardas and Dajka (2013 J. Phys. A: Math. Theor. 46 235301) proposed a theoretical scheme on how to prepare a proper initial state of a composite qubit–boson system which could assure no energy exchange between the two subsystems. For illustration, they applied the proposed scheme to both the Jaynes–Cummings model and the multi-photon Rabi model. However, it has already been rigorously proven that the k-photon Rabi model for k > 2 does not have eigenstates in the Hilbert space spanned by the eigenstates of the corresponding k-photon Jaynes–Cummings model and that the two-photon Rabi model has a discrete eigenenergy spectrum with normalizable eigenstates only if the coupling strength is smaller than a critical value. Hence, the proposed theoretical scheme is not applicable to the multi-photon Rabi model. (comment)

Managing Complexity

DEFF Research Database (Denmark)

Maylath, Bruce; Vandepitte, Sonia; Minacori, Patricia

2013-01-01

and into French. The complexity of the undertaking proved to be a central element in the students' learning, as the collaboration closely resembles the complexity of international documentation workplaces of language service providers. © Association of Teachers of Technical Writing.......This article discusses the largest and most complex international learning-by-doing project to date- a project involving translation from Danish and Dutch into English and editing into American English alongside a project involving writing, usability testing, and translation from English into Dutch...

Mathematics for electric engineers. Complex numbers; Mathematiques pour l`electricien. Nombres complexes

Energy Technology Data Exchange (ETDEWEB)

Rouxel, C. [Conservatoire National des Arts et Metiers (CNAM), 75 - Paris (France)

1999-05-01

Complex numbers are widely used in electrical engineering. This article is divided into 5 parts dealing successively with: the cartesian form of complex numbers (definition, conjugated complex numbers, graphical representation); the trigonometrical form of complex numbers (module and argument, trigonometrical form, exponential notation, multiplication and division of two complex numbers); Moivre and Euler formulae; applications (square root and second degree equation, n. roots, plan rotation and similarity); cissoidal transformation (definition, properties, applications to electricity: complex impedance in permanent sinusoidal regime, transfer function of a linear system in permanent regime, study of an example). (J.S.)

DOI: 10.18697/ajfand.79.15670 12325 ECONOMIC DIFFERENTIAL ...

African Journals Online (AJOL)

fish, rice cum poultry production integration platforms were set up to perfect the ... people along its divergent value chain, in addition to providing food and nutrition .... the application of organic manure at the recommended rate of 150kg fresh.

EPA's SHEDS-multimedia model: children's cumulative pyrethroid exposure estimates and evaluation against NHANES biomarker data

Science.gov (United States)

The U.S. EPA's SHEDS-Multimedia model was applied to enhance the understanding of children's exposures and doses to multiple pyrethroid pesticides, including major contributing chemicals and pathways. This paper presents combined dietary and residential exposure estimates and cum...

A 1 V supercapacitor device with nanostructured graphene oxide ...

Indian Academy of Sciences (India)

Polyaniline and graphene oxide composite on activated carbon cum reduced graphene oxide-supported supercapacitor electrodes are fabricated and electrochemically characterized in a three-electrode cell assembly. Attractive supercapacitor performance, namely high-power capability and cycling stability for graphene ...

ComplexRec 2017

DEFF Research Database (Denmark)

a single step in the user's more complex background need. These background needs can often place a variety of constraints on which recommendations are interesting to the user and when they are appropriate. However, relatively little research has been done on these complex recommendation scenarios....... The ComplexRec 2017 workshop addressed this by providing an interactive venue for discussing approaches to recommendation in complex scenarios that have no simple one-size-fits-all-solution....

Complex variables

CERN Document Server

Fisher, Stephen D

1999-01-01

The most important topics in the theory and application of complex variables receive a thorough, coherent treatment in this introductory text. Intended for undergraduates or graduate students in science, mathematics, and engineering, this volume features hundreds of solved examples, exercises, and applications designed to foster a complete understanding of complex variables as well as an appreciation of their mathematical beauty and elegance. Prerequisites are minimal; a three-semester course in calculus will suffice to prepare students for discussions of these topics: the complex plane, basic

Complexity Management In Projects Between Rational Momentum And Complex Conditions

DEFF Research Database (Denmark)

Mac, Anita; Schlamovitz, Jesper

2015-01-01

Abstract: This study takes its departure in a model of complexity, developed by Stacey (1993), to test and discuss its practical benefit as perceived by practicing project managers. Based on a survey, the study finds that complexity is a phenomenon recognized by project managers, and complexity...... management is associated with benefits in the development of tasks and managing stakeholders. It is also associated with some difficulty in terms of an increased need for dialogue and a risk of creating goal ambiguity. Based on the findings, we conclude that classical project management approaches can...... benefit from incorporating complexity management....

Complexity management in projects between rational momentum and complex conditions

DEFF Research Database (Denmark)

Mac, Anita; Schlamovitz, Jesper

This study takes its departure in a model of complexity, developed by Stacey (1993), to test and discuss its practical benefit as perceived by practicing project managers. Based on a survey, the study finds that complexity is a phenomenon recognized by project managers, and complexity management...... is associated with benefits in the development of tasks and managing stakeholders. It is also associated with some difficulty in terms of an increased need for dialogue and a risk of creating goal ambiguity. Based on the findings, we conclude that classical project management approaches can benefit from...... incorporating complexity management....

Description d’un genre nouveau de la famille des Clérides

NARCIS (Netherlands)

Fairmaire, L.

1887-01-01

Tarsi quadriarticulati. Prothorax haud marginatus, lateribus cum pleuris confusis. Oculi antice emarginati, subtiliter granulati. Antennæ breves, ab articulo 5° late serratae, articulo 4° brevissimo, ultimo emarginato, apice sat acuto. Palpi omnes articulo ultimo elongato, acuto. Elytra apice

A Review of the Dodo and its Ecosystem: Interdisciplinary Research of a Vertebrate Concentration-Lagerstätte in Mauritius

NARCIS (Netherlands)

Rijsdijk, K.F.; Hume, J.P.; de Louw, P.G.B.; Meijer, H.J.M.; Janoo, A.; de Boer, E.J.; Steel, L.; de Vos, J.; van der Sluis, L.G.; Hooghiemstra, H.; Florens, F.B.V.; Baider, C.; Vernimmen, T.J.J.; Baas, P.; van Heteren, A.H.; Rupear, V.; Beebeejaun, G.; Grihault, A.; van der Plicht, J.; Besselink, M.; Lubeek, J.K.; Jansen, M.; Kluiving, S.J.; Hollund, H.; Shapiro, B.; Collins, M.; Buckley, M.; Jayasena, R.M.; Porch, N.; Floore, R.; Bunnik, F.; Biedlingmaier, A.; Leavitt, J.; Monfette, G.; Kimelblatt, A.; Floore, P.; Claessens, L.P.A.M.

2016-01-01

The dodo Raphus cucullatus Linnaeus, 1758 Linnaeus, C. 1758. Systema Naturae per Tegna Tria Naturae, Secundum Classes, Ordines, Genera, Species, cum Characteribus, Differentiis, Synonymis, Locis. Tenth Edition. Laurentii Salvii, Stockholm, 824 pp., an extinct and flightless, giant pigeon endemic to

Cavity quantum electrodynamics of a quantum dot in a micropillar cavity: comparison between experiment and theory

DEFF Research Database (Denmark)

Madsen, Kristian Høeg; Ates, Serkan; Reitzenstein, S.

2010-01-01

The coupling between a quantum dot (QD) and a micropillar cavity is experimentally investigated by performing time-resolved, correlation, and two-photon interference measurements. The Jaynes-Cummings model including dissipative Lindblad terms and dephasing is analyzed, and all the parameters...

An interesting new Bulbophyllum

NARCIS (Netherlands)

Smith, J.J.

1935-01-01

Bulbophyllum (sect. Cirrhopetalum) Jacobsonii J. J. S. n. sp. — Rhizoma repens, teres. Pseudobulbi remoti, oblique ovoidei, manifesto quadranguli cum lateribus concavis, 1.8 cm longi, 0.75 et 0.95 cm diam., 1-folii. Folium lanceolatum, apice recurvulum, basi brevissime

Prevalence and correlates of chronic kidney disease among civil ...

African Journals Online (AJOL)

2014-01-31

Jan 31, 2014 ... Results: The prevalence of CKD in the study was 7.8%. Age >50 years was .... participant and preserved in lithium heparin bottle for subsequent ..... Craig JC, Barratt A, Cumming R, Irwig L, Salkeld G. Feasibility study of the.

Making Sense of Formalization in Interorganizational Relationships: Beyond Coordination and Control

NARCIS (Netherlands)

P.W.L. Vlaar (Paul)

2006-01-01

textabstractPaul W.L. Vlaar (Obdam, January 4, 1978) obtained his M.Sc. degree in Economics (Cum Laude) from Wageningen University, The Netherlands. He is currently an assistant professor of strategic management at RSM Erasmus University. His research interests include interorganizational

Search Results | Page 16 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 151 - 160 of 9581 ... Estimating the effect of minimum wage on firm profitability in China ... minimum wage policy in China has not only direct effects on wage levels but ... Sustainable livelihoods for all the micro enterprise cum micro credit ...

Complexity Theory

Science.gov (United States)

Lee, William H K.

2016-01-01

A complex system consists of many interacting parts, generates new collective behavior through self organization, and adaptively evolves through time. Many theories have been developed to study complex systems, including chaos, fractals, cellular automata, self organization, stochastic processes, turbulence, and genetic algorithms.

Phospholyl-uranium complexes

International Nuclear Information System (INIS)

Gradoz, Philippe

1993-01-01

After having reported a bibliographical study on penta-methylcyclopentadienyl uranium complexes, and a description of the synthesis and radioactivity of uranium (III) and (IV) boron hydrides compounds, this research thesis reports the study of mono and bis-tetramethyl-phospholyl uranium complexes comprising chloride, boron hydride, alkyl and alkoxide ligands. The third part reports the comparison of structures, stabilities and reactions of homologue complexes in penta-methylcyclopentadienyl and tetramethyl-phospholyl series. The last part addresses the synthesis of tris-phospholyl uranium (III) and (IV) complexes. [fr

Complex saddle points and the sign problem in complex Langevin simulation

International Nuclear Information System (INIS)

Hayata, Tomoya; Hidaka, Yoshimasa; Tanizaki, Yuya

2016-01-01

We show that complex Langevin simulation converges to a wrong result within the semiclassical analysis, by relating it to the Lefschetz-thimble path integral, when the path-integral weight has different phases among dominant complex saddle points. Equilibrium solution of the complex Langevin equation forms local distributions around complex saddle points. Its ensemble average approximately becomes a direct sum of the average in each local distribution, where relative phases among them are dropped. We propose that by taking these phases into account through reweighting, we can solve the wrong convergence problem. However, this prescription may lead to a recurrence of the sign problem in the complex Langevin method for quantum many-body systems.

Complex and symplectic geometry

CERN Document Server

Medori, Costantino; Tomassini, Adriano

2017-01-01

This book arises from the INdAM Meeting "Complex and Symplectic Geometry", which was held in Cortona in June 2016. Several leading specialists, including young researchers, in the field of complex and symplectic geometry, present the state of the art of their research on topics such as the cohomology of complex manifolds; analytic techniques in Kähler and non-Kähler geometry; almost-complex and symplectic structures; special structures on complex manifolds; and deformations of complex objects. The work is intended for researchers in these areas.

Elemental characterization of New Year's Day PM10 and PM2.2 particulates matter at several sites in Metro Manila

Energy Technology Data Exchange (ETDEWEB)

Santos, Flora L; Pabroa, Preciosa Corazon B; Morco, Ryan P; Racho, Joseph Michael D [Analytical Measurements Research Group, Philippine Nuclear Research Institute, Commonwealth Ave., Diliman, Quezon City (Philippines)

2007-07-01

In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project {sup P}articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques{sup .} Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the

Monitoring endemic livestock diseases using laboratory diagnostic data: A simulation study to evaluate the performance of univariate process monitoring control algorithms.

Science.gov (United States)

Lopes Antunes, Ana Carolina; Dórea, Fernanda; Halasa, Tariq; Toft, Nils

2016-05-01

Surveillance systems are critical for accurate, timely monitoring and effective disease control. In this study, we investigated the performance of univariate process monitoring control algorithms in detecting changes in seroprevalence for endemic diseases. We also assessed the effect of sample size (number of sentinel herds tested in the surveillance system) on the performance of the algorithms. Three univariate process monitoring control algorithms were compared: Shewart p Chart(1) (PSHEW), Cumulative Sum(2) (CUSUM) and Exponentially Weighted Moving Average(3) (EWMA). Increases in seroprevalence were simulated from 0.10 to 0.15 and 0.20 over 4, 8, 24, 52 and 104 weeks. Each epidemic scenario was run with 2000 iterations. The cumulative sensitivity(4) (CumSe) and timeliness were used to evaluate the algorithms' performance with a 1% false alarm rate. Using these performance evaluation criteria, it was possible to assess the accuracy and timeliness of the surveillance system working in real-time. The results showed that EWMA and PSHEW had higher CumSe (when compared with the CUSUM) from week 1 until the end of the period for all simulated scenarios. Changes in seroprevalence from 0.10 to 0.20 were more easily detected (higher CumSe) than changes from 0.10 to 0.15 for all three algorithms. Similar results were found with EWMA and PSHEW, based on the median time to detection. Changes in the seroprevalence were detected later with CUSUM, compared to EWMA and PSHEW for the different scenarios. Increasing the sample size 10 fold halved the time to detection (CumSe=1), whereas increasing the sample size 100 fold reduced the time to detection by a factor of 6. This study investigated the performance of three univariate process monitoring control algorithms in monitoring endemic diseases. It was shown that automated systems based on these detection methods identified changes in seroprevalence at different times. Increasing the number of tested herds would lead to faster

Publii ovidii nasonis tristium liber IV commentario exegetico instructus

NARCIS (Netherlands)

Jonge, Theodorus Jacobus de

1951-01-01

Sub finem anni 8 p. Chr. n. P. Ovidius Naso quinquagesimum annum egressus relegatus est. Duas causas ipse poeta affert: perdiderint cum me duo crimina, carmen et error. Verisimile est utrumque crimen pertinuisse ad formulam laesae maiestatis. Augusti temporibus autem crimen laesae maiestatis

Description de Coléoptères nouveaux de la Malaisie, de l’Inde et de la Chine

NARCIS (Netherlands)

Fairmaire, L.

1897-01-01

Long. 13 mill. — Oblonga, sat convexa, dilute piceola, vage ænescens, opaca, labro dilute testaceo, elytris utrinque plaga magna media, intus constricta et parte apicali lutosis, lateribus utrinque plagulis 2 triangularibus cum prothoracis lateribus æneo-pernitidis, quasi specularibus; capite basin

A corpus-based Critical Discourse Analysis (CDA) of the linguistic ...

African Journals Online (AJOL)

Additionally, nominalisation-cum-thematisation of discourse topics, intertextuality, citation of views by experts and officials, the local nomenclature of HIV and AIDS and Shona for Specific Purposes (SSP) motivated by politeness, were variously used to reveal advances and challenges encountered regarding activities ...

Arcillas y biocarbones para la eliminación de contaminantes de origen agrícola en aguas: ensayo en filtro a escala precomercial

OpenAIRE

Durán, Esperanza

2017-01-01

297 páginas.-- Tesis para obtener el título de Doctor por la Universidad de Sevilla con la calificación de Sobresaliente Cum laude.-- Tutora: Dra. Isabel González Díez, Profesora Titular de la Universidad de Sevilla

Exact and useful optimization methods for microeconomics

NARCIS (Netherlands)

Balder, E.J.

2011-01-01

This paper points out that the treatment of utility maximization in current textbooks on microeconomic theory is deficient in at least three respects: breadth of coverage, completeness-cum-coherence of solution methods and mathematical correctness. Improvements are suggested in the form of a

Designing an Error Resolution Checklist for a Shared Manned-Unmanned Environment

Science.gov (United States)

2010-06-01

to many people who contributed to the successful completion of this thesis. First, a special thank you to Missy Cummings, my research advisor ...Management Using Treemaps. Proceedings of the Project Management Institute Research Conference. London, UK. Chandler, D. (2009). Robo -forklift keeps

Adaptive generalized combination complex synchronization of uncertain real and complex nonlinear systems

Energy Technology Data Exchange (ETDEWEB)

Wang, Shi-bing, E-mail: wang-shibing@dlut.edu.cn, E-mail: wangxy@dlut.edu.cn [School of Computer and Information Engineering, Fuyang Normal University, Fuyang 236041 (China); Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China); Wang, Xing-yuan, E-mail: wang-shibing@dlut.edu.cn, E-mail: wangxy@dlut.edu.cn [Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China); Wang, Xiu-you [School of Computer and Information Engineering, Fuyang Normal University, Fuyang 236041 (China); Zhou, Yu-fei [College of Electrical Engineering and Automation, Anhui University, Hefei 230601 (China)

2016-04-15

With comprehensive consideration of generalized synchronization, combination synchronization and adaptive control, this paper investigates a novel adaptive generalized combination complex synchronization (AGCCS) scheme for different real and complex nonlinear systems with unknown parameters. On the basis of Lyapunov stability theory and adaptive control, an AGCCS controller and parameter update laws are derived to achieve synchronization and parameter identification of two real drive systems and a complex response system, as well as two complex drive systems and a real response system. Two simulation examples, namely, ACGCS for chaotic real Lorenz and Chen systems driving a hyperchaotic complex Lü system, and hyperchaotic complex Lorenz and Chen systems driving a real chaotic Lü system, are presented to verify the feasibility and effectiveness of the proposed scheme.

A new generative complexity science of learning for a complex pedagogy

NARCIS (Netherlands)

Jörg, T.

2007-01-01

Proposal for the SIG Chaos and Complexity Theories at AERA 2007 Title: A New Generative Complexity Science of Learning for a Complex Pedagogy Ton Jörg IVLOS Institute of Education University of Utrecht The Netherlands A.G.D.Jorg@ivlos.uu.nl Introduction My paper focuses on the link between thinking

Chirality Quantum Phase Transition in Noncommutative Dirac Oscillator

International Nuclear Information System (INIS)

Wang Shao-Hua; Hou Yu-Long; Jing Jian; Wang Qing; Long Zheng-Wen

2014-01-01

The charged Dirac oscillator on a noncommutative plane coupling to a uniform perpendicular magnetic held is studied in this paper. We map the noncommutative plane to a commutative one by means of Bopp shift and study this problem on the commutative plane. We find that this model can be mapped onto a quantum optics model which contains Anti—Jaynes—Cummings (AJC) or Jaynes—Cummings (JC) interactions when a dimensionless parameter ζ (which is the function of the intensity of the magnetic held) takes values in different regimes. Furthermore, this model behaves as experiencing a chirality quantum phase transition when the dimensionless parameter ζ approaches the critical point. Several evidences of the chirality quantum phase transition are presented. We also study the non-relativistic limit of this model and find that a similar chirality quantum phase transition takes place in its non-relativistic limit. (physics of elementary particles and fields)

EVALUATION OF PRE AND POST TRAINING PRACTICES REGARDING MANAGEMENT OF DIABETES

Directory of Open Access Journals (Sweden)

M Mohanty

1995-09-01

Full Text Available The study was conducted on 112 diabetic patients in S.S. Hospital.Varanasi to evaluate the pre- and post- training practices regarding management of Diabetes mellitus. A pre-tested structured respondent schedule urn used to collect information regarding the socio-economic status and some of the managerial aspects of the disease by questionaire cum interview method. Education cum training was imparted to all the respondents in the first three months and in the fourth month evaluation programme was carried out and their level ofpractive regarding different aspects of diabetic management were assessed by using seven point score method. It was found that training was proved effective for the aspect "Physical exer­cise" and "Restricted diet" but slight improvement in the practive score was seen in "Precaution in Special Hygienic Condition" aspects. So. con­tinuous education programme was needed to improve their practice rate.

Classical-driving-assisted entanglement dynamics control

Energy Technology Data Exchange (ETDEWEB)

Zhang, Ying-Jie, E-mail: yingjiezhang@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Han, Wei [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Xia, Yun-Jie, E-mail: yjxia@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Fan, Heng, E-mail: hfan@iphy.ac.cn [Beijing National Laboratory of Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing, 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing, 100190 (China)

2017-04-15

We propose a scheme of controlling entanglement dynamics of a quantum system by applying the external classical driving field for two atoms separately located in a single-mode photon cavity. It is shown that, with a judicious choice of the classical-driving strength and the atom–photon detuning, the effective atom–photon interaction Hamiltonian can be switched from Jaynes–Cummings model to anti-Jaynes–Cummings model. By tuning the controllable atom–photon interaction induced by the classical field, we illustrate that the evolution trajectory of the Bell-like entanglement states can be manipulated from entanglement-sudden-death to no-entanglement-sudden-death, from no-entanglement-invariant to entanglement-invariant. Furthermore, the robustness of the initial Bell-like entanglement can be improved by the classical driving field in the leaky cavities. This classical-driving-assisted architecture can be easily extensible to multi-atom quantum system for scalability.

Quantum complex rotation and uniform semiclassical calculations of complex energy eigenvalues

International Nuclear Information System (INIS)

Connor, J.N.L.; Smith, A.D.

1983-01-01

Quantum and semiclassical calculations of complex energy eigenvalues have been carried out for an exponential potential of the form V 0 r 2 exp(-r) and Lennard-Jones (12,6) potential. A straightforward method, based on the complex coordinate rotation technique, is described for the quantum calculation of complex eigenenergies. For singular potentials, the method involves an inward and outward integration of the radial Schroedinger equation, followed by matching of the logarithmic derivatives of the wave functions at an intermediate point. For regular potentials, the method is simpler, as only an inward integration is required. Attention is drawn to the World War II researches of Hartree and co-workers who anticipated later quantum mechanical work on the complex rotation method. Complex eigenenergies are also calculated from a uniform semiclassical three turning point quantization formula, which allows for the proximity of the outer pair of complex turning points. Limiting cases of this formula, which are valid for very narrow or very broad widths, are also used in the calculations. We obtain good agreement between the semiclassical and quantum results. For the Lennard-Jones (12,6) potential, we compare resonance energies and widths from the complex energy definition of a resonance with those obtained from the time delay definition

Complex Constructivism: A Theoretical Model of Complexity and Cognition

Science.gov (United States)

Doolittle, Peter E.

2014-01-01

Education has long been driven by its metaphors for teaching and learning. These metaphors have influenced both educational research and educational practice. Complexity and constructivism are two theories that provide functional and robust metaphors. Complexity provides a metaphor for the structure of myriad phenomena, while constructivism…

Complexity in phonology: The complex consonants of simple CV ...

African Journals Online (AJOL)

The main objective of this article is to investigate the interplay of simplicity and complexity in the phonological structure of Zezuru. The article argues that Zezuru affricates, prenasalised consonants (NCs) and velarised consonants (Cws) are subsegmentally complex segments which function as simple onsets. Treating them ...

Cobalt(III) complex

Indian Academy of Sciences (India)

Administrator

e, 40 µM complex, 10 hrs after dissolution, f, 40 µM complex, after irradiation dose 15 Gy. and H-atoms result in reduction of Co(III) to Co. (II). 6. It is interesting to see in complex containing multiple ligands what is the fate of electron adduct species formed by electron addition. Reduction to. Co(II) and intramolecular transfer ...

Unraveling the effect of structurally different classes of insecticide on germination and early plant growth of soybean [Glycine max (L.) Merr].

Science.gov (United States)

Dhungana, Sanjeev Kumar; Kim, Il-Doo; Kwak, Hwa-Sook; Shin, Dong-Hyun

2016-06-01

Although a considerable number of studies about the effect of different insecticides on plant physiology and metabolism have been carried out, research work about the comparative action of structurally different classes of insecticide on physiological and biochemical properties of soybean seed germination and early growth has not been found. The objective of this study was to investigate the effect of different classes of insecticides on soybean seed germination and early plant growth. Soybean seeds of Bosuk cultivar were soaked for 24h in distilled water or recommended dose (2mLL(-1), 1mLL(-1), 0.5gL(-1), and 0.5gL(-1) water for insecticides Mepthion, Myungtaja, Actara, and Stonate, respectively) of pesticide solutions of four structurally different classes of insecticides - Mepthion (fenitrothion; organophosphate), Myungtaja (etofenprox; pyrethroid), Actara (thiamethoxam; neonicotinoid), and Stonate (lambda-cyhalothrin cum thiamethoxam; pyrethroid cum neonicotinoid) - which are used for controlling stink bugs in soybean crop. Insecticides containing thiamethoxam and lamda-cyhalothrin cum thiamethoxam showed positive effects on seedling biomass and content of polyphenol and flavonoid, however fenitrothion insecticide reduced the seed germination, seed and seedling vigor, and polyphenol and flavonoid contents in soybean. Results of this study reveal that different classes of insecticide have differential influence on physiologic and metabolic actions like germination, early growth, and antioxidant activities of soybean and this implies that yield and nutrient content also might be affected with the application of different types of insecticide. Copyright © 2015 Elsevier B.V. All rights reserved.

Nuclear weapons complex

International Nuclear Information System (INIS)

Rezendes, V.S.

1991-03-01

In this book, GAO characterizes DOE's January 1991 Nuclear Weapons Complex Reconfiguration Study as a starting point for reaching agreement on solutions to many of the complex's safety and environmental problems. Key decisions still need to be made about the size of the complex, where to relocate plutonium operations, what technologies to use for new tritium production, and what to do with excess plutonium. The total cost for reconfiguring and modernizing the complex is still uncertain, and some management issues remain unresolved. Congress faces a difficult task in making test decisions given the conflicting demands for scarce resources in a time of growing budget deficits and war in the Persian Gulf

Complex Networks

CERN Document Server

Evsukoff, Alexandre; González, Marta

2013-01-01

In the last decade we have seen the emergence of a new inter-disciplinary field focusing on the understanding of networks which are dynamic, large, open, and have a structure sometimes called random-biased. The field of Complex Networks is helping us better understand many complex phenomena such as the spread of  deseases, protein interactions, social relationships, to name but a few. Studies in Complex Networks are gaining attention due to some major scientific breakthroughs proposed by network scientists helping us understand and model interactions contained in large datasets. In fact, if we could point to one event leading to the widespread use of complex network analysis is the availability of online databases. Theories of Random Graphs from Erdös and Rényi from the late 1950s led us to believe that most networks had random characteristics. The work on large online datasets told us otherwise. Starting with the work of Barabási and Albert as well as Watts and Strogatz in the late 1990s, we now know th...

Mawuli Adjei *

African Journals Online (AJOL)

Agenda for Change, the party pledged, inter alia, to reduce "the potential for, and level of ... According to her, "The Centre for Democratic Development (CDD) Ghana's 2005. Afro Barometer Round ... party organization, incompetence, victimization, personality cult etc. combine to perpetuate an ..... Cummings, Jeffreys. 1992.

Rhizobium as a crop enhancer and biofertilizer for increased cereal ...

African Journals Online (AJOL)

OHWESIRI IBUJE

2010-09-13

Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...

Florae Malesianae precursores I. Xyridaceae

NARCIS (Netherlands)

Royen, van P.

1953-01-01

Xyris malmei sp. nov. — Folia ensiformia, 7—30 cm longa, subfalcata, minute papillosa. Scapus 20—45 cm longus, teres vel subteres, papillatus. Bracteae ovatae ad ellipticae, obtusae, emarginatae vel retusae; bracteae basales cum nervo uno completo et nervis 4 descendentibus incompletis. Sepala

Individualism and community consciousness in contemporary Africa ...

African Journals Online (AJOL)

The contemporary Africa is witnessing a subtle encroachment of Western styled socio-political cum economic individualism. This indiscriminate assimilation of values has invariably led to the gradual eroding and bastardization of her once cherished communal approach to life. This paper critically examines the foregoing ...

Physico-chemical parameters and heavy metal contents of Ibuya ...

African Journals Online (AJOL)

The physico-chemical parameters and heavy metal contents of Ibuya River were investigated between September 2012 and August 2013 from four stations using standard methods to etermine acceptable water quality standards and evaluate possible sustainability of a thriving fisheries cum tourist sport fishing venture.

Challenges of Local Government Administration in Edo State of ...

African Journals Online (AJOL)

This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.

143 OUR GRANDMOTHERS, EXCLUDED FROM HISTORY ...

African Journals Online (AJOL)

ecomatemalistic theory by Swila (2014) and Talitha cum theory by Dube ... Sexism is viewed as a prejudice backed by power directed against women ... dependent children (United Nations Statistical Department, 2000; Uchem, 2001; Ezenweke, .... confronts systems of patriarchy, race and class in traditional societies and ...

Hydrogen production through biocatalyzed electrolysis

NARCIS (Netherlands)

Rozendal, R.A.

2007-01-01

cum laude graduation (with distinction) To replace fossil fuels, society is currently considering alternative clean fuels for transportation. Hydrogen could be such a fuel. In theory, large amounts of renewable hydrogen can be produced from organic contaminants in wastewater. During his PhD research

Predictive Models of Procedural Human Supervisory Control Behavior

Science.gov (United States)

2011-01-01

821708, Brest , France. Page 139 of 150 Boussemart, Y. and M. L. Cummings (2010). "Predicting Supervisory Control Behavior with Hidden Markov Models...Strategies for Strike Planning. COGIS 2006 - Cognitive Systems with Interactive Sensors, Paris . Burges, C. (1998). "A Tutorial on Support Vector Machines

Fostering argumentation-based computer-supported collaborative learning in higher education

NARCIS (Netherlands)

Noroozi, O.

2013-01-01

cum laude graduation (with distinction). In collaborative settings, students of all ages need to learn to clearly explain their informed opinions and give reasons for the way in which they carry out tasks and solve problems. Engaging students in collaborative discussion and argumentation is an

Photon and spin dependence of the resonance line shape in the strong coupling regime

NARCIS (Netherlands)

Miyashita, Seiji; Shirai, Tatsuhiko; Mori, Takashi; De Raedt, Hans; Bertaina, Sylvain; Chiorescu, Irinel

2012-01-01

We study the quantum dynamics of a spin ensemble coupled to cavity photons. Recently, related experimental results have been reported, showing the existence of the strong coupling regime in such systems. We study the eigenenergy distribution of the multi-spin system (following the Tavis-Cummings

Power grid complexity

Energy Technology Data Exchange (ETDEWEB)

Mei, Shengwei; Zhang, Xuemin [Tsinghua Univ., Beijing, BJ (China). Dept. of Electrical Engineering; Cao, Ming [Groningen Univ. (Netherlands). Faculty of Mathematics and Natural Sciences

2011-07-01

''Power Grid Complexity'' introduces the complex system theory known as self-organized criticality (SOC) theory and complex network theory, and their applications to power systems. It studies the network characteristics of power systems, such as their small-world properties, structural vulnerability, decomposition and coordination strategies, and simplification and equivalence methods. The book also establishes four blackout models based on SOC theory through which the SOC of power systems is studied at both the macroscopic and microscopic levels. Additionally, applications of complex system theory in power system planning and emergency management platforms are also discussed in depth. This book can serve as a useful reference for engineers and researchers working with power systems. (orig.)

Coxeter-like complexes

Directory of Open Access Journals (Sweden)

Eric Babson

2004-12-01

Full Text Available Motivated by the Coxeter complex associated to a Coxeter system (W,S, we introduce a simplicial regular cell complex Δ(G,S with a G-action associated to any pair (G,S where G is a group and S is a finite set of generators for G which is minimal with respect to inclusion. We examine the topology of Δ(G,S, and in particular the representations of G on its homology groups. We look closely at the case of the symmetric group S n minimally generated by (not necessarily adjacent transpositions, and their type-selected subcomplexes. These include not only the Coxeter complexes of type A, but also the well-studied chessboard complexes.

Technetium complexation by macrocyclic compounds

International Nuclear Information System (INIS)

Li Fan Yu.

1983-01-01

Research in nuclear medicine are directed towards the labelling of biological molecules, however, sup(99m)Tc does not show sufficient affinity for these molecules. The aim of this study was to evaluate the ability of macrocyclic compounds to bind strongly technetium in order to be used as complexation intermediate. The reducing agents used were a stannous complex and sodium dithionite. Cryptates and polyesters are not good complexing agents. They form two complexes: a 2:1 sandwich complex or 3:2 and a 1:1 complex. Cyclams are good complexing agents for technetium their complexations strength was determined by competition with pyrophosphate, gluconate and DTPA. Using the method of ligand exchange, the oxidation state of technetium in the Tc-cyclam complex was IV or V. They are 1:1 cationic complexes, the complex charge is +1. The biodistribution in rats of labelling solutions containing (cyclam 14 ane N 4 ) C 12 H 25 shows a good urinary excretion without intoxication risks [fr

Entanglement in the degenerate two-photon Tavis-Cummings model

Energy Technology Data Exchange (ETDEWEB)

Bashkirov, E K, E-mail: bash@ssu.samara.r [Departments of General and Theoretical Physics, Samara State University, PO Box 443011, 1 Academican Pavlov Str., Samara (Russian Federation)

2010-07-15

An exact solution of the problem of two two-level atoms with degenerate two-photon transitions interacting with a one-mode coherent radiation field is presented. Asymptotic solutions for system state vectors are obtained in the approximation of large initial coherent fields. The atom-field entanglement is investigated on the basis of reduced atomic entropy dynamics. The possibility of the system being initially in a pure disentangled state to revive into this state during the evolution process for the model considered is shown. The conditions and times of disentanglement are derived.

[Tissue-specific nucleoprotein complexes].

Science.gov (United States)

Riadnova, I Iu; Shataeva, L K; Khavinson, V Kh

2000-01-01

A method of isolation of native nucleorprotein complexes from cattle cerebral cortex, thymus, and liver was developed. Compositions of these complexes were studied by means of gel-chromatography and ion-exchange chromatography. These preparations were shown to consist of several fractions of proteins and their complexes differ by molecular mass and electro-chemical properties. Native nucleoprotein complexes revealed high tissue specific activity, which was not species-specific.

Complex analysis and geometry

CERN Document Server

Silva, Alessandro

1993-01-01

The papers in this wide-ranging collection report on the results of investigations from a number of linked disciplines, including complex algebraic geometry, complex analytic geometry of manifolds and spaces, and complex differential geometry.

On Complex Random Variables

Directory of Open Access Journals (Sweden)

Anwer Khurshid

2012-07-01

Full Text Available Normal 0 false false false EN-US X-NONE X-NONE In this paper, it is shown that a complex multivariate random variable  is a complex multivariate normal random variable of dimensionality if and only if all nondegenerate complex linear combinations of  have a complex univariate normal distribution. The characteristic function of  has been derived, and simpler forms of some theorems have been given using this characterization theorem without assuming that the variance-covariance matrix of the vector  is Hermitian positive definite. Marginal distributions of  have been given. In addition, a complex multivariate t-distribution has been defined and the density derived. A characterization of the complex multivariate t-distribution is given. A few possible uses of this distribution have been suggested.

Complex Systems: An Introduction

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 9. Complex Systems: An Introduction - Anthropic Principle, Terrestrial Complexity, Complex Materials. V K Wadhawan. General Article Volume 14 Issue 9 September 2009 pp 894-906 ...

Development of sparse-seeded mutant kinnow (Citrus reticulata ...

African Journals Online (AJOL)

... crops like citrus, induced mutation for seedlessness in Kinnow with gamma irradiation of dormant bud which was attempted at the Nuclear Institute for Agriculture and Biology (NIAB), Faisalabad. Dormant bud irradiation-cum-grafting technique was employed, using the Citrus jambhiri rootstock for propagation of the scion.

"Neem het dier serieus als individu"

NARCIS (Netherlands)

Kleis, R.; Driessen, C.P.G.

2014-01-01

Ethiek op de boerderij komt het beste uit de verf door samen met dieren nieuwe technologie te ontwikkelen. Filosoof Clemens Driessen, de man van het varkensspel Pig Chase, promoveerde afgelopen week cum laude op Animal deliberation, the co-evolution of technology and ethics on the farm. Resource

Children's Representations of Family Relationships, Peer Information Processing, and School Adjustment

Science.gov (United States)

Bascoe, Sonnette M.; Davies, Patrick T.; Sturge-Apple, Melissa L.; Cummings, E. Mark

2009-01-01

This study examined children's peer information processing as an explanatory mechanism underlying the association between their insecure representations of interparental and parent-child relationships and school adjustment in a sample of 210 first graders. Consistent with emotional security theory (P. T. Davies & E. M. Cummings, 1994), results…

African Journal of AIDS Research - Vol 11, No 4 (2012)

African Journals Online (AJOL)

Older people living with HIV in Uganda: understanding their experience and needs · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Monica O Kuteesa, Janet Seeley, Robert G Cumming, Joel Negin. http://dx.doi.org/10.2989/16085906.2012.754829 ...

Sadhana | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Sadhana. PAUL CUMMING. Articles written in Sadhana. Volume 42 Issue 5 May 2017 pp 641-653. Improving EEG signal peak detection using feature weight learning of a neural network with random weights for eye event-related applications · ASRUL ADAM ZUWAIRIE IBRAHIM NORRIMA MOKHTAR ...

Collaborative Research to Optimize Warfighter Nutrition (CROWN)

Science.gov (United States)

2014-09-01

10.1002/oby.20075. PMID: 23592679 2. Margolis LM, Rood J, Champagne C, Young AJ, Castellani JW. Energy balance and body composition during US Army... Champagne , C., Carpentieri, D. M., Cummings, C. M., Young, A. J., Montain, S. J., & Scisco, J. L. (2014, November). Using an environmental

Simplicial complexes of graphs

CERN Document Server

Jonsson, Jakob

2008-01-01

A graph complex is a finite family of graphs closed under deletion of edges. Graph complexes show up naturally in many different areas of mathematics, including commutative algebra, geometry, and knot theory. Identifying each graph with its edge set, one may view a graph complex as a simplicial complex and hence interpret it as a geometric object. This volume examines topological properties of graph complexes, focusing on homotopy type and homology. Many of the proofs are based on Robin Forman's discrete version of Morse theory. As a byproduct, this volume also provides a loosely defined toolbox for attacking problems in topological combinatorics via discrete Morse theory. In terms of simplicity and power, arguably the most efficient tool is Forman's divide and conquer approach via decision trees; it is successfully applied to a large number of graph and digraph complexes.

Analytical Solution for the Anisotropic Rabi Model: Effects of Counter-Rotating Terms

Science.gov (United States)

Zhang, Guofeng; Zhu, Hanjie

2015-03-01

The anisotropic Rabi model, which was proposed recently, differs from the original Rabi model: the rotating and counter-rotating terms are governed by two different coupling constants. This feature allows us to vary the counter-rotating interaction independently and explore the effects of it on some quantum properties. In this paper, we eliminate the counter-rotating terms approximately and obtain the analytical energy spectrums and wavefunctions. These analytical results agree well with the numerical calculations in a wide range of the parameters including the ultrastrong coupling regime. In the weak counter-rotating coupling limit we find out that the counter-rotating terms can be considered as the shifts to the parameters of the Jaynes-Cummings model. This modification shows the validness of the rotating-wave approximation on the assumption of near-resonance and relatively weak coupling. Moreover, the analytical expressions of several physics quantities are also derived, and the results show the break-down of the U(1)-symmetry and the deviation from the Jaynes-Cummings model.

Differential regulation of catecholamine synthesis and transport in rat adrenal medulla by fluoxetine treatment.

Science.gov (United States)

Spasojevic, Natasa; Jovanovic, Predrag; Dronjak, Sladjana

2015-03-01

We have recently shown that chronic fluoxetine treatment acted significantly increasing plasma norepinephrine and epinephrine concentrations both in control and chronically stressed adult male rats. However, possible effects of fluoxetine on catecholamine synthesis and re-uptake in adrenal medulla have been largely unknown. In the present study the effects of chronic fluoxetine treatment on tyrosine hydroxylase, a rate-limiting enzyme in catecholamine synthesis, as well as a norepinephrine transporter and vesicular monoamine transporter 2 gene expressions in adrenal medulla of animals exposed to chronic unpredictable mild stress (CUMS) for 4 weeks, were investigated. Gene expression analyses were performed using a real-time quantitative reverse transcription-PCR. Chronically stressed animals had increased tyrosine hydroxylase mRNA levels and decreased expression of both transporters. Fluoxetine increased tyrosine hydroxylase and decreased norepinephrine transporter gene expression in both unstressed and CUMS rats. These findings suggest that chronic fluoxetine treatment increased plasma catecholamine levels by affecting opposing changes in catecholamine synthesis and uptake.

Differential regulation of catecholamine synthesis and transport in rat adrenal medulla by fluoxetine treatment

Directory of Open Access Journals (Sweden)

NATASA SPASOJEVIC

2015-03-01

Full Text Available We have recently shown that chronic fluoxetine treatment acted significantly increasing plasma norepinephrine and epinephrine concentrations both in control and chronically stressed adult male rats. However, possible effects of fluoxetine on catecholamine synthesis and re-uptake in adrenal medulla have been largely unknown. In the present study the effects of chronic fluoxetine treatment on tyrosine hydroxylase, a rate-limiting enzyme in catecholamine synthesis, as well as a norepinephrine transporter and vesicular monoamine transporter 2 gene expressions in adrenal medulla of animals exposed to chronic unpredictable mild stress (CUMS for 4 weeks, were investigated. Gene expression analyses were performed using a real-time quantitative reverse transcription-PCR. Chronically stressed animals had increased tyrosine hydroxylase mRNA levels and decreased expression of both transporters. Fluoxetine increased tyrosine hydroxylase and decreased norepinephrine transporter gene expression in both unstressed and CUMS rats. These findings suggest that chronic fluoxetine treatment increased plasma catecholamine levels by affecting opposing changes in catecholamine synthesis and uptake.

Remnant pancreatic parenchymal volume predicts postoperative pancreatic exocrine insufficiency after pancreatectomy.

Science.gov (United States)

Okano, Keisuke; Murakami, Yoshiaki; Nakagawa, Naoya; Uemura, Kenichiro; Sudo, Takeshi; Hashimoto, Yasushi; Kondo, Naru; Takahashi, Shinya; Sueda, Taijiro

2016-03-01

Pancreatectomy, including pancreatoduodenectomy and distal pancreatectomy, often causes postoperative pancreatic exocrine insufficiency (PEI). Our aim was to clarify a relationship between remnant pancreatic volume and postoperative PEI. A total of 227 patients who underwent pancreatoduodenectomy or distal pancreatectomy were enrolled in this study. All patients underwent a (13)C-labeled mixed triglyceride breath test to assess pancreatic exocrine function and abdominal dynamic computed tomography for assessing remnant pancreatic volume after pancreatectomy at a median of 7 months postoperatively. The percent (13)CO2 cumulative dose at 7 hours (% dose (13)C cum 7 h) pancreatectomy were performed in 174 (76.7%) and 53 (23.3%) patients, respectively. Of the 227 patients, 128 (56.3%) developed postoperative PEI. Postoperative % dose (13)C cum 7 h was strongly correlated with remnant pancreatic volume (r = .509, P pancreatectomy (P pancreatectomy. Remnant pancreatic volume may predict postoperative PEI in patients who undergo pancreatectomy. Copyright © 2016 Elsevier Inc. All rights reserved.

Approximate and Conditional Teleportation of an Unknown Atomic State Without Bell-State Measurement with Two-Photon Interaction

Institute of Scientific and Technical Information of China (English)

CHEN Chang-Yong

2006-01-01

A scheme for approximately and conditionally teleporting an unknown atomic state via two-photon interaction in cavity QED is proposed. It is the extension of the scheme of Ref. [11] [Phys. Rev. A 69 (2004) 064302], which is based on Jaynes-Cummings model in QED and where only a time point of system evolution and the corresponding fidelity implementing the teleportation are given. In our scheme, the two-photon interaction Jaynes-Cummings model is used to realize the approximate and conditional teleportation. Our scheme does not involve the Bell-state measurement and an additional atom, only requiring two atoms and one single-mode cavity. The fidelity of the scheme is higher than that of Ref. [11]. The scheme may be generalized to not only the teleportation of the state of a cavity mode to another mode by means of a single atom but also the teleportation of the state of a trapped ion.

Mutual preservation of entanglement

International Nuclear Information System (INIS)

Veitia, Andrzej; Jing, Jun; Yu, Ting; Wong, Chee Wei

2012-01-01

We study a generalized double Jaynes–Cummings (JC) model where two entangled pairs of two-level atoms interact indirectly. We show that there exist initial states of the qubit system so that two entangled pairs are available at all times. In particular, the minimum entanglement in the pairs as a function of the initial state is studied. Finally, we extend our findings to a model consisting of multi-mode atom–cavity interactions. We use a non-Markovian quantum state diffusion (QSD) equation to obtain the steady-state density matrix for the qubits. We show that the multi-mode model also displays dynamical preservation of entanglement. -- Highlights: ► Entanglement dynamics is studied in a generalized double Jaynes–Cummings model. ► We show that for certain initial states, the atoms remain entangled at all times. ► We extend the results to the case of multi-mode atom–cavity interactions. ► The model suggest that indirect interaction may help to preserve entanglement.

Actinide cation-cation complexes

International Nuclear Information System (INIS)

Stoyer, N.J.; Seaborg, G.T.

1994-12-01

The +5 oxidation state of U, Np, Pu, and Am is a linear dioxo cation (AnO 2 + ) with a formal charge of +1. These cations form complexes with a variety of other cations, including actinide cations. Other oxidation states of actinides do not form these cation-cation complexes with any cation other than AnO 2 + ; therefore, cation-cation complexes indicate something unique about AnO 2 + cations compared to actinide cations in general. The first cation-cation complex, NpO 2 + ·UO 2 2+ , was reported by Sullivan, Hindman, and Zielen in 1961. Of the four actinides that form AnO 2 + species, the cation-cation complexes of NpO 2 + have been studied most extensively while the other actinides have not. The only PuO 2 + cation-cation complexes that have been studied are with Fe 3+ and Cr 3+ and neither one has had its equilibrium constant measured. Actinides have small molar absorptivities and cation-cation complexes have small equilibrium constants; therefore, to overcome these obstacles a sensitive technique is required. Spectroscopic techniques are used most often to study cation-cation complexes. Laser-Induced Photacoustic Spectroscopy equilibrium constants for the complexes NpO 2 + ·UO 2 2+ , NpO 2 + ·Th 4+ , PuO 2 + ·UO 2 2+ , and PuO 2 + ·Th 4+ at an ionic strength of 6 M using LIPAS are 2.4 ± 0.2, 1.8 ± 0.9, 2.2 ± 1.5, and ∼0.8 M -1

Conducting metal dithiolate complexes

DEFF Research Database (Denmark)

Underhill, A. E.; Ahmad, M. M.; Turner, D. J.

1985-01-01

Further work on the chemical composition of the one-dimensional metallic metal dithiolene complex Li-Pt(mnt) is reported. The electrical conduction and thermopower properties of the nickel and palladium complexes are reported and compared with those of the platinum compound......Further work on the chemical composition of the one-dimensional metallic metal dithiolene complex Li-Pt(mnt) is reported. The electrical conduction and thermopower properties of the nickel and palladium complexes are reported and compared with those of the platinum compound...

Curcumin complexation with cyclodextrins by the autoclave process: Method development and characterization of complex formation.

Science.gov (United States)

Hagbani, Turki Al; Nazzal, Sami

2017-03-30

One approach to enhance curcumin (CUR) aqueous solubility is to use cyclodextrins (CDs) to form inclusion complexes where CUR is encapsulated as a guest molecule within the internal cavity of the water-soluble CD. Several methods have been reported for the complexation of CUR with CDs. Limited information, however, is available on the use of the autoclave process (AU) in complex formation. The aims of this work were therefore to (1) investigate and evaluate the AU cycle as a complex formation method to enhance CUR solubility; (2) compare the efficacy of the AU process with the freeze-drying (FD) and evaporation (EV) processes in complex formation; and (3) confirm CUR stability by characterizing CUR:CD complexes by NMR, Raman spectroscopy, DSC, and XRD. Significant differences were found in the saturation solubility of CUR from its complexes with CD when prepared by the three complexation methods. The AU yielded a complex with expected chemical and physical fingerprints for a CUR:CD inclusion complex that maintained the chemical integrity and stability of CUR and provided the highest solubility of CUR in water. Physical and chemical characterizations of the AU complexes confirmed the encapsulated of CUR inside the CD cavity and the transformation of the crystalline CUR:CD inclusion complex to an amorphous form. It was concluded that the autoclave process with its short processing time could be used as an alternate and efficient methods for drug:CD complexation. Copyright © 2017 Elsevier B.V. All rights reserved.

Complex analysis

CERN Document Server

Freitag, Eberhard

2005-01-01

The guiding principle of this presentation of ``Classical Complex Analysis'' is to proceed as quickly as possible to the central results while using a small number of notions and concepts from other fields. Thus the prerequisites for understanding this book are minimal; only elementary facts of calculus and algebra are required. The first four chapters cover the essential core of complex analysis: - differentiation in C (including elementary facts about conformal mappings) - integration in C (including complex line integrals, Cauchy's Integral Theorem, and the Integral Formulas) - sequences and series of analytic functions, (isolated) singularities, Laurent series, calculus of residues - construction of analytic functions: the gamma function, Weierstrass' Factorization Theorem, Mittag-Leffler Partial Fraction Decomposition, and -as a particular highlight- the Riemann Mapping Theorem, which characterizes the simply connected domains in C. Further topics included are: - the theory of elliptic functions based on...

Complexes and imagination.

Science.gov (United States)

Kast, Verena

2014-11-01

Fantasies as imaginative activities are seen by Jung as expressions of psychic energy. In the various descriptions of active imagination the observation of the inner image and the dialogue with inner figures, if possible, are important. The model of symbol formation, as Jung describes it, can be experienced in doing active imagination. There is a correspondence between Jung's understanding of complexes and our imaginations: complexes develop a fantasy life. Complex episodes are narratives of difficult dysfunctional relationship episodes that have occurred repeatedly and are internalized with episodic memory. This means that the whole complex episode (the image for the child and the image for the aggressor, connected with emotions) is internalized and can get constellated in everyday relationship. Therefore inner dialogues do not necessarily qualify as active imaginations, often they are the expression of complex-episodes, very similar to fruitless soliloquies. If imaginations of this kind are repeated, new symbols and new possibilities of behaviour are not found. On the contrary, old patterns of behaviour and fantasies are perpetuated and become cemented. Imaginations of this kind need an intervention by the analyst. In clinical examples different kinds of imaginations are discussed. © 2014, The Society of Analytical Psychology.

Journal of Chemical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

A combined sol-gel-cum-hydrothermalmethod has been employed to synthesize novelmonometallic (Mn, Fe, Co) and bimetallic (Co-Fe, Mn-Co, Fe-Mn) nanoparticles loaded onto Al₂O₃−MCM-41. Powder XRD, N2 sorption, field emission scanning electron microscopy (FESEM) and high resolution transmission electron ...

Somatostatin and dopamine receptors as molecular targets for the medical treatment of Cushing’s disease

NARCIS (Netherlands)

C. de Bruin (Christiaan)

2009-01-01

textabstractHarvey Williams Cushing (1869-1939) was born as the 10th child of a well-educated, puritanical medical family in Cleveland (figure 1). He attended Yale University, graduated cum laude from Harvard Medical School and was trained as a general surgeon at Johns Hopkins under the famous

Kristi Salve kaitses doktoriväitekirja / Mall Hiiemäe

Index Scriptorium Estoniae

Hiiemäe, Mall, 1937-

2000-01-01

Kristi Salve kaitses 20. dets.̀1999 Tartu Ülikooli kirjanduse ja rahvaluule osakonnanõukogu ees väitekirja : Läänemeresoomlaste traditsiooniline vaimne kultuur : pärimusliikide vahelised seosed ja etnilised suhted / Kristi Salve. Tartu, 1999. 287 lk. Talle omistati doktorikraad folkloristika alal hinnanguga summa cum laude

Resolving the African Development Sclerosis: Two Strategies, No ...

African Journals Online (AJOL)

User

2011-05-20

May 20, 2011 ... Commission for Africa (ECA) and the Organization of African Unity (OAU) ... The Lagos Plan of Action for the Economic Development of Africa, .... change and committed itself to an essential continuation of the status quo in ..... monopoly capitalism than poor countries (Brown and Cummings, 1984: 124).

Cavity quantum electrodynamics with a Rydberg-blocked atomic ensemble

DEFF Research Database (Denmark)

Guerlin, Christine; Brion, Etienne; Esslinger, Tilman

2010-01-01

The realization of a Jaynes-Cummings model in the optical domain is proposed for an atomic ensemble. The scheme exploits the collective coupling of the atoms to a quantized cavity mode and the nonlinearity introduced by coupling to high-lying Rydberg states. A two-photon transition resonantly cou...

Process development for gelatinisation and enzymatic hydrolysis of starch at high concentrations

NARCIS (Netherlands)

Baks, T.

2007-01-01

cum laude graduation (with distinction) Enzymatic hydrolysis of starch is encountered in day-to-day life for instance in the dishwasher during removal of stains with detergents or in our mouth during chewing of starch-based foods in the presence of saliva. The reaction is also important for the

Training the Twenty-First Century Special Forces Warrior: Does Character Matter When Training the Adaptive Leader

Science.gov (United States)

2006-06-16

whale that caused the ship to sink, forcing Marion and three others to take refuge in one of the lifeboats (Cummings 2005, 1). He spent a week on...disorder (2004, 4). The post-traumatic stress disorder then often spurs other addictive behaviors, increasing the inability to regain normalcy among

Author Details

African Journals Online (AJOL)

Ukagba, GU. Vol 7 (2010) - Articles Human Nature, Dirty Hands and Social Disorder: A Socio-Political Understanding of the Nigerian Society Abstract PDF · Vol 10 (2014) - Articles Feminism and human genetic engineering: A philosophical cum catholic perspective. Abstract PDF. ISSN: 1597-474X. AJOL African Journals ...

Beauty, a road to the truth

NARCIS (Netherlands)

Kuipers, T.A.F.

In this article I give a naturalistic-cum-formal analysis of the relation between beauty, empirical success, and truth. The analysis is based on the one hand on a hypothetical variant of the so-called 'mere-exposure effect' which has been more or less established in experimental psychology regarding

The Iconography of Universities as Institutional Narratives

Science.gov (United States)

Drori, Gili S.; Delmestri, Giuseppe; Oberg, Achim

2016-01-01

The coming of "brand society" and the onset of mediatization spur universities to strategize their visual identity and pay particular attention to their icon. Resulting from branding initiatives, university icons are visual self-representations and material-cum-symbolic forms of organizational identity. In this work we ask: What identity…

the role of force in state formation: a comparative analysis

African Journals Online (AJOL)

plt

of globalisation. We now proceed to the organisational characteristics of the military ... discipline cum self-sacrifice and patriotism, which are identified with the soldier, make the ... frame of mind to government, military leaders conceive of society in roughly the ..... See also Huntington, S. Political order in changing societies.

Leading healthcare in complexity.

Science.gov (United States)

Cohn, Jeffrey

2014-12-01

Healthcare institutions and providers are in complexity. Networks of interconnections from relationships and technology create conditions in which interdependencies and non-linear dynamics lead to surprising, unpredictable outcomes. Previous effective approaches to leadership, focusing on top-down bureaucratic methods, are no longer effective. Leading in complexity requires leaders to accept the complexity, create an adaptive space in which innovation and creativity can flourish and then integrate the successful practices that emerge into the formal organizational structure. Several methods for doing adaptive space work will be discussed. Readers will be able to contrast traditional leadership approaches with leading in complexity. They will learn new behaviours that are required of complexity leaders, along with challenges they will face, often from other leaders within the organization.

Analysis and control of complex dynamical systems robust bifurcation, dynamic attractors, and network complexity

CERN Document Server

Imura, Jun-ichi; Ueta, Tetsushi

2015-01-01

This book is the first to report on theoretical breakthroughs on control of complex dynamical systems developed by collaborative researchers in the two fields of dynamical systems theory and control theory. As well, its basic point of view is of three kinds of complexity: bifurcation phenomena subject to model uncertainty, complex behavior including periodic/quasi-periodic orbits as well as chaotic orbits, and network complexity emerging from dynamical interactions between subsystems. Analysis and Control of Complex Dynamical Systems offers a valuable resource for mathematicians, physicists, and biophysicists, as well as for researchers in nonlinear science and control engineering, allowing them to develop a better fundamental understanding of the analysis and control synthesis of such complex systems.

Modified projective synchronization with complex scaling factors of uncertain real chaos and complex chaos

International Nuclear Information System (INIS)

Zhang Fang-Fang; Liu Shu-Tang; Yu Wei-Yong

2013-01-01

To increase the variety and security of communication, we present the definitions of modified projective synchronization with complex scaling factors (CMPS) of real chaotic systems and complex chaotic systems, where complex scaling factors establish a link between real chaos and complex chaos. Considering all situations of unknown parameters and pseudo-gradient condition, we design adaptive CMPS schemes based on the speed-gradient method for the real drive chaotic system and complex response chaotic system and for the complex drive chaotic system and the real response chaotic system, respectively. The convergence factors and dynamical control strength are added to regulate the convergence speed and increase robustness. Numerical simulations verify the feasibility and effectiveness of the presented schemes. (general)

Selenophene transition metal complexes

Energy Technology Data Exchange (ETDEWEB)

White, Carter James [Iowa State Univ., Ames, IA (United States)

1994-07-27

This research shows that selenophene transition metal complexes have a chemistry that is similar to their thiophene analogs. Selenophene coordination has been demonstrated and confirmed by molecular structure in both the η⁵- and the η¹(Se)-coordination modes. The reaction chemistry of selenophene complexes closely resembles that of the analogous thiophene complexes. One major difference, however, is that selenophene is a better donor ligand than thiophene making the selenophene complexes more stable than the corresponding thiophene complexes. The ⁷⁷Se NMR chemical shift values for selenophene complexes fall within distinct regions primarily depending on the coordination mode of the selenophene ligand. In the final paper, the C-H bond activation of η¹(S)-bound thiophenes, η¹(S)-benzothiophene and η¹(Se)-bound selenophenes has been demonstrated. The deprotonation and rearrangement of the η¹(E)-bound ligand to the carbon bound L-yl complex readily occurs in the presence of base. Reprotonation with a strong acid gives a carbene complex that is unreactive towards nucleophilic attack at the carbene carbon and is stable towards exposure to air. The molecular structure of [Cp(NO)(PPh₃)Re(2-benzothioenylcarbene)]O₃SCF₃ was determined and contains a Re-C bond with substantial double bond character. Methyl substitution for the thienylcarbene or selenylcarbene gives a carbene that rearranges thermally to give back the η¹(E)-bound complex. Based on these model reactions, a new mechanism for the H/D exchange of thiophene over the hydrodesulfurization catalyst has been proposed.

Photocytotoxic lanthanide complexes

Indian Academy of Sciences (India)

Among many applications of lanthanides, gadolinium complexes are used as magnetic resonance imaging (MRI) contrast agents in clinical radiology and luminescent lanthanides for bioanalysis, imaging and sensing. The chemistry of photoactive lanthanide complexes showing biological applications is of recent origin.

Physical Complexity and Cognitive Evolution

Science.gov (United States)

Jedlicka, Peter

Our intuition tells us that there is a general trend in the evolution of nature, a trend towards greater complexity. However, there are several definitions of complexity and hence it is difficult to argue for or against the validity of this intuition. Christoph Adami has recently introduced a novel measure called physical complexity that assigns low complexity to both ordered and random systems and high complexity to those in between. Physical complexity measures the amount of information that an organism stores in its genome about the environment in which it evolves. The theory of physical complexity predicts that evolution increases the amount of `knowledge' an organism accumulates about its niche. It might be fruitful to generalize Adami's concept of complexity to the entire evolution (including the evolution of man). Physical complexity fits nicely into the philosophical framework of cognitive biology which considers biological evolution as a progressing process of accumulation of knowledge (as a gradual increase of epistemic complexity). According to this paradigm, evolution is a cognitive `ratchet' that pushes the organisms unidirectionally towards higher complexity. Dynamic environment continually creates problems to be solved. To survive in the environment means to solve the problem, and the solution is an embodied knowledge. Cognitive biology (as well as the theory of physical complexity) uses the concepts of information and entropy and views the evolution from both the information-theoretical and thermodynamical perspective. Concerning humans as conscious beings, it seems necessary to postulate an emergence of a new kind of knowledge - a self-aware and self-referential knowledge. Appearence of selfreflection in evolution indicates that the human brain reached a new qualitative level in the epistemic complexity.

Pioglitazone, a PPARγ agonist rescues depression associated with obesity using chronic unpredictable mild stress model in experimental mice

Directory of Open Access Journals (Sweden)

Yeshwant Kurhe

2016-06-01

Full Text Available Pioglitazone, a peroxisome proliferator activated receptor gamma (PPARγ agonist belonging to thiazolidinedione class, is mainly used in diabetes mellitus. Obese subjects are twice likely to become depressed than non-obese individuals. The biological mechanisms linking depression with obesity still remain poorly understood and there is immense need for better therapeutic intervention against such co-morbid disorders. The present study investigates the effect of pioglitazone on the chronic unpredictable mild stress (CUMS induced depression in obese mice by using behavioral tests and biochemical estimations. Mice were fed with high fat diet (HFD for 14 weeks and were further subjected to different stress procedures for 28 days to induce depressive behavior. Animals were administered orally with pioglitazone (30 mg/kg p.o./escitalopram (10 mg/kg p.o./vehicle (10 ml/kg p.o. daily from day 15–28. Various behavioral paradigms such as sucrose preference test, forced swim test (FST, tail suspension test (TST and elevated plus maze (EPM were performed. Biochemical estimations including plasma glucose, total cholesterol, triglycerides, and total proteins were performed. The data obtained from behavioral assays and biochemical assessments indicated that obese animals exhibited severe depressive-like behavior compared to non-obese animals. Furthermore, obese animals subjected to CUMS worsen the depressive behavior compared to obese control animals. Repetitive treatment with pioglitazone reversed the CUMS induced behavioral and biochemical alterations in HFD fed obese mice which atleast in part may be mediated through improving altered plasma glucose. The study suggests that pioglitazone needs further attention with respect to molecular mechanisms that could provide a better therapeutic strategy against depression associated with obesity.

Functionalized active-nucleus complex sensor

Science.gov (United States)

Pines, Alexander; Wemmer, David E.; Spence, Megan; Rubin, Seth

2003-11-25

A functionalized active-nucleus complex sensor that selectively associates with one or more target species, and a method for assaying and screening for one or a plurality of target species utilizing one or a plurality of functionalized active-nucleus complexes with at least two of the functionalized active-nucleus complexes having an attraction affinity to different corresponding target species. The functionalized active-nucleus complex has an active-nucleus and a targeting carrier. The method involves functionalizing an active-nucleus, for each functionalized active-nucleus complex, by incorporating the active-nucleus into a macromolucular or molecular complex that is capable of binding one of the target species and then bringing the macromolecular or molecular complexes into contact with the target species and detecting the occurrence of or change in a nuclear magnetic resonance signal from each of the active-nuclei in each of the functionalized active-nucleus complexes.

Complex Neutrosophic Subsemigroups and Ideals

Directory of Open Access Journals (Sweden)

Muhammad Gulistan

2018-01-01

Full Text Available In this article we study the idea of complex neutrosophic subsemigroups. We define the Cartesian product of complex neutrosophic subsemigroups, give some examples and study some of its related results. We also define complex neutrosophic (left, right, interior ideal in semigroup. Furthermore, we introduce the concept of characteristic function of complex neutrosophic sets, direct product of complex neutrosophic sets and study some results prove on its.

Transition Complexity of Incomplete DFAs

Directory of Open Access Journals (Sweden)

Yuan Gao

2010-08-01

Full Text Available In this paper, we consider the transition complexity of regular languages based on the incomplete deterministic finite automata. A number of results on Boolean operations have been obtained. It is shown that the transition complexity results for union and complementation are very different from the state complexity results for the same operations. However, for intersection, the transition complexity result is similar to that of state complexity.

Subsumed complexity: abiogenesis as a by-product of complex energy transduction

Science.gov (United States)

Adam, Z. R.; Zubarev, D.; Aono, M.; Cleaves, H. James

2017-11-01

The origins of life bring into stark relief the inadequacy of our current synthesis of thermodynamic, chemical, physical and information theory to predict the conditions under which complex, living states of organic matter can arise. Origins research has traditionally proceeded under an array of implicit or explicit guiding principles in lieu of a universal formalism for abiogenesis. Within the framework of a new guiding principle for prebiotic chemistry called subsumed complexity, organic compounds are viewed as by-products of energy transduction phenomena at different scales (subatomic, atomic, molecular and polymeric) that retain energy in the form of bonds that inhibit energy from reaching the ground state. There is evidence for an emergent level of complexity that is overlooked in most conceptualizations of abiogenesis that arises from populations of compounds formed from atomic energy input. We posit that different forms of energy input can exhibit different degrees of dissipation complexity within an identical chemical medium. By extension, the maximum capacity for organic chemical complexification across molecular and macromolecular scales subsumes, rather than emerges from, the underlying complexity of energy transduction processes that drive their production and modification. This article is part of the themed issue 'Reconceptualizing the origins of life'.

Spectroscopy of plutonium-organic complexes

International Nuclear Information System (INIS)

Richmann, M.K.; Reed, D.T.

1995-01-01

Information on the spectroscopy of plutonium-organic complexes is needed to help establish the speciation of these complexes under environmentally relevant conditions. Laser photoacoustic spectroscopy (LPAS) and absorption spectrometry were used to characterize the Pu(IV)-citrate and Pu(IV)-nitrilotriacetic acid (NTA) complexes at concentrations of 10 -3 --10 -7 M in aqueous solution. Good agreement was observed between the band shape of the LPAS and absorption spectra for the Pu(IV)-NTA complex. Agreement for the Pu(IV)-citrate complex was not quite as good. In both cases, a linear dependence of the LPAS signal on laser power and total concentration of the complexes was noted. This work is part of an ongoing research effort to study key subsurface interactions of plutonium-organic complexes

Complex Networks IX

CERN Document Server

Coronges, Kate; Gonçalves, Bruno; Sinatra, Roberta; Vespignani, Alessandro; Proceedings of the 9th Conference on Complex Networks; CompleNet 2018

2018-01-01

This book aims to bring together researchers and practitioners working across domains and research disciplines to measure, model, and visualize complex networks. It collects the works presented at the 9th International Conference on Complex Networks (CompleNet) 2018 in Boston, MA in March, 2018. With roots in physical, information and social science, the study of complex networks provides a formal set of mathematical methods, computational tools and theories to describe prescribe and predict dynamics and behaviors of complex systems. Despite their diversity, whether the systems are made up of physical, technological, informational, or social networks, they share many common organizing principles and thus can be studied with similar approaches. This book provides a view of the state-of-the-art in this dynamic field and covers topics such as group decision-making, brain and cellular connectivity, network controllability and resiliency, online activism, recommendation systems, and cyber security.

What is complex in the complex world? Niklas Luhmann and the theory of social systems

Directory of Open Access Journals (Sweden)

Clarissa Eckert Baeta Neves

Full Text Available This paper discusses Niklas Luhmann's understanding of complexity, its function in the theory and the different ways of its use. It starts with the paradigmatic change that occurred in the field of general Science, with the rupture of the Newtonian model. In the 20th century, the paradigm of order, symmetry, regularity, regulation of the intellect to things, collapses.Based on new formulations of Physics, Chemistry, etc., a new universe is built on bases radically opposed to those of modern Science.Chaos, the procedural irreversibility, indeterminism, the observer and the complexity are rehabilitated.This new conceptual context served as substratum to Niklas Luhmann's theoretical reflection.With his Theory of Social Systems, he proposes the reduction of the world's complexity.Social systems have the function of reducing complexity because of their difference in relation to the environment.On the other hand, the reduction of complexity also creates its own complexity. Luhmann defines complexity as the moment when it is not possible anymore for each element to relate at any moment with all the others. Complexity forces the selection, what means contingency and risk. Luhmann expands the concept of complexity when he introduces the figure of the observer and the distinction of complexity as a unit of a multiplicity. He also deals with the limit of relations in connection, the time factor, the self-reference of operations and the representation of complexity in the form of sense. To conclude, the paper discusses the complexity in the system of science, the way it reduces internal and external complexity, in accordance in its own operative basis.

Complexity Leadership: A Theoretical Perspective

Science.gov (United States)

Baltaci, Ali; Balci, Ali

2017-01-01

Complex systems are social networks composed of interactive employees interconnected through collaborative, dynamic ties such as shared goals, perspectives and needs. Complex systems are largely based on "the complex system theory". The complex system theory focuses mainly on finding out and developing strategies and behaviours that…

Organotin complexes with phosphines

International Nuclear Information System (INIS)

Passos, B. de F.T.; Jesus Filho, M.F. de; Filgueiras, C.A.L.; Abras, A.

1988-01-01

A series of organotin complexes was prepared involving phosphines bonded to the organotin moiety. The series include derivatives of SnCl x Ph 4-x (where x varied from zero to four with the phosphines Ph 3 P, (Ph 2 P)CH 2 , (Ph 2 P) 2 (CH 2 ) 2 , cis-(Ph 2 P)CH 2 , and CH 3 C(CH 2 PPh 2 ) 3 . A host of new complexes was obtained, showing different stoichiometries, bonding modes, and coordination numbers around the tin atom. These complexes were characterized by several different chemical and physical methods. The 119 Sn Moessbauer parameters varied differently. Whereas isomer shift values did not great variation for each group of complexs with the same organotin parent (SnCl x Ph 4-x ), reflecting a small change in s charge distribution on the Sn atom upon complexation, quadrupole splitting results varied widely, however, when the parent organotin compound was wholly symmetric (SnCl 4 and SnPPh 4 ), the complexes also tended to show quadrupole splitting values approaching zero. (author)

Nuclear weapons complex

International Nuclear Information System (INIS)

Rezendes, V.S.

1992-04-01

In addition to long-standing safety and environmental problems plaguing the nuclear weapons complex, this paper reports that the Department of Energy (DOE) faces a major new challenge-how to reconfigure the weapons complex to meet the nation's defense needs in the 21st century. Key decisions still need to be made about the size of the complex; where, if necessary, to relocate various operations; what technologies to use for new tritium production; and what to do with excess weapons-grade material. The choices confronting DOE and Congress are difficult given the conflicting demands for limited resources

The Orion complex

International Nuclear Information System (INIS)

Goudis, C.

1982-01-01

This work deals with some of the most typical complexes of interstellar matter and presents a holistic view of the well studied complexes in Orion, built on information derived from various branches of modern astrophysics. A wealth of published data is presented in the form of photographs, contour maps, diagrams and numerous heavily annotated tables. Chapter 1, which is concerned with the large scale view of the Orion region, outlines the morphology of the area and examines in particular the nature of Barnard's Loop and the associated filamentary structure in addition to the origin of the I Orion OB association. Chapter 2 focuses on the Great Orion Nebula (M42 or NGC 1976) and the small H II region to the north (M43 or NGC 1982). Chapter 3 examines the Orion Complex as a whole, i.e. the H II regions M42 and M43, the associated molecular clouds OMC 1 and OMC 2 and their interrelations. Chapter 4 contains a discussion of the empirical models introduced to attempt to explain certain aspects of this very complex region, and chapter 5 investigates the second prominent H II region and molecular cloud complex, NGC 2024 (Orion B, W12). (Auth.)

Algorithmic Relative Complexity

Directory of Open Access Journals (Sweden)

Daniele Cerra

2011-04-01

Full Text Available Information content and compression are tightly related concepts that can be addressed through both classical and algorithmic information theories, on the basis of Shannon entropy and Kolmogorov complexity, respectively. The definition of several entities in Kolmogorov’s framework relies upon ideas from classical information theory, and these two approaches share many common traits. In this work, we expand the relations between these two frameworks by introducing algorithmic cross-complexity and relative complexity, counterparts of the cross-entropy and relative entropy (or Kullback-Leibler divergence found in Shannon’s framework. We define the cross-complexity of an object x with respect to another object y as the amount of computational resources needed to specify x in terms of y, and the complexity of x related to y as the compression power which is lost when adopting such a description for x, compared to the shortest representation of x. Properties of analogous quantities in classical information theory hold for these new concepts. As these notions are incomputable, a suitable approximation based upon data compression is derived to enable the application to real data, yielding a divergence measure applicable to any pair of strings. Example applications are outlined, involving authorship attribution and satellite image classification, as well as a comparison to similar established techniques.

Embracing uncertainty, managing complexity: applying complexity thinking principles to transformation efforts in healthcare systems.

Science.gov (United States)

Khan, Sobia; Vandermorris, Ashley; Shepherd, John; Begun, James W; Lanham, Holly Jordan; Uhl-Bien, Mary; Berta, Whitney

2018-03-21

Complexity thinking is increasingly being embraced in healthcare, which is often described as a complex adaptive system (CAS). Applying CAS to healthcare as an explanatory model for understanding the nature of the system, and to stimulate changes and transformations within the system, is valuable. A seminar series on systems and complexity thinking hosted at the University of Toronto in 2016 offered a number of insights on applications of CAS perspectives to healthcare that we explore here. We synthesized topics from this series into a set of six insights on how complexity thinking fosters a deeper understanding of accepted ideas in healthcare, applications of CAS to actors within the system, and paradoxes in applications of complexity thinking that may require further debate: 1) a complexity lens helps us better understand the nebulous term "context"; 2) concepts of CAS may be applied differently when actors are cognizant of the system in which they operate; 3) actor responses to uncertainty within a CAS is a mechanism for emergent and intentional adaptation; 4) acknowledging complexity supports patient-centred intersectional approaches to patient care; 5) complexity perspectives can support ways that leaders manage change (and transformation) in healthcare; and 6) complexity demands different ways of implementing ideas and assessing the system. To enhance our exploration of key insights, we augmented the knowledge gleaned from the series with key articles on complexity in the literature. Ultimately, complexity thinking acknowledges the "messiness" that we seek to control in healthcare and encourages us to embrace it. This means seeing challenges as opportunities for adaptation, stimulating innovative solutions to ensure positive adaptation, leveraging the social system to enable ideas to emerge and spread across the system, and even more important, acknowledging that these adaptive actions are part of system behaviour just as much as periods of stability are. By

Complexity in practice: understanding primary care as a complex adaptive system

Directory of Open Access Journals (Sweden)

Beverley Ellis

2010-06-01

Conclusions The results are real-world exemplars of the emergent properties of complex adaptive systems. Improving clinical governance in primary care requires both complex social interactions and underpinning informatics. The socio-technical lessons learned from this research should inform future management approaches.

Resveratrol ameliorates chronic unpredictable mild stress-induced depression-like behavior: involvement of the HPA axis, inflammatory markers, BDNF, and Wnt/β-catenin pathway in rats

Directory of Open Access Journals (Sweden)

Yang X

2017-10-01

Full Text Available Xin-Hua Yang,1 Su-Qi Song,2 Yun Xu3 1Department of Pharmacy, Hefei Eighth People’s Hospital, Hefei, 2Department of Psychiatry, Chaohu Hospital of Anhui Medical University, Hefei, 3Faculty of Pharmacy, Anhui Medical University, Hefei, China Abstract: Classic antidepressant drugs are modestly effective across the population and most are associated with intolerable side effects. Recently, numerous lines of evidence suggest that resveratrol (RES, a natural polyphenol, possesses beneficial therapeutic activity for depression. The aim of the present study was to explore whether RES exhibits an antidepressant-like effect in a depression model and to explore the possible mechanism. A depression model was established via chronic unpredictable mild stress (CUMS, after which the model rats in the RES and fluoxetine groups received a daily injection of RES or fluoxetine, respectively. The sucrose preference test, open field test, and forced swimming test were used to explore the antidepressant-like effects of RES. The activity of the hypothalamic–pituitary–adrenal (HPA axis was evaluated by detecting the plasma corticosterone concentration and hypothalamic mRNA expression of corticotrophin-releasing hormone. The plasma interleukin-6 (IL-6, C-reactive protein (CRP, and tumor necrosis factor-α (TNF-α concentrations were measured by enzyme-linked immunosorbent assay. Hippocampal protein expression of brain-derived neurotrophic factor (BDNF and the Wnt/β-catenin pathway were analyzed by western blot. The results showed that RES relieved depression-like behavior of CUMS rats, as indicated by the increased sucrose preference and the decreased immobile time. Rats that received RES treatment exhibited reduced plasma corticosterone levels and corticotrophin-releasing hormone mRNA expression in the hypothalamus, suggesting that the hyperactivity of the HPA axis in CUMS rats was reversed by RES. Moreover, after RES treatment, the rats exhibited increased

Shapes of interacting RNA complexes

DEFF Research Database (Denmark)

Fu, Benjamin Mingming; Reidys, Christian

2014-01-01

Shapes of interacting RNA complexes are studied using a filtration via their topological genus. A shape of an RNA complex is obtained by (iteratively) collapsing stacks and eliminating hairpin loops.This shape-projection preserves the topological core of the RNA complex and for fixed topological...... genus there are only finitely many such shapes. Our main result is a new bijection that relates the shapes of RNA complexes with shapes of RNA structures. This allows to compute the shape polynomial of RNA complexes via the shape polynomial of RNA structures. We furthermore present a linear time uniform...... sampling algorithm for shapes of RNA complexes of fixed topological genus....

Technetium-aspirin molecule complexes

International Nuclear Information System (INIS)

El-Shahawy, A.S.; Mahfouz, R.M.; Aly, A.A.M.; El-Zohry, M.

1993-01-01

Technetium-aspirin and technetium-aspirin-like molecule complexes were prepared. The structure of N-acetylanthranilic acid (NAA) has been decided through CNDO calculations. The ionization potential and electron affinity of the NAA molecule as well as the charge densities were calculated. The electronic absorption spectra of Tc(V)-Asp and Tc(V)-ATS complexes have two characteristic absorption bands at 450 and 600 nm, but the Tc(V)-NAA spectrum has one characteristic band at 450 nm. As a comparative study, Mo-ATS complex was prepared and its electronic absorption spectrum is comparable with the Tc-ATS complex spectrum. (author)

The pervasive reach of resource-bounded Kolmogorov complexity in computational complexity theory

Czech Academy of Sciences Publication Activity Database

Allender, E.; Koucký, Michal; Ronneburger, D.; Roy, S.

2011-01-01

Roč. 77, č. 1 (2011), s. 14-40 ISSN 0022-0000 R&D Projects: GA ČR GAP202/10/0854; GA MŠk(CZ) 1M0545; GA AV ČR IAA100190902 Institutional research plan: CEZ:AV0Z10190503 Keywords : Circuit complexity * Distinguishing complexity * FewEXP * Formula size * Kolmogorov complexity Subject RIV: BA - General Mathematics Impact factor: 1.157, year: 2011 http://www.sciencedirect.com/science/article/pii/S0022000010000887

Spectral simplicity of apparent complexity. II. Exact complexities and complexity spectra

Science.gov (United States)

Riechers, Paul M.; Crutchfield, James P.

2018-03-01

The meromorphic functional calculus developed in Part I overcomes the nondiagonalizability of linear operators that arises often in the temporal evolution of complex systems and is generic to the metadynamics of predicting their behavior. Using the resulting spectral decomposition, we derive closed-form expressions for correlation functions, finite-length Shannon entropy-rate approximates, asymptotic entropy rate, excess entropy, transient information, transient and asymptotic state uncertainties, and synchronization information of stochastic processes generated by finite-state hidden Markov models. This introduces analytical tractability to investigating information processing in discrete-event stochastic processes, symbolic dynamics, and chaotic dynamical systems. Comparisons reveal mathematical similarities between complexity measures originally thought to capture distinct informational and computational properties. We also introduce a new kind of spectral analysis via coronal spectrograms and the frequency-dependent spectra of past-future mutual information. We analyze a number of examples to illustrate the methods, emphasizing processes with multivariate dependencies beyond pairwise correlation. This includes spectral decomposition calculations for one representative example in full detail.

obstetric performance of elderly primigravida in jos university

African Journals Online (AJOL)

Administrator

30. Jos Journal of Medicine, Volume 9 No. 1. OBSTETRIC PERFORMANCE OF ... at time of delivery to that of nulliparous women aged 20-34 years old in Jos University ... prospective study was carried out on allprimigravid women with singleton ..... Total. 411. 100.0%. 100.0%. Pregnancy outcome. Frequency. Percent. Cum.

Maternal Warmth and Early Adolescents' Internalizing Symptoms and Externalizing Behavior: Mediation via Emotional Insecurity

Science.gov (United States)

Alegre, Albert; Benson, Mark J.; Pérez-Escoda, Núria

2014-01-01

This study examines the relation between maternal warmth and the internalizing and externalizing problems of early adolescents, and the potential mediation of this relation by emotional insecurity. The hypotheses for the study derive from Cummings and Davies' theory of emotional security. The current study extends the theory to security processes…

Fulltext PDF

Indian Academy of Sciences (India)

the students. There are tennis, badminton, volleyball, and basketball courts on campus, a cricket-cum-football ground nearby, plus indoor table-tennis for those interested in sports. Nearby sal forests, a small patch of scrub vegetation on campus, are the regular haunt of the campus ornithologists and naturalists. Besides this ...

Spin squeezing and Schrödinger cat generation in atomic samples with Rydberg blockade

DEFF Research Database (Denmark)

Opatrný, Tomáš; Mølmer, Klaus

2012-01-01

A scheme is proposed to prepare squeezed states and Schrödinger-cat-like states of the collective spin degrees of freedom associated with a pair of ground states in an atomic ensemble. The scheme uses an effective Jaynes-Cummings interaction which can be provided by excitation of the atoms...

research note the oestrous response and changes in plasma ...

African Journals Online (AJOL)

Refercnces. FAURE, A.S., 1975. Vroeii embrionale verlies weens wanvoeding by Meino skape. M. Sc. (Landbou) Tesis. Universiteit van Stellenbosch. FINDLAY, J.K. & CUMMING, J.A., 1976. lncrease in ovulation rate in sheep following administration of an LHRH analogue. Biol. Repr. 15, I15. HARESIGN, W., FOSTER, J.P., ...

ACHP | News | President Appoints Clement A. Price Vice Chairman of ACHP

Science.gov (United States)

appreciation of the nation's diverse cultural heritage will be greatly aided by Dr. Price's expertise." Jersey in 1999. In 2008 Price received the second annual Charles Cummings award from the Trustees of the contributions to the knowledge and appreciation of Newark history. Price will receive the oath of office and

Domain Endurants: An Analysis and Description Process Model

DEFF Research Database (Denmark)

Bjørner, Dines

2014-01-01

We present a summary, Sect. 2, of a structure of domain analysis and description concepts: techniques and tools. And we link, in Sect. 3, these concepts, embodied in domain analysis prompts and domain description prompts, in a model of how a diligent domain analyser cum describer would use them. We...

Decisionmaking in Operation Iraqi Freedom: Removing Saddam Hussein by Force

Science.gov (United States)

2010-02-01

have been to abandon diplomacy, but British Prime Minister Tony Blair warned that without a second resolution (or, at least, a serious effort to... Robbins and Jeanne Cummings, “New Doctrine: How Bush Decided That Iraq’s Hussein Must Be Ousted,” Wall Street Journal, June 14, 2002. 58. National

Adolescent Substance Abuse.

Science.gov (United States)

Thorne, Craig R.; DeBlassie, Richard R.

1985-01-01

Cummings (1979), citing evidence from the National Institute of Drug Abuse, reports that one of every eleven adult Americans suffers from a severe addictive problem. Drug addiction is epidemic among teenagers; one of every six teenagers suffers from a severe addictive problem. This paper focuses on adolescent drug/substance abuse. (Author)

The alternative sigma factor sigmaB and the stress response of Bacillus cereus

NARCIS (Netherlands)

Schaik, van W.

2005-01-01

cum laude graduation (with distinction) The bacterium Bacillus cereus is responsible for a large number of cases of foodborne illness across the world. It is also an important cause of spoilage of food, in particular of milk and dairy-products. The growth and survival of B. cereus in food or during

Immiseration Capitalism, Activism and Education: Resistance, Revolt and Revenge

Science.gov (United States)

Hill, Dave

2012-01-01

This is a panoptic paper in five parts. In Part One, Immiseration Capitalism, I examine the current neoliberal cum neoconservative austerity capitalism and its "class war from above", in particular its resultant relative immiseration and its absolute immiseration, with particular reference to Greece, Ireland, Britain and the USA. In Part…

Oil shale energy and some alternatives in Estonia

International Nuclear Information System (INIS)

Oepik, I.

2002-01-01

An academic lecture delivered by prof. Ilmar Oepik at the Thermal Engineering Department of Tallinn Technical University in Dec. 2000 to mark the 120 semesters since the cum laude diploma of a mechanical engineer discusses about ineffective utilization of oil shale and developing renewable resources as an alternative to oil shale

Designing the Bayous: The Control of Water in the Atchafalaya Basin 1800-1995

Science.gov (United States)

1998-01-01

with the levee board and the doctrine of equitable estoppel 166 Designing the Bayous eliminated any requirement by the federal government to pay for...Homer S. Cummings to Secretary of War George H. Oem, Washington, D.C., 5 September 1933. The doctrine of equitable estoppel asserts that a party’s

Complexity of formation in holography

International Nuclear Information System (INIS)

Chapman, Shira; Marrochio, Hugo; Myers, Robert C.

2017-01-01

It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.

Complexity of formation in holography

Energy Technology Data Exchange (ETDEWEB)

Chapman, Shira [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Marrochio, Hugo [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Department of Physics & Astronomy and Guelph-Waterloo Physics Institute,University of Waterloo, Waterloo, ON N2L 3G1 (Canada); Myers, Robert C. [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada)

2017-01-16

It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.

Lanthanide complexes with pivaloylacetone

International Nuclear Information System (INIS)

Eliseeva, S.V.; Chugarov, N.V.; Kuz'mina, N.P.; Martynenko, L.I.; Nichiporuk, R.V.; Ivanov, S.A.

2003-01-01

Complexes Ln(pa) 3 ·2H 2 O (Ln=La, Gd, Lu, Hpa - pivaloylacetone) are synthesized and investigated by the methods of element, IR spectroscopic and thermal analyses. Behaviour of the complexes during heating in vacuum is compared with such one for acetylacetonates and dipivaloylmethanates. Structure of the complexes in solution is studied by 1 H NMR and MALDI-MS [ru

Complexity Control of Fast Motion Estimation in H.264/MPEG-4 AVC with Rate-Distortion-Complexity optimization

DEFF Research Database (Denmark)

Wu, Mo; Forchhammer, Søren; Aghito, Shankar Manuel

2007-01-01

A complexity control algorithm for H.264 advanced video coding is proposed. The algorithm can control the complexity of integer inter motion estimation for a given target complexity. The Rate-Distortion-Complexity performance is improved by a complexity prediction model, simple analysis of the pa...... statistics and a control scheme. The algorithm also works well for scene change condition. Test results for coding interlaced video (720x576 PAL) are reported.......A complexity control algorithm for H.264 advanced video coding is proposed. The algorithm can control the complexity of integer inter motion estimation for a given target complexity. The Rate-Distortion-Complexity performance is improved by a complexity prediction model, simple analysis of the past...

Aryldiazo complexes. Syntheses and reactions of new complexes of osmium and ruthenium

International Nuclear Information System (INIS)

Haymore, B.L.; Ibers, J.A.

1975-01-01

Aryldiazo complexes, [M(CO) 2 (NNPh)(PPh 3 ) 2 ][PF 6 ](M = Os, Ru; Ph = C 6 H 5 ), were prepared by allowing diazonium salts to react with M(CO) 3 (PPh 3 ) 2 . Infrared spectra of the Ru complex suggest the presence of two isomers both in solution and in the solid state. These complexes react with a variety of coordinating anions (X - ), to form MX(CO) 2 (NNPh)(PPh 3 ) 2 . The osmium derivatives have ν(NN) near 1455 cm -1 , which is the lowest value yet reported for a nonbridging aryldiazo ligand. The first aryldiazo--hydrido complexes, MH(CO) 2 (NNPh)(PPh 3 ) 2 and MH(CO)(NNPh)(PPh 3 ) 2 , were prepared by deprotonation of the respective phenyldiazene complexes, MH(CO) 2 (HNNPh)(PPh 3 ) 2 + and MH(CO)(HNNPh)(PPh 3 ) 3 + . The compound OsCl 3 (NNPh)(PPh 3 ) 2 was also prepared. A large number of the foregoing complexes were synthesized with selective 2 H and 15 N labels. Infrared and NMR spectra show MX(CO) 2 (NNPh)(PPh 3 ) 2 and the analogous hydrido complex to be pseudooctahedral with trans phosphine ligands, cis carbonyl ligands, and a doubly bent phenyldiazenido (NNPh - ) ligand. Similarly, MH(CO)(NNPh)(PPh 3 ) 2 possesses a trigonal-bipyramidal geometry with trans phosphine ligands and an equatorial, singly bent phenyldiazoniumato (NNPh + ) ligand. Isotopic substitution of the diazo ligand shows that ν(NN) is often vibrationally coupled with phenyl vibrational modes and that two or three bands sometimes shift upon 15 N substitution. Vibrational coupling was also observed in the higher energy region (1850 to 1900 cm -1 ) in the compound RuCl 3 (NNC 6 D 5 )(PPh 3 ) 2 . The wide range in the values of ν(NN), RuCl 3 (NNPh)(PPh 3 ) 2 (1882 cm -1 ) vs. RuCl(CO) 2 (NNPh)(PPh 3 ) 2 (1462 cm -1 ), indicates that the N--N stretching frequencies are sensitive to the electronic and steric environment of the diazo ligand. The aryldiazo complexes are compared with analogous, isoelectronic nitrosyl complexes of Os and Ru

Visual Short-Term Memory Complexity

DEFF Research Database (Denmark)

Sørensen, Thomas Alrik

of objective complexity, it seems that subjective complexity - which is dependent on the familiarity of the stimulus - plays a more important role than the objective visual complexity of the objects stored. In two studies, we explored how familiarity influences the capacity of VSTM. 1) In children learning...... and Cavanagh (2004) have raised the question that the capacity of VSTM is dependent on visual complexity rather than the number of objects. We hypothesise that VSTM capacity is dependent on both the objective and subjective complexity of visual stimuli. Contrary to Alvarez and Cavanagh, who argue for the role...... for letters and pictures remained similar. Our results indicate that VSTM capacity for familiar items is larger irrespective of visual complexity....

Complexity: Outline of the NWO strategic theme Dynamics of complex systems

NARCIS (Netherlands)

Burgers, G.; Doelman, A.; Frenken, K.; Hogeweg, P.; Hommes, C.; van der Maas, H.; Mulder, B.; Stam, K.; van Steen, M.; Zandee, L.

2008-01-01

Dynamics of complex systems is one of the program 5 themes in the NWO (Netherlands Organisation for Scientific Research) strategy for the years 2007-2011. The ambition of the current proposal is to initiate integrated activities in the field of complex systems within the Netherlands, to provide

Complexity : outline of the NWO strategic theme dynamics of complex systems

NARCIS (Netherlands)

Burgers, G.; Doelman, A.; Frenken, K.; Hogeweg, P.; Hommes, C.; Maas, van der H.; Mulder, B.; Stam, K.; Steen, van M.; Zandee, L.

2008-01-01

Dynamics of complex systems is one of the program 5 themes in the NWO (Netherlands Organisation for Scientific Research) strategy for the years 2007-2011. The ambition of the current proposal is to initiate integrated activities in the field of complex systems within the Netherlands, to provide

Coopetition and Complexity : Exploring a Coopetitive Relationship with Complexity

OpenAIRE

Wennberg, Andreas; Persson, Emil

2011-01-01

Cooperation have in previous research been seen as a negative impact on competition and  vice versa. This thesis is building on a concept called coopetition in which cooperation and  competition is studied simultaneously. Coopetition have been studied in terms of the level of  cooperation and competition. However, we found a possible link between coopetition and  complexity in previous literature. Thus, the purpose of this study is to explore whether  complexity can develop an understanding f...

Complexity and Control: Towards a Rigorous Behavioral Theory of Complex Dynamical Systems

Science.gov (United States)

Ivancevic, Vladimir G.; Reid, Darryn J.

We introduce our motive for writing this book on complexity and control with a popular "complexity myth," which seems to be quite wide spread among chaos and complexity theory fashionistas: quote>Low-dimensional systems usually exhibit complex behaviours (which we know fromMay's studies of the Logisticmap), while high-dimensional systems usually exhibit simple behaviours (which we know from synchronisation studies of the Kuramoto model)...quote> We admit that this naive view on complex (e.g., human) systems versus simple (e.g., physical) systems might seem compelling to various technocratic managers and politicians; indeed, the idea makes for appealing sound-bites. However, it is enough to see both in the equations and computer simulations of pendula of various degree - (i) a single pendulum, (ii) a double pendulum, and (iii) a triple pendulum - that this popular myth is plain nonsense. The only thing that we can learn from it is what every tyrant already knows: by using force as a strong means of control, it is possible to effectively synchronise even hundreds of millions of people, at least for a while.

Group 4 Metalloporphyrin diolato Complexes and Catalytic Application of Metalloporphyrins and Related Transition Metal Complexes

Energy Technology Data Exchange (ETDEWEB)

Du, Guodong [Iowa State Univ., Ames, IA (United States)

2003-01-01

In this work, the first examples of group 4 metalloporphyrin 1,2-diolato complexes were synthesized through a number of strategies. In general, treatment of imido metalloporphyrin complexes, (TTP)M=NR, (M = Ti, Zr, Hf), with vicinal diols led to the formation of a series of diolato complexes. Alternatively, the chelating pinacolate complexes could be prepared by metathesis of (TTP)MCl₂ (M = Ti, Hf) with disodium pinacolate. These complexes were found to undergo C-C cleavage reactions to produce organic carbonyl compounds. For titanium porphyrins, treatment of a titanium(II) alkyne adduct, (TTP)Ti(η²-PhC≡CPh), with aromatic aldehydes or aryl ketones resulted in reductive coupling of the carbonyl groups to produce the corresponding diolato complexes. Aliphatic aldehydes or ketones were not reactive towards (TTP)Ti(η²-PhC≡CPh). However, these carbonyl compounds could be incorporated into a diolato complex on reaction with a reactive precursor, (TTP)Ti[O(Ph)₂C(Ph)₂O] to provide unsymmetrical diolato complexes via cross coupling reactions. In addition, an enediolato complex (TTP)Ti(OCPhCPhO) was obtained from the reaction of (TTP)Ti(η²-PhC≡CPh) with benzoin. Titanium porphyrin diolato complexes were found to be intermediates in the (TTP)Ti=O-catalyzed cleavage reactions of vicinal diols, in which atmospheric oxygen was the oxidant. Furthermore, (TTP)Ti=O was capable of catalyzing the oxidation of benzyl alcohol and α-hydroxy ketones to benzaldehyde and α-diketones, respectively. Other high valent metalloporphyrin complexes also can catalyze the oxidative diol cleavage and the benzyl alcohol oxidation reactions with dioxygen. A comparison of Ti(IV) and Sn(IV) porphyrin chemistry was undertaken. While chelated diolato complexes were invariably obtained for titanium porphyrins on treatment with 1,2-diols, the reaction of vicinal diols with tin porphyrins gave a number of products, including mono

Thinking in complexity the complex dynamics of matter, mind, and mankind

CERN Document Server

Mainzer, Klaus

1994-01-01

The theory of nonlinear complex systems has become a successful and widely used problem-solving approach in the natural sciences - from laser physics, quantum chaos and meteorology to molecular modeling in chemistry and computer simulations of cell growth in biology In recent times it has been recognized that many of the social, ecological and political problems of mankind are also of a global, complex and nonlinear nature And one of the most exciting topics of present scientific and public interest is the idea that even the human mind is governed largely by the nonlinear dynamics of complex systems In this wide-ranging but concise treatment Prof Mainzer discusses, in nontechnical language, the common framework behind these endeavours Special emphasis is given to the evolution of new structures in natural and cultural systems and it is seen clearly how the new integrative approach of complexity theory can give new insights that were not available using traditional reductionistic methods

Clearing the complexity: immune complexes and their treatment in lupus nephritis

Directory of Open Access Journals (Sweden)

Catherine Toong

2011-01-01

Full Text Available Catherine Toong1, Stephen Adelstein1, Tri Giang Phan21Department of Clinical Immunology, Royal Prince Alfred Hospital, Missenden Rd, Camperdown, NSW, Australia; 2Immunology Program, Garvan Institute of Medical Research and St. Vincent’s Clinical School, University of New South Wales, Darlinghurst, NSW, AustraliaAbstract: Systemic lupus erythematosus (SLE is a classic antibody-mediated systemic autoimmune disease characterised by the development of autoantibodies to ubiquitous self-antigens (such as antinuclear antibodies and antidouble-stranded DNA antibodies and widespread deposition of immune complexes in affected tissues. Deposition of immune complexes in the kidney results in glomerular damage and occurs in all forms of lupus nephritis. The development of nephritis carries a poor prognosis and high risk of developing end-stage renal failure despite recent therapeutic advances. Here we review the role of DNA-anti-DNA immune complexes in the pathogenesis of lupus nephritis and possible new treatment strategies aimed at their control.Keywords: immune complex, systemic lupus erythematosus, nephritis, therapy

Subgroup complexes

CERN Document Server

Smith, Stephen D

2011-01-01

This book is intended as an overview of a research area that combines geometries for groups (such as Tits buildings and generalizations), topological aspects of simplicial complexes from p-subgroups of a group (in the spirit of Brown, Quillen, and Webb), and combinatorics of partially ordered sets. The material is intended to serve as an advanced graduate-level text and partly as a general reference on the research area. The treatment offers optional tracks for the reader interested in buildings, geometries for sporadic simple groups, and G-equivariant equivalences and homology for subgroup complexes.

Adaptive control for a class of nonlinear complex dynamical systems with uncertain complex parameters and perturbations.

Directory of Open Access Journals (Sweden)

Jian Liu

Full Text Available In this paper, adaptive control is extended from real space to complex space, resulting in a new control scheme for a class of n-dimensional time-dependent strict-feedback complex-variable chaotic (hyperchaotic systems (CVCSs in the presence of uncertain complex parameters and perturbations, which has not been previously reported in the literature. In detail, we have developed a unified framework for designing the adaptive complex scalar controller to ensure this type of CVCSs asymptotically stable and for selecting complex update laws to estimate unknown complex parameters. In particular, combining Lyapunov functions dependent on complex-valued vectors and back-stepping technique, sufficient criteria on stabilization of CVCSs are derived in the sense of Wirtinger calculus in complex space. Finally, numerical simulation is presented to validate our theoretical results.

Adaptive control for a class of nonlinear complex dynamical systems with uncertain complex parameters and perturbations.

Science.gov (United States)

Liu, Jian; Liu, Kexin; Liu, Shutang

2017-01-01

In this paper, adaptive control is extended from real space to complex space, resulting in a new control scheme for a class of n-dimensional time-dependent strict-feedback complex-variable chaotic (hyperchaotic) systems (CVCSs) in the presence of uncertain complex parameters and perturbations, which has not been previously reported in the literature. In detail, we have developed a unified framework for designing the adaptive complex scalar controller to ensure this type of CVCSs asymptotically stable and for selecting complex update laws to estimate unknown complex parameters. In particular, combining Lyapunov functions dependent on complex-valued vectors and back-stepping technique, sufficient criteria on stabilization of CVCSs are derived in the sense of Wirtinger calculus in complex space. Finally, numerical simulation is presented to validate our theoretical results.

Complexity a very short introduction

CERN Document Server

Holland, John H

2014-01-01

The importance of complexity is well-captured by Hawking's comment: "Complexity is the science of the 21st century". From the movement of flocks of birds to the Internet, environmental sustainability, and market regulation, the study and understanding of complex non-linear systems has become highly influential over the last 30 years. In this Very Short Introduction, one of the leading figures in the field, John Holland, introduces the key elements and conceptual framework of complexity. From complex physical systems such as fluid flow and the difficulties of predicting weather, to complex adaptive systems such as the highly diverse and interdependent ecosystems of rainforests, he combines simple, well-known examples - Adam Smith's pin factory, Darwin's comet orchid, and Simon's 'watchmaker' - with an account of the approaches, involving agents and urn models, taken by complexity theory. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost eve...

Quantifying Complexity in Quantum Phase Transitions via Mutual Information Complex Networks.

Science.gov (United States)

Valdez, Marc Andrew; Jaschke, Daniel; Vargas, David L; Carr, Lincoln D

2017-12-01

We quantify the emergent complexity of quantum states near quantum critical points on regular 1D lattices, via complex network measures based on quantum mutual information as the adjacency matrix, in direct analogy to quantifying the complexity of electroencephalogram or functional magnetic resonance imaging measurements of the brain. Using matrix product state methods, we show that network density, clustering, disparity, and Pearson's correlation obtain the critical point for both quantum Ising and Bose-Hubbard models to a high degree of accuracy in finite-size scaling for three classes of quantum phase transitions, Z_{2}, mean field superfluid to Mott insulator, and a Berzinskii-Kosterlitz-Thouless crossover.

Quantifying Complexity in Quantum Phase Transitions via Mutual Information Complex Networks

Science.gov (United States)

Valdez, Marc Andrew; Jaschke, Daniel; Vargas, David L.; Carr, Lincoln D.

2017-12-01

We quantify the emergent complexity of quantum states near quantum critical points on regular 1D lattices, via complex network measures based on quantum mutual information as the adjacency matrix, in direct analogy to quantifying the complexity of electroencephalogram or functional magnetic resonance imaging measurements of the brain. Using matrix product state methods, we show that network density, clustering, disparity, and Pearson's correlation obtain the critical point for both quantum Ising and Bose-Hubbard models to a high degree of accuracy in finite-size scaling for three classes of quantum phase transitions, Z2, mean field superfluid to Mott insulator, and a Berzinskii-Kosterlitz-Thouless crossover.

Innovation in a complex environment

Directory of Open Access Journals (Sweden)

René Pellissier

2012-11-01

Objectives: The study objectives were, firstly, to establish the determinants for complexity and how these can be addressed from a design point of view in order to ensure innovation success and, secondly, to determine how this changes innovation forms and applications. Method: Two approaches were offered to deal with a complex environment – one allowing for complexity for organisational innovation and the other introducing reductionism to minimise complexity. These approaches were examined in a qualitative study involving case studies, open-ended interviews and content analysis between seven developing economy (South African organisations and seven developed economy (US organisations. Results: This study presented a proposed framework for (organisational innovation in a complex environment versus a framework that minimises complexity. The comparative organisational analysis demonstrated the importance of initiating organisational innovation to address internal and external complexity, with the focus being on the leadership actions, their selected operating models and resultant organisational innovations designs, rather than on technological innovations. Conclusion: This study cautioned the preference for technological innovation within organisations and suggested alternative innovation forms (such as organisational and management innovation be used to remain competitive in a complex environment.

COMPLEX PROMOTIONSIN RETAIL

Directory of Open Access Journals (Sweden)

O. Yusupova

2015-10-01

Full Text Available Complex promotions used by retailers introduce to the consumers several rules that must be satisfied in order to get some benefits and usually refer to multiple products (e.g. “buy two, get one free”. Rules of complex promotions can be quite sophisticated and complicated themselves. Since diversity of complex promotions limited only by marketers’ imagination we can observe broad variety of promotions’ rules and representa¬tions of those rules in retailers’ commercials. Such diversification makes no good for fellow scientist who’s trying to sort all type of promotions into the neatly organized classification. Although we can simple add every single set of rules offered by retailers as a separate form of sales promotion it seems not to be the best way of dealing with such a problem. The better way is to realize that mechanisms underlying that variety of promotions are basically the same, namely changes in demand or quantity demanded. Those two concepts alone provide powerful insight into classification of complex promotions and allow us to comprehend the variety of promotions offered by marketers nowadays.

Nuclear weapons complex

International Nuclear Information System (INIS)

Peach, J.D.

1991-02-01

In this paper, GAO provides its views on DOE's January 1991 Nuclear Weapons Complex Reconfiguration Study. GAO believes that DOE's new reconfiguration study provides a starting point for reaching agreement on solutions to many of the complex's problems. Key decisions still need to be made about the size of the complex, where to relocate plutonium operations, what technologies should be used for new tritium production, and what to do with excess plutonium. The total cost for reconfiguring and modernizing is still uncertain and some management issues remain unresolved. Congress faces a difficult task in making these decisions given the conflicting demands for scare resources in a time of growing budget deficits and war in the Persian Gulf

The SEA complex – the beginning

Directory of Open Access Journals (Sweden)

Dokudovskaya S. S.

2012-07-01

Full Text Available The presence of distinctive internal membrane compartments, dynamically connected via selective transport pathways, is a hallmark of eukaryotic cells. Many of the proteins required for formation and maintenance of these compartments share an evolutionary history. We have recently identified a new conserved protein complex – the SEA complex – that possesses proteins with structural characteristics similar to the membrane coating complexes such as the nuclear pore complex (NPC, the COPII vesicle coating complex and HOPS/CORVET tethering complexes. The SEA complex in yeast is dynamically associated to the vacuole. The data on the function of the SEA complex remain extremely limited. Here we will discuss a possible role of the SEA complex based on the data from genetic assays and a number of functional studies in both yeast and other eukaryotes.

United States Air Force F-35A Operational Basing Environmental Impact Statement. Appendix E: Final EIS Public Comments and Responses

Science.gov (United States)

2013-09-01

Virginia Cryan Essex Junction VT R-PCS-8187 David and Dale Piper Middlebury VT R-PCS-2224 Manuel Cueto Colchester VT R-PCS-5615 Dan Pipes Fairfield... Cruz South Burlington VT R-PCOY-0218 Mohet Cruz South Burlington VT R-PCOY-0180 Don Cummings South Burlington VT R-PCOY-0113 Rene Cusson South

Die uitbouing van die Bybelse kanon in antieke Judaïsme en die ...

African Journals Online (AJOL)

31 Jul 2015 ... die oer-Christelike boodskap tot by sy Ou Testamentiese wortels, die geskrifte van Israel wat cum grano salis die 'Bybel' van die oer-Christendom geword het en die blywende verwysingspunt van die Christelike boodskap is. Erkenning. Hierdie artikel is vertaal na Afrikaans deur Prof. Jan G. van der Watt.

Toward a Historical Archaeology of West African Borderlands ...

African Journals Online (AJOL)

Whereas, the ethnographic cum archival study of West African borderlands abounds in the literature, there is the dearth of the comparative analysis of these sources in tandem with the archaeological findings of material culture. Thus, this paper seeks to open up a new dialogue on the importance of borderlands studies in ...

Students' Perceptions of the Usefulness of an E-Book with Annotative and Sharing Capabilities as a Tool for Learning: A Case Study

Science.gov (United States)

Lim, Ee-Lon; Hew, Khe Foon

2014-01-01

E-books offer a range of benefits to both educators and students, including ease of accessibility and searching capabilities. However, the majority of current e-books are repository-cum-delivery platforms of textual information. Hitherto, there is a lack of empirical research that examines e-books with annotative and sharing capabilities. This…

Opportunities Green Roofs Can Offer Ghanaians and their Cities

African Journals Online (AJOL)

Lone Star College System

2015-08-17

Aug 17, 2015 ... rising faster than the daily maximum thereby decreasing the comfort index of city dwellers. Electricity ... also on the rise. Green roofs have ..... by 6%. In Central Florida in the U.S., Cummings et al. .... levels, provision of habitat for animals and plants and .... representation of the Mediterranean Sea. Bull.

Histopathological study on the effect of rice herbicides on grass carp ...

African Journals Online (AJOL)

user

2011-02-14

Feb 14, 2011 ... observe the impact of herbicides on the histopathology of the fish, the fingerlings were collected from the field trenches ... is almost non-existent in India; the reasons being that increasing ... intensive rice-cum-fish culture offered the opportunity for ..... Toxicity of herbicides to Malaysian rice field fish. In: Proc.

The imperative of a new social contract through the technology of mind

African Journals Online (AJOL)

The progress of neuro/computer science makes it clear that sometime during the 21st century, man as a technology-driven being will master the technologies of mind and of life. Man will build machines more intelligent than man and modify human brains and bodies to increase intelligence. This scientific cum ...

SOUTH AFRICA AND THE WAR AGAINST JAPAN 1941-1945

African Journals Online (AJOL)

Second World War contain few details of South . Africans who served in the Far East. Commander. H.R. Gordon-Cumming's unpublished Official His- tory of the SA Naval Forces in the Second World. War 1939-1945 includes narratives of the two South. African ships which served in the Far East, HMSAS. BARBRAKE.

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Pramana – Journal of Physics. M M Golshan. Articles written in Pramana – Journal of Physics. Volume 80 Issue 5 May 2013 pp 785-796. Collapse revival behaviour of the entanglement between V-type three-level atoms and two-mode photons in nonlinear Jaynes–Cummings model · M Mohjoei M M ...

Ergonomic Based Design and Survey of Elementary School Furniture

Science.gov (United States)

Maheshwar; Jawalkar, Chandrashekhar S.

2014-01-01

This paper presents the ergonomic aspects in designing and prototyping of desks cum chairs used in elementary schools. The procedures adopted for the assessment included: the study of existing school furniture, design analysis and development of prototypes. The design approach proposed a series of adjustable desks and chairs developed in terms of…

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

We have exactly solved a model of equidistant cascade four-level system interacting with a single-mode radiation field both semiclassically and quantum mechanically by exploiting its similarity with Jaynes-Cummings model. For the classical field, it is shown that the Rabi oscillation of the system initially in the first level ...

A Comparative Study of Academic Staff Teaching Activities between Japan and China: Based on National Surveys in 2011-2012. RIHE International Seminar Reports. No. 23

Science.gov (United States)

Huang, Futao

2015-01-01

A review of recent literature suggests that, although academics in several countries (such as Japan, Korea and Germany) now allocate more of their time to research, service activities and administration than they had in the early 1990s (Teichler, Arimoto, and Cummings, 2013), the majority of university professors still spend the largest proportion…

Qubit Complexity of Continuous Problems

National Research Council Canada - National Science Library

Papageorgiou, A; Traub, J. F

2005-01-01

.... The authors show how to obtain the classical query complexity for continuous problems. They then establish a simple formula for a lower bound on the qubit complexity in terms of the classical query complexity...

Innovation in a complex environment

Directory of Open Access Journals (Sweden)

René Pellissier

2012-02-01

Full Text Available Background: As our world becomes more global and competitive yet less predictable, the focus seems to be increasingly on looking to innovation activities to remain competitive. Although there is little doubt that a nation’s competitiveness is embedded in its innovativeness, the complex environment should not be ignored. Complexity is not accounted for in balance sheets or reported in reports; it becomes entrenched in every activity in the organisation. Innovation takes many forms and comes in different shapes.Objectives: The study objectives were, firstly, to establish the determinants for complexity and how these can be addressed from a design point of view in order to ensure innovation success and, secondly, to determine how this changes innovation forms and applications.Method: Two approaches were offered to deal with a complex environment – one allowing for complexity for organisational innovation and the other introducing reductionism to minimise complexity. These approaches were examined in a qualitative study involving case studies, open-ended interviews and content analysis between seven developing economy (South African organisations and seven developed economy (US organisations.Results: This study presented a proposed framework for (organisational innovation in a complex environment versus a framework that minimises complexity. The comparative organisational analysis demonstrated the importance of initiating organisational innovation to address internal and external complexity, with the focus being on the leadership actions, their selected operating models and resultant organisational innovations designs, rather than on technological innovations.Conclusion: This study cautioned the preference for technological innovation within organisations and suggested alternative innovation forms (such as organisational and management innovation be used to remain competitive in a complex environment. 

SCAR/WAVE: A complex issue.

Science.gov (United States)

Davidson, Andrew J; Insall, Robert H

2013-11-01

The SCAR/WAVE complex drives the actin polymerisation that underlies protrusion of the front of the cell and thus drives migration. However, it is not understood how the activity of SCAR/WAVE is regulated to generate the infinite range of cellular shape changes observed during cell motility. What are the relative roles of the subunits of the SCAR/WAVE complex? What signaling molecules do they interact with? And how does the complex integrate all this information in order to control the temporal and spatial polymerisation of actin during protrusion formation? Unfortunately, the interdependence of SCAR complex members has made genetic dissection hard. In our recent paper,(1) we describe stabilization of the Dictyostelium SCAR complex by a small fragment of Abi. Here we summarize the main findings and discuss how this approach can help reveal the inner workings of this impenetrable complex.

Complex manifolds

CERN Document Server

Morrow, James

2006-01-01

This book, a revision and organization of lectures given by Kodaira at Stanford University in 1965-66, is an excellent, well-written introduction to the study of abstract complex (analytic) manifolds-a subject that began in the late 1940's and early 1950's. It is largely self-contained, except for some standard results about elliptic partial differential equations, for which complete references are given. -D. C. Spencer, MathSciNet The book under review is the faithful reprint of the original edition of one of the most influential textbooks in modern complex analysis and geometry. The classic

Hypoxia targeting copper complexes

International Nuclear Information System (INIS)

Dearling, J.L.

1998-11-01

The importance and incidence of tumour hypoxia, its measurement and current treatments available, including pharmacological and radiopharmacological methods of targeting hypoxia, are discussed. A variety of in vitro and in vivo methods for imposing hypoxia have been developed and are reviewed. Copper, its chemistry, biochemistry and radiochemistry, the potential for use of copper radionuclides and its use to date in this field is considered with particular reference to the thiosemicarbazones. Their biological activity, metal chelation, in vitro and in vivo studies of their radiocopper complexes and the potential for their use as hypoxia targeting radiopharmaceuticals is described. The reduction of the copper(II) complex to copper(l), its pivotal importance in their biological behaviour, and the potential for manipulation of this to effect hypoxia selectivity are described. An in vitro method for assessing the hypoxia selectivity of radiopharmaceuticals is reported. The rapid deoxygenation and high viability of a mammalian cell culture in this system is discussed and factors which may affect the cellular uptake of a radiopharmaceutical are described. The design, synthesis and complexation with copper and radiocopper of a range of bis(thiosemicarbazones) is reported. Synthesis of these compounds is simple giving high yields of pure products. The characteristics of the radiocopper complexes ( 64 Cu) including lipophilicity and redox activity are reported (reduction potentials in the range -0.314 - -0.590 V). High cellular uptakes of the radiocopper complexes of the ligands, in hypoxic and normoxic EMT6 and CHO320 cells, were observed. Extremes of selectivity are shown ranging from the hypoxia selective 64 Cu(II)ATSM to normoxic cell selective 64 Cu(II)GTS. The selectivities observed are compared with the physico chemical characteristics of the complexes. A good correlation exists between selectivity of the complex and its Cu(II)/Cu(I) reduction potential, with hypoxia

Complex Systems and Dependability

CERN Document Server

Zamojski, Wojciech; Sugier, Jaroslaw

2012-01-01

Typical contemporary complex system is a multifaceted amalgamation of technical, information, organization, software and human (users, administrators and management) resources. Complexity of such a system comes not only from its involved technical and organizational structure but mainly from complexity of information processes that must be implemented in the operational environment (data processing, monitoring, management, etc.). In such case traditional methods of reliability analysis focused mainly on technical level are usually insufficient in performance evaluation and more innovative meth

Complexity Management - A multiple case study analysis on control and reduction of complexity costs

DEFF Research Database (Denmark)

Myrodia, Anna

of products, with features more custom-made to cover individual needs, both regarding characteristics of products and support services. This necessity leads to a considerable increase of the complexity in the company, which affects the product portfolio, production and supply chain, market segments......, IT systems, and business processes. In order to identify and eliminate complexity, several approaches are used, both by researchers and practitioners. The purpose of this thesis is to contribute to the existing knowledge of complexity management theory. This research focuses on the relationship between......Complexity tends to be arguably the biggest challenge of manufacturing companies. The motivation of further studying complexity is a combination between the existing literature and the practical experiences from the industry. Based on the latest trend companies are trying to supply a growing mix...

On dependence of stability of lanthanum complexes with aminopolycarboxylic acids on the complex structure

International Nuclear Information System (INIS)

Poluehktov, N.S.; Meshkova, S.B.; Danilkovich, M.M.; Topilova, Z.M.

1985-01-01

Regularities in changes of stability constants of lanthanum complexes with aminopolycarboxylic acids (APA) versus their structure are studied, The stability of lathanum-APA complexes depends mainly on the number of carboxyl groups in a ligand molecule. At that, the highest stability constant is characteristic of a complex with a ligand, containing 3 nitrogen atoms and 5 carboxyl groups, in the presenoe of which the lanthanum ion coordination sphere gets satupated. The oxyethy group introduction into a ligand molecule also improves the lanthanum complex stability but to a lesser degree than during the introduction of a carboxyl group. The number of nitrogen atoms in a ligand polecule affects insignificantly the complex stability constant value, and the elongation of a chain of CH 2 groups, separating nitrogen atoms, reduces the constant to a -0.6 power

Complex Projective Synchronization in Drive-Response Stochastic Complex Networks by Impulsive Pinning Control

Directory of Open Access Journals (Sweden)

Xuefei Wu

2014-01-01

Full Text Available The complex projective synchronization in drive-response stochastic coupled networks with complex-variable systems is considered. The impulsive pinning control scheme is adopted to achieve complex projective synchronization and several simple and practical sufficient conditions are obtained in a general drive-response network. In addition, the adaptive feedback algorithms are proposed to adjust the control strength. Several numerical simulations are provided to show the effectiveness and feasibility of the proposed methods.

Microscopic theory of photon-correlation spectroscopy in strong-coupling semiconductors

Energy Technology Data Exchange (ETDEWEB)

Schneebeli, Lukas

2009-11-27

While many quantum-optical phenomena are already well established in the atomic systems, like the photon antibunching, squeezing, Bose-Einstein condensation, teleportation, the quantum-optical investigations in semiconductors are still at their beginning. The fascinating results observed in the atomic systems inspire physicists to demonstrate similar quantum-optical effects also in the semiconductor systems. In contrast to quantum optics with dilute atomic gases, the semiconductors exhibit a complicated many-body problem which is dominated by the Coulomb interaction between the electrons and holes and by coupling with the semiconductor environment. This makes the experimental observation of similar quantum-optical effects in semiconductors demanding. However, there are already experiments which have verified nonclassical effects in semiconductors. In particular, experiments have demonstrated that semiconductor quantum dots (QDs) can exhibit the single-photon emission and generation of polarization-entangled photon pairs. In fact, both atom and QD systems, embedded within a microcavity, have become versatile platforms where one can perform systematic quantum-optics investigations as well as development work toward quantum-information applications. Another interesting field is the strong-coupling regime in which the light-matter coupling exceeds both the decoherence rate of the atom or QD and the cavity resulting in a reversible dynamics between light and matter excitations. In the strong-coupling regime, the Jaynes-Cummings ladder is predicted and shows a photon-number dependent splitting of the new dressed strong-coupling states which are the polariton states of the coupled light-matter system. Although the semiclassical effect of the vacuum Rabi splitting has already been observed in QDs, the verification of the quantum-mechanical Jaynes-Cummings splitting is still missing mainly due to the dephasing. Clearly, the observation of the Jaynes-Cummings ladder in QDs

MANAGEMENT OF SPORT COMPLEXES

Directory of Open Access Journals (Sweden)

Marian STAN

2015-07-01

Full Text Available The actuality of the investigated theme. Nowadays, human evolution, including his intellectual development, proves the fact that especially the creation manpower and the employment was the solution of all life’s ambitions in society. So, the fact is that in reality, man is the most important capital of the society. Also, in an individual’s life, the practice of sport plays a significant role and that’s why the initiation, the launch and the management of sports complexes activity reveal the existence of specific management features that we will identify and explain in the current study. The aim of the research refers to the elaboration of a theoretical base of the management of the sport complexes, to the pointing of the factors that influence the efficient existence and function of a sport complex in our country and to the determination of the responsibilities that have a manager who directs successfully the activity of the sport complexes. The investigation is based on theoretical methods, such as: scientific documentation, analysis, synthesis, comparison and on empirical research methods, like: study of researched literature and observation. The results of the research indicate the fact that the profitability of a sport complex must assure a particular structure to avoid the bankruptcy risk and also, that the administration of the sport complexes activity must keep in view the reliable functions of the contemporaneous management.

COMPLEXITY AND UNIVERSITY

Directory of Open Access Journals (Sweden)

Edna Lemes Martins Pereira

2013-12-01

Full Text Available Economic globalization affects different countries on the globe, has positive effects mainly related to access to communication, which promotes the exchange of ideas, information, products and quality of life. However, extends numerous negative aspects such as marginalization, economic dependencies, political, cultural, scientific, educational accentuate social inequalities and cultural conflicts and territorial. In this article it is a dialogue with authors (Cunha 2009; BARNETT 2005; MORIN 1999, 2006, among others, who understand these changes in society from the contemporary world as conceived as the "Complexity era" or "supercomplexity". To understand and cope with this reality, they propose a paradigm that is able to overcome the fragmentation and reductionism of knowledge and to relate the multiple approaches and visions to meet the complexity of reality. Although this paper presents proposals to the aforementioned authors point to education and the university found in this tangle of interconnected global transformations, given the need to be subject to act in a complex reality that requires critical and self-critical professionals, able to think about their own ability to think, understand and act within this complex context.

Cooperativity of complex salt bridges

OpenAIRE

Gvritishvili, Anzor G.; Gribenko, Alexey V.; Makhatadze, George I.

2008-01-01

The energetic contribution of complex salt bridges, in which one charged residue (anchor residue) forms salt bridges with two or more residues simultaneously, has been suggested to have importance for protein stability. Detailed analysis of the net energetics of complex salt bridge formation using double- and triple-mutant cycle analysis revealed conflicting results. In two cases, it was shown that complex salt bridge formation is cooperative, i.e., the net strength of the complex salt bridge...

Piper sarmentosum Roxb. produces antidepressant-like effects in rodents, associated with activation of the CREB-BDNF-ERK signaling pathway and reversal of HPA axis hyperactivity.

Science.gov (United States)

Li, Qing; Qu, Fa-Lin; Gao, Yue; Jiang, Yi-Ping; Rahman, Khalid; Lee, Kuo-Hsiung; Han, Ting; Qin, Lu-Ping

2017-03-06

There are many plants of genus Piper which have been reported to induce antidepressant-like effects, Piper sarmentosum (PS) is one of them. PS is a Chinese herbal medicine and a traditional edible vegetable. In the present study, the antidepressant-like effects of PS extracts and the ethyl acetate fraction of PS extracts (PSY) were assessed using the open field test (OFT), forced swimming test (FST), and tail suspension test (TST) in mice. Furthermore, we applied a 4 consecutive weeks of chronic unpredictable mild stress (CUMS) as a model of depression in rats, followed by a sucrose preference test. Then we examined the possible mechanisms of this action. The activity of the hypothalamic-pituitary-adrenal (HPA) axis was evaluated by detecting the serum corticosterone (CORT) concentrations, and the protein expression levels of brain-derived neurotrophic factor (BDNF), the phosphorylated form CREB and ERK1/2 were detected by qRT-PCR or Western blot. The results showed that PS extracts (100, 200mg/kg) and PSY (12.5, 25, 50mg/kg) treatment produced antidepressant-like effects in mice similar to fluoxetine (20mg/kg), indicated by the reduced immobility time in the FST and TST, while both had no influence on the locomotor activity in the OFT. PSY treatment significantly increased sucrose preference and reduced serum CORT levels in CUMS rats. Moreover, PSY up-regulated BDNF protein levels, and increased CREB and ERK phosphorylation levels in the hippocampus on CUMS rats. These findings suggest that the antidepressant-like effects of PS extracts and PSY are mediated, at least in part, by modulating HPA axis, BDNF, CREB and ERK phosphorylation and expression in the hippocampus. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

Local hyperthermia of cervical N2/N3 lymph node metastases - a phase-I/II-study

International Nuclear Information System (INIS)

Stahl, H.; Wust, P.; Graf, R.; Loeffel, J.; Bier, J.; Riess, H.; Jahnke, V.; Felix, R.

1997-01-01

50 patients with primary advanced, recurrent or persistent N2/N3 lymph node metastases were treated with microwave hyperthermia in addition to their standard therapy (radiotherapy or radiochemotherapy). For the thermometry, closed-end catheters were implanted in the cervical lesions under CT monitoring. Temperature/time and temperature/position curves were analysed with regard to power density, effective perfusion, tissue depth, index temperatures T 90 , T 50 , T 20 , cum min T 60 ≥40.5 C, and equ min T 90 at 43 C. Radiation dose, total irradiation time and chemotherapy were also recorded as therapy parameters. Repeated CT scans for assessing response were taken for a subgroup of 32 patients following primary potentially curative radiotherapy (with and without chemotherapy) and local hyperthermia. All therapy parameters were subjected to a variance analysis with regard to response. At a tissue depth of 3 cm, relative and absolute power densities were on average of 50% less than at the surface. Therapeutic temperature increases of more than 4 C (i.e. more than 41 C) were not reached at tissue depths greater than 5 cm. The effective perfusion under local hyperthermia is significantly higher than under basal conditions. The mean T 90 was 39.9 C, and the mean T 20 value was 42.3 C. T 90 , cum min T 90 ≥40.5 C, equ min T 90 43 C, radiation dose and total irradiation time have a significant influence on response. The tumor volume correlates negatively with response, and this results in the thermal gradients correlating negatively with response and survival. The quality of the temperature distribution, represented by the value of cum min T 90 ≥40.5 C, showed a tendency to correlate positively with the survival in the subgroup of patients who underwent primary therapy. (orig./AJ) [de

Study of complex modes

International Nuclear Information System (INIS)

Pastrnak, J.W.

1986-01-01

This eighteen-month study has been successful in providing the designer and analyst with qualitative guidelines on the occurrence of complex modes in the dynamics of linear structures, and also in developing computer codes for determining quantitatively which vibration modes are complex and to what degree. The presence of complex modes in a test structure has been verified. Finite element analysis of a structure with non-proportional dumping has been performed. A partial differential equation has been formed to eliminate possible modeling errors

Managing complexity insights, concepts, applications

CERN Document Server

Helbing, Dirk

2007-01-01

Each chapter in Managing Complexity focuses on analyzing real-world complex systems and transferring knowledge from the complex-systems sciences to applications in business, industry and society. The interdisciplinary contributions range from markets and production through logistics, traffic control, and critical infrastructures, up to network design, information systems, social conflicts and building consensus. They serve to raise readers' awareness concerning the often counter-intuitive behavior of complex systems and to help them integrate insights gained in complexity research into everyday planning, decision making, strategic optimization, and policy. Intended for a broad readership, the contributions have been kept largely non-technical and address a general, scientifically literate audience involved in corporate, academic, and public institutions.

The Application of Statistical Turbulence Theory to Convective Instabilities.

Science.gov (United States)

1986-11-01

WHITE SANDS MISSILE RANGE DEPARTMENT OF THE AIR FORCE ATTN: STEWS -TE-N K CUMMINGS AIR FORCE CTR FOR STUDIES & ANALYSIS DEPARTMENT OF THE NAVY ATTN...INC ATTN: R BUCKNER ATTN: J DEVORE " ATTN: J THOMPSON TOYON RESEARCH CORP ATTN: W SCHLUETER ATTN: J GARBARINO ATTN: J ISE R & D ASSOCIATES ATTN: B LAMB

Reaction and Transport Processes Controlling In Situ Chemical Oxidation of DNAPLs

Science.gov (United States)

2006-11-01

Contact Areas. Ground Water, 36(4):495-502. Atlas , R.M., and R. Bartha (1987). Microbial Ecology , Benjamin/Cummings Publishing Company, Menlo Park...relatively few species ( Atlas and Bartha 1987). If selection for bioremediation processes following oxidation does occur, competition for substrates...Experiments.....................................................................3-23 3.6.3. Microbial Culture Preparation for Evaluation of Coupling

Author Details

African Journals Online (AJOL)

Cumming, DEA. Vol 13, No 2 (1996) - Articles Effect of management factors on tiller dynamics in tall fescue: numbers of tillers reaching reproductive maturity. Abstract · Vol 13, No 2 (1996) - Articles Effect of management factors on tiller dynamics in tall fescue: tiller initiation. Abstract · Vol 13, No 2 (1996) - Articles Effect of ...

A combination of electrical resistivity and cone penetration test ...

African Journals Online (AJOL)

The conductive unconsolidated clayey soil / peat with the resistivity values 0.9 – 10 Ωm cum CPT values 2 to 4 kg/cm2 experienced along noticeable depressed parts could have contributed to the cracking and differential settlement of the residential buildings in the study area. However, boring via percussion drilling should ...

What I Think I May Have Learned--Reflections on 50 Years of Teaching: An Interview with Michael Wertheimer

Science.gov (United States)

Michael, Kurt D.

2006-01-01

Kurt Michael is an associate professor in the Department of Psychology at Appalachian State University (ASU) where he teaches history and systems of psychology, abnormal psychology, child psychopathology, and interventions for children and adolescents. He received his BA (cum laude) from the University of Colorado at Boulder and his MS and PhD in…

Computer aided cooling curve analysis for Al-5Si and Al-11Si alloys ...

African Journals Online (AJOL)

The effect of grain refiner, modifier, and combination of grain refiner cum modifier was studied on Al-5Si and Al-11Si alloys using computer aided cooling curve analysis. For combined grain refinement and modification effect, Al-Ti-B-Sr single master alloy was developed that acted as both grain refiner and modifier.

Complexation of buffer constituents with neutral complexation agents: part II. Practical impact in capillary zone electrophoresis.

Science.gov (United States)

Beneš, Martin; Riesová, Martina; Svobodová, Jana; Tesařová, Eva; Dubský, Pavel; Gaš, Bohuslav

2013-09-17

This article elucidates the practical impact of the complexation of buffer constituents with complexation agents on electrophoretic results, namely, complexation constant determination, system peak development, and proper separation of analytes. Several common buffers, which were selected based on the pH study in Part I of this paper series (Riesová, M.; Svobodová, J.; Tošner, Z.; Beneš, M.; Tesařová, E.; Gaš, B. Anal. Chem., 2013, DOI: 10.1021/ac4013804); e.g., CHES, MES, MOPS, Tricine were used to demonstrate behavior of such complex separation systems. We show that the value of a complexation constant determined in the interacting buffers environment depends not only on the analyte and complexation agent but it is also substantially affected by the type and concentration of buffer constituents. As a result, the complexation parameters determined in the interacting buffers cannot be regarded as thermodynamic ones and may provide misleading information about the strength of complexation of the compound of interest. We also demonstrate that the development of system peaks in interacting buffer systems significantly differs from the behavior known for noncomplexing systems, as the mobility of system peaks depends on the concentration and type of neutral complexation agent. Finally, we show that the use of interacting buffers can totally ruin the results of electrophoretic separation because the buffer properties change as the consequence of the buffer constituents' complexation. As a general conclusion, the interaction of buffer constituents with the complexation agent should always be considered in any method development procedures.

Quantify the complexity of turbulence

Science.gov (United States)

Tao, Xingtian; Wu, Huixuan

2017-11-01

Many researchers have used Reynolds stress, power spectrum and Shannon entropy to characterize a turbulent flow, but few of them have measured the complexity of turbulence. Yet as this study shows, conventional turbulence statistics and Shannon entropy have limits when quantifying the flow complexity. Thus, it is necessary to introduce new complexity measures- such as topology complexity and excess information-to describe turbulence. Our test flow is a classic turbulent cylinder wake at Reynolds number 8100. Along the stream-wise direction, the flow becomes more isotropic and the magnitudes of normal Reynolds stresses decrease monotonically. These seem to indicate the flow dynamics becomes simpler downstream. However, the Shannon entropy keeps increasing along the flow direction and the dynamics seems to be more complex, because the large-scale vortices cascade to small eddies, the flow is less correlated and more unpredictable. In fact, these two contradictory observations partially describe the complexity of a turbulent wake. Our measurements (up to 40 diameters downstream the cylinder) show that the flow's degree-of-complexity actually increases firstly and then becomes a constant (or drops slightly) along the stream-wise direction. University of Kansas General Research Fund.

BRAND program complex

International Nuclear Information System (INIS)

Androsenko, A.A.; Androsenko, P.A.

1983-01-01

A description is given of the structure, input procedure and recording rules of initial data for the BRAND programme complex intended for the Monte Carlo simulation of neutron physics experiments. The BRAND complex ideology is based on non-analogous simulation of the neutron and photon transport process (statistic weights are used, absorption and escape of particles from the considered region is taken into account, shifted readouts from a coordinate part of transition nucleus density are applied, local estimations, etc. are used). The preparation of initial data for three sections is described in detail: general information for Monte Carlo calculation, source definition and data for describing the geometry of the system. The complex is to be processed with the BESM-6 computer, the basic programming lan-- guage is FORTRAN, volume - more than 8000 operators

Evolution of Integrated Open Aquaculture Systems in Hungary: Results from a Case Study

Directory of Open Access Journals (Sweden)

József Popp

2018-01-01

Full Text Available This article presents the history of integrated farming in aquaculture through a Hungarian case study. The development of Hungarian integrated aquaculture is aligned with global trends. In the previous millennium, the utilization of the nutrients introduced into the system was the main aspect of the integration. In Hungary, technologies that integrated fish production with growing crops and animal husbandry appeared, including for example: large-scale fish-cum-rice production; fish-cum-duck production; and integrated pig-fish farming which were introduced in the second half of the 20th century. Today, the emphasis is on integrating the use of the kind of feed where the main goal is to minimize nutrient loads in the surrounding natural ecosystems and to maximize the utilization of the unit’s water resources. The various modern integrated freshwater aquaculture systems, such as intensive fish production combined with wetland, recirculation aquaculture system and multi-functional aquaculture, have proved their viability. However, the future opportunities for these systems have not always been properly recognized and acknowledged when the future of European aquaculture is discussed.

Linguistic research in the empirical paradigm as outlined by Mario Bunge.

Science.gov (United States)

Zielińska, Dorota

2016-01-01

In view of the critique of the methodology of the dominant interdisciplinary research involving language studies as the main component, in particular clinical linguistics, Cummings (Pragmatic disorders. Perspectives in pragmatics, philosophy and psychology, vol 3. Springer, Dordrecht, 2014) proposes that "It is perhaps appropriate at this point to move the debate onto non-empirical grounds." In Cummings (2014: 113) she starts such a debate on the grounds of the philosophy of language and pragmatics. In this article, I propose to expand that debate by including the input of the philosophy of science. I start the discussion by presenting the way one may carry out language research in the paradigm of empirical sciences from the perspective outlined in Bunge (Scientific research. Strategy and philosophy. Berlin, Springer, 1967; Method, model and matter (synthese library). D. Reidel Publishing Company, Dordrecht, 1973; Emergence and convergence: qualitative novelty and the unity of knowledge. University of Toronto Press, Toronto, 2003) and constrained by Altmann's (Towards a theory of language. Glottometrica 1:1-25, 1978) assumption about self-originating and self-regulatory nature of language.

Paecilomyces tenuipes extract prevents depression-like behaviors in chronic unpredictable mild stress-induced rat model via modulation of neurotransmitters.

Science.gov (United States)

Liu, Chungang; Wang, Juan; Xu, Shiqi; An, Shengshu; Tang, Siying; He, Jian; Liu, Yang; Lee, Robert J; Wang, Di

2017-08-01

The medicinal fungus Paecilomyces tenuipes exhibits a variety of pharmacological effects, including antidepressive effects. The chronic unpredictable mild stress (CUMS)‑induced rat model has served an important role in studies involving antidepressants screening. The aim of the present study was to evaluate the antidepressant‑like activity of P. tenuipes N45 aqueous extract (PTNE) in a CUMS‑induced rat model of behavioral despair depression. Following 4 weeks of PTNE treatment, behavioral tests were conducted to investigate the antidepressant‑like activities, and the levels of neurotransmitters and hormones in blood and hypothalamus were measured. The results demonstrated that PTNE treatment significantly increased movement in the forced running test, whereas the immobility time was reduced in the hotplate test and the forced swim test in depression‑model rats. PTNE treatment was able to normalize the levels of hormones and neurotransmitters in serum and hypothalamus of CUMS rats. The data demonstrated that PTNE treatment may be a potential pharmaceutical agent in treatment‑resistant depression, and the effects of PTNE may be partly mediated through normalizing the levels of neurotransmitters.

Comparing the Nordic and South Korean Models: Labour-Market Regulation and Social Welfare in Times of Crisis

DEFF Research Database (Denmark)

Schmidt, Johannes Dragsbæk

2012-01-01

The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models of contemporary capitalism – the discredited Anglo-Saxon finance-driven model versus the export-driven product......The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models of contemporary capitalism – the discredited Anglo-Saxon finance-driven model versus the export......-driven production model of growth, with weak safety nets, adopted by East Asian countries in contrast to the export-oriented Nordic social welfare model. The third section documents the impact of the crisis on the economies, and discusses core examples of state intervention in the socio-economic sectors...... such as labor markets and social welfare in the Nordic as well as Korean contexts. The final section discusses some tentative conclusions about the resilience of the Nordic and ROK models and their potential for recovery....

International nurse recruitment in India.

Science.gov (United States)

Khadria, Binod

2007-06-01

This paper describes the practice of international recruitment of Indian nurses in the model of a "business process outsourcing" of comprehensive training-cum-recruitment-cum-placement for popular destinations like the United Kingdom and United States through an agency system that has acquired growing intensity in India. Despite the extremely low nurse to population ratio in India, hospital managers in India are not concerned about the growing exodus of nurses to other countries. In fact, they are actively joining forces with profitable commercial ventures that operate as both training and recruiting agencies. Most of this activity is concentrated in Delhi, Bangalore, and Kochi. Gaps in data on nursing education, employment, and migration, as well as nonstandardization of definitions of "registered nurse," impair the analysis of international migration of nurses from India, making it difficult to assess the impact of migration on vacancy rates. One thing is clear, however, the chain of commercial interests that facilitate nurse migration is increasingly well organized and profitable, making the future growth of this business a certainty.

Identification of a small TAF complex and its role in the assembly of TAF-containing complexes.

Science.gov (United States)

Demény, Màté A; Soutoglou, Evi; Nagy, Zita; Scheer, Elisabeth; Jànoshàzi, Agnes; Richardot, Magalie; Argentini, Manuela; Kessler, Pascal; Tora, Laszlo

2007-03-21

TFIID plays a role in nucleating RNA polymerase II preinitiation complex assembly on protein-coding genes. TFIID is a multisubunit complex comprised of the TATA box binding protein (TBP) and 14 TBP-associated factors (TAFs). Another class of multiprotein transcriptional regulatory complexes having histone acetyl transferase (HAT) activity, and containing TAFs, includes TFTC, STAGA and the PCAF/GCN5 complex. Looking for as yet undiscovered subunits by a proteomic approach, we had identified TAF8 and SPT7L in human TFTC preparations. Subsequently, however, we demonstrated that TAF8 was not a stable component of TFTC, but that it is present in a small TAF complex (SMAT), containing TAF8, TAF10 and SPT7L, that co-purified with TFTC. Thus, TAF8 is a subunit of both TFIID and SMAT. The latter has to be involved in a pathway of complex formation distinct from the other known TAF complexes, since these three histone fold (HF)-containing proteins (TAF8, TAF10 and SPT7L) can never be found together either in TFIID or in STAGA/TFTC HAT complexes. Here we show that TAF8 is absolutely necessary for the integration of TAF10 in a higher order TFIID core complex containing seven TAFs. TAF8 forms a heterodimer with TAF10 through its HF and proline rich domains, and also interacts with SPT7L through its C-terminal region, and the three proteins form a complex in vitro and in vivo. Thus, the TAF8-TAF10 and TAF10-SPT7L HF pairs, and also the SMAT complex, seem to be important regulators of the composition of different TFIID and/or STAGA/TFTC complexes in the nucleus and consequently may play a role in gene regulation.

Complexity science and leadership in healthcare.

Science.gov (United States)

Burns, J P

2001-10-01

The emerging field of complexity science offers an alternative leadership strategy for the chaotic, complex healthcare environment. A survey revealed that healthcare leaders intuitively support principles of complexity science. Leadership that uses complexity principles offers opportunities in the chaotic healthcare environment to focus less on prediction and control and more on fostering relationships and creating conditions in which complex adaptive systems can evolve to produce creative outcomes.

Complex Functions with GeoGebra

Science.gov (United States)

Breda, Ana Maria D'azevedo; Dos Santos, José Manuel Dos Santos

2016-01-01

Complex functions, generally feature some interesting peculiarities, seen as extensions of real functions. The visualization of complex functions properties usually requires the simultaneous visualization of two-dimensional spaces. The multiple Windows of GeoGebra, combined with its ability of algebraic computation with complex numbers, allow the…

Complex DNA structures and structures of DNA complexes

International Nuclear Information System (INIS)

Chazin, W.J.; Carlstroem, G.; Shiow-Meei Chen; Miick, S.; Gomez-Paloma, L.; Smith, J.; Rydzewski, J.

1994-01-01

Complex DNA structures (for example, triplexes, quadruplexes, junctions) and DNA-ligand complexes are more difficult to study by NMR than standard DNA duplexes are because they have high molecular weights, show nonstandard or distorted local conformations, and exhibit large resonance linewidths and severe 1 H spectral overlap. These systems also tend to have limited solubility and may require specialized solution conditions to maintain favorable spectral characteristics, which adds to the spectroscopic difficulties. Furthermore, with more atoms in the system, both assignment and structure calculation become more challenging. In this article, we focus on demonstrating the current status of NMR studies of such systems and the limitations to further progress; we also indicate in what ways isotopic enrichment can be useful

Complex DNA structures and structures of DNA complexes

Energy Technology Data Exchange (ETDEWEB)

Chazin, W.J.; Carlstroem, G.; Shiow-Meei Chen; Miick, S.; Gomez-Paloma, L.; Smith, J.; Rydzewski, J. [Scripps Research Institute, La Jolla, CA (United States)

1994-12-01

Complex DNA structures (for example, triplexes, quadruplexes, junctions) and DNA-ligand complexes are more difficult to study by NMR than standard DNA duplexes are because they have high molecular weights, show nonstandard or distorted local conformations, and exhibit large resonance linewidths and severe {sup 1}H spectral overlap. These systems also tend to have limited solubility and may require specialized solution conditions to maintain favorable spectral characteristics, which adds to the spectroscopic difficulties. Furthermore, with more atoms in the system, both assignment and structure calculation become more challenging. In this article, we focus on demonstrating the current status of NMR studies of such systems and the limitations to further progress; we also indicate in what ways isotopic enrichment can be useful.

Oligocyclopentadienyl transition metal complexes

Energy Technology Data Exchange (ETDEWEB)

de Azevedo, Cristina G.; Vollhardt, K. Peter C.

2002-01-18

Synthesis, characterization, and reactivity studies of oligocyclopentadienyl transition metal complexes, namely those of fulvalene, tercyclopentadienyl, quatercyclopentadienyl, and pentacyclopentadienyl(cyclopentadienyl) are the subject of this account. Thermal-, photo-, and redox chemistries of homo- and heteropolynuclear complexes are described.

Measuring Complexity of SAP Systems

Directory of Open Access Journals (Sweden)

Ilja Holub

2016-10-01

Full Text Available The paper discusses the reasons of complexity rise in ERP system SAP R/3. It proposes a method for measuring complexity of SAP. Based on this method, the computer program in ABAP for measuring complexity of particular SAP implementation is proposed as a tool for keeping ERP complexity under control. The main principle of the measurement method is counting the number of items or relations in the system. The proposed computer program is based on counting of records in organization tables in SAP.

Treatment of tributyl phosphate wastes by extraction cum pyrolysis process

International Nuclear Information System (INIS)

Deshingkar, D.S.; Ramaswamy, M.; Kartha, P.K.S.; Kutty, P.V.E.; Ramanujam, A.

1989-01-01

For the treatment of spent tri n-butyl phospate (TBP) wastes from Purex process, a method involving extraction of TBP with phosphoric acid followed by pyrolysis of TBP - phosphoric acid phase was investigated. The process was examined with respect to simulated waste, process solvent wastes and aged organic waste samples. These studies seem to offer a simple treatment method for the separation of bulk of diluent from spent solvent wastes. The diluent phase needs further purification for reuse in reprocessing plant; otherwise it can be incinerated. (author). 18 refs., 3 tabs., 6 figs

National seminar on non-destructive evaluation techniques: proceedings cum souvenir

International Nuclear Information System (INIS)

Dutta, N.G.; Kulkarni, P.G.; Purushotham, D.S.C.

1994-01-01

This volume contains selected papers presented at the National Seminar on Non-Destructive Evaluation Techniques held at Bhabha Atomic Research Centre, Mumbai during December 8-9, 1994. The papers covered a wide spectrum of non-destructive evaluation activities including that for quality assurance of various nuclear components and structures with the focal theme being computerization and robotics. The papers relevant to INIS are indexed separately

Cummings Memorial Lecture - 1975. The market basket: food for thought.

Science.gov (United States)

Deichman, W B

1975-06-01

The world food crisis is as critical today as when it was debated at the 1974 World Food Conference in Rome. Since the United States and Canada-and to a lesser extent, Australia and New Zealand-lead in the production of corn, wheat and soybeans, the North American "bread basket" has become the "market basket" of the world. For welfare, economic, and political reasons, our energies, resources, and deliberations must be expanded toward optimum production of wholesome food products. I do not recommend that we permit food additives in "questionably" safe or excessive concentrations in our agricultural products. I do recommend, however, that tolerance limits for food additives be established based on a comprehensive review of all contributing factors-the world food crisis and the rational interpretation of both positive and negative animal data as they relate to man. As Dr. Herbert Stokinger put it so aptly: "Avoid the establishment of unnecessarily severe standards." 2. Funds for research and teaching of food and nutrition should be greatly increased, so that all who can read and write may be made aware of the daily dietary requirements for the maintenance of good health. 3. Unsubstantiated scare tactics in publications of the scientific and lay press can only lead to well-intended but often emotionally-inspired restrictions, ordinances, and laws. Such decisions are likely to either under- or over-define the requirements and standards for food additives and other chemicals which are important to the well-being of the populace.

Employment-cum-Training Contracts in France: The 1975-85 Record.

Science.gov (United States)

Caspar, M.-L.

1988-01-01

The author evaluates a program whereby the French government subsidized employers to organize training for youth under employment contracts. Youth with above average employment opportunties benefited. Failure to serve the most disadvantaged youth is attributed to (1) individual youth choices, (2) screening by program administrators, and (3)…

Proceedings of the ISEAC international symposium cum workshop on electrochemistry

International Nuclear Information System (INIS)

Aggarwal, Suresh K.; Guin, Saurav K.; Kamat, Jayshree V.; Gupta, Ruma

2011-01-01

This symposium highlights the role of chemistry to find out the solution of some global problems. Among the leading branches of chemistry, the foot prints of electrochemistry can be seen in a variety of fields for both fundamental studies and methodological applications. Electrochemistry and allied science has already exhibited its potential to meet the world's need starting from health and medicine, environment, nanofabrication to alternate energy resources. Articles relevant to INIS are indexed separately

Exotic plant species around Jeongeup Research Complex and RFT industrial complex

International Nuclear Information System (INIS)

Kim, Jin Kyu; Cha, Min Kyoung; Ryu, Tae Ho; Lee, Yun Jong; Kim, Jin Hong

2015-01-01

In Shinjeong-dong of Jeongeup, there are three government-supported research institutes and an RFT industrial complex which is currently being established. Increased human activities can affect flora and fauna as a man-made pressure onto the region. As a baseline study, status of exotic plants was investigated prior to a full operation of the RFT industrial complex. A total of 54 species and 1 variety of naturalized or introduced plants were found in the study area. Among them, three species (Ambrosia artemisifolia var. elatior, Rumex acetocella and Aster pilosus) belong to 'nuisance species', and four species (Phytolacca americana, Iopomoea hederacea, Ereechtites hieracifolia and Rudbeckia laciniata) to ‘monitor species’ designated by the ministry of Environment. Some of naturalized trees and plants were intentionally introduced in this area, while others naturally immigrated. Physalis angulata seems to immigrate in the study area in the form of mixture with animal feeds as its distribution coincided with the transportation route of the animal feeds. Liquidambar styraciflua is amenable to the ecological investigation on the possible expansion of the species to the nearby Naejang National Park as its leave shape and autumn color are very similar to those of maple trees. The number of naturalized plants around the RFT industrial complex will increase with an increase in floating population, in human activities in association with constructions of factories and operations of the complex. The result of this study provides baseline data for assessing the ecological change of the region according to the operation of the RFT industrial complex

Exotic plant species around Jeongeup Research Complex and RFT industrial complex

Energy Technology Data Exchange (ETDEWEB)

Kim, Jin Kyu; Cha, Min Kyoung; Ryu, Tae Ho; Lee, Yun Jong; Kim, Jin Hong [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup(Korea, Republic of)

2015-08-15

In Shinjeong-dong of Jeongeup, there are three government-supported research institutes and an RFT industrial complex which is currently being established. Increased human activities can affect flora and fauna as a man-made pressure onto the region. As a baseline study, status of exotic plants was investigated prior to a full operation of the RFT industrial complex. A total of 54 species and 1 variety of naturalized or introduced plants were found in the study area. Among them, three species (Ambrosia artemisifolia var. elatior, Rumex acetocella and Aster pilosus) belong to 'nuisance species', and four species (Phytolacca americana, Iopomoea hederacea, Ereechtites hieracifolia and Rudbeckia laciniata) to ‘monitor species’ designated by the ministry of Environment. Some of naturalized trees and plants were intentionally introduced in this area, while others naturally immigrated. Physalis angulata seems to immigrate in the study area in the form of mixture with animal feeds as its distribution coincided with the transportation route of the animal feeds. Liquidambar styraciflua is amenable to the ecological investigation on the possible expansion of the species to the nearby Naejang National Park as its leave shape and autumn color are very similar to those of maple trees. The number of naturalized plants around the RFT industrial complex will increase with an increase in floating population, in human activities in association with constructions of factories and operations of the complex. The result of this study provides baseline data for assessing the ecological change of the region according to the operation of the RFT industrial complex.

A Memristor-Based Hyperchaotic Complex Lü System and Its Adaptive Complex Generalized Synchronization

Directory of Open Access Journals (Sweden)

Shibing Wang

2016-02-01

Full Text Available This paper introduces a new memristor-based hyperchaotic complex Lü system (MHCLS and investigates its adaptive complex generalized synchronization (ACGS. Firstly, the complex system is constructed based on a memristor-based hyperchaotic real Lü system, and its properties are analyzed theoretically. Secondly, its dynamical behaviors, including hyperchaos, chaos, transient phenomena, as well as periodic behaviors, are explored numerically by means of bifurcation diagrams, Lyapunov exponents, phase portraits, and time history diagrams. Thirdly, an adaptive controller and a parameter estimator are proposed to realize complex generalized synchronization and parameter identification of two identical MHCLSs with unknown parameters based on Lyapunov stability theory. Finally, the numerical simulation results of ACGS and its applications to secure communication are presented to verify the feasibility and effectiveness of the proposed method.

Complexity of Economical Systems

Directory of Open Access Journals (Sweden)

G. P. Pavlos

2015-01-01

Full Text Available In this study new theoretical concepts are described concerning the interpretation of economical complex dynamics. In addition a summary of an extended algorithm of nonlinear time series analysis is provided which is applied not only in economical time series but also in other physical complex systems (e.g. [22, 24]. In general, Economy is a vast and complicated set of arrangements and actions wherein agents—consumers, firms, banks, investors, government agencies—buy and sell, speculate, trade, oversee, bring products into being, offer services, invest in companies, strategize, explore, forecast, compete, learn, innovate, and adapt. As a result the economic and financial variables such as foreign exchange rates, gross domestic product, interest rates, production, stock market prices and unemployment exhibit large-amplitude and aperiodic fluctuations evident in complex systems. Thus, the Economics can be considered as spatially distributed non-equilibrium complex system, for which new theoretical concepts, such as Tsallis non extensive statistical mechanics and strange dynamics, percolation, nonGaussian, multifractal and multiscale dynamics related to fractional Langevin equations can be used for modeling and understanding of the economical complexity locally or globally.

Complexity and Dynamical Depth

Directory of Open Access Journals (Sweden)

Terrence Deacon

2014-07-01

Full Text Available We argue that a critical difference distinguishing machines from organisms and computers from brains is not complexity in a structural sense, but a difference in dynamical organization that is not well accounted for by current complexity measures. We propose a measure of the complexity of a system that is largely orthogonal to computational, information theoretic, or thermodynamic conceptions of structural complexity. What we call a system’s dynamical depth is a separate dimension of system complexity that measures the degree to which it exhibits discrete levels of nonlinear dynamical organization in which successive levels are distinguished by local entropy reduction and constraint generation. A system with greater dynamical depth than another consists of a greater number of such nested dynamical levels. Thus, a mechanical or linear thermodynamic system has less dynamical depth than an inorganic self-organized system, which has less dynamical depth than a living system. Including an assessment of dynamical depth can provide a more precise and systematic account of the fundamental difference between inorganic systems (low dynamical depth and living systems (high dynamical depth, irrespective of the number of their parts and the causal relations between them.

Redox and oxo-abstraction reactions of silylamine with MoOCl4

International Nuclear Information System (INIS)

Vasisht, S.K.; Singh, G.

1985-01-01

Trimethylsilyldiethylamine Me 3 SiNEt 2 and MoOCl 4 (1:1) undergo a free radical redox reaction in CH 2 Cl 2 or Et 2 O to form MoCl 3 O(HNEt 2 ). Reduction occurs even in aprotic media like CCl 4 and CS 2 to give Mo(V) complexes Mo 2 Cl 6 O 2 (N 2 Et 4 ) and Mo 2 Cl 6 O 2 [(SCNEt 2 ) 2 S 2 ], respectively. A 2:1 reaction in nonionizing protic solvents undergoes redox cum cleavage to provide MoCl 2 O(NEt 2 )(HNEt 2 ) but a reaction at reflux temperature in 1,2-dichloroethane leads to diethylammonium salt, [Et 2 NH 2 ][MoCl 4 O(HNEt 2 )]. Higher molar reactions (3:1, 4:1) in CH 2 Cl 2 or Et 2 O are associated with redox reaction as well as oxygen atom abstraction to form de-oxo Mo(IV) complex MoCl 3 (NEt 2 )(HNEt 2 ) 2 , whereas, a 3:1 reaction in CS 2 forms Mo 2 Cl 4 O(S 2 CNEt 2 ) 4 . Compounds have been characterized by elemental analyses, redox titration, magnetic moment, conductance, infrared, electronic absorption and 1 H-NMR measurements. (author)

Automated technological equipment-robot complexes

International Nuclear Information System (INIS)

Zhitomirskii, S.V.; Samorodskikh, B.L.

1984-01-01

This paper surveys the types of automated technological equipment robot complexes. The principal elements of such complexes are described. Complexes are divided into two principal groups: those using simultaneously acting robots, and those using successively acting robots. The great variety of types of robots using successive action is then described

Managing complex child law

DEFF Research Database (Denmark)

Svendsen, Idamarie Leth

2017-01-01

The article reports the findings of a qualitative study of Danish legal regulation of the public initial assessment of children and young persons and municipal practitioners’ decision-making under this regulation. The regulation mirrors new and complex relations between families and society...... in the form of 7 individual vignette interviews with municipal mid-level managers and professional consultants in five Danish municipalities. The study finds that the regulation is more complex than it looks, and that the complexity is handled through simplifying decision-making patterns that can be seen...

Cyclomatic Complexity: theme and variations

Directory of Open Access Journals (Sweden)

Brian Henderson-Sellers

1993-11-01

Full Text Available Focussing on the "McCabe family" of measures for the decision/logic structure of a program, leads to an evaluation of extensions to modularization, nesting and, potentially, to object-oriented program structures. A comparison of rated, operating and essential complexities of programs suggests two new metrics: "inessential complexity" as a measure of unstructuredness and "product complexity" as a potential objective measure of structural complexity. Finally, nesting and abstraction levels are considered, especially as to how metrics from the "McCabe family" might be applied in an object-oriented systems development environment.

The structure of complex Lie groups

CERN Document Server

Lee, Dong Hoon

2001-01-01

Complex Lie groups have often been used as auxiliaries in the study of real Lie groups in areas such as differential geometry and representation theory. To date, however, no book has fully explored and developed their structural aspects.The Structure of Complex Lie Groups addresses this need. Self-contained, it begins with general concepts introduced via an almost complex structure on a real Lie group. It then moves to the theory of representative functions of Lie groups- used as a primary tool in subsequent chapters-and discusses the extension problem of representations that is essential for studying the structure of complex Lie groups. This is followed by a discourse on complex analytic groups that carry the structure of affine algebraic groups compatible with their analytic group structure. The author then uses the results of his earlier discussions to determine the observability of subgroups of complex Lie groups.The differences between complex algebraic groups and complex Lie groups are sometimes subtle ...

Modeling Complex Systems

CERN Document Server

Boccara, Nino

2010-01-01

Modeling Complex Systems, 2nd Edition, explores the process of modeling complex systems, providing examples from such diverse fields as ecology, epidemiology, sociology, seismology, and economics. It illustrates how models of complex systems are built and provides indispensable mathematical tools for studying their dynamics. This vital introductory text is useful for advanced undergraduate students in various scientific disciplines, and serves as an important reference book for graduate students and young researchers. This enhanced second edition includes: . -recent research results and bibliographic references -extra footnotes which provide biographical information on cited scientists who have made significant contributions to the field -new and improved worked-out examples to aid a student’s comprehension of the content -exercises to challenge the reader and complement the material Nino Boccara is also the author of Essentials of Mathematica: With Applications to Mathematics and Physics (Springer, 2007).

Tensor Product of Polygonal Cell Complexes

OpenAIRE

Chien, Yu-Yen

2017-01-01

We introduce the tensor product of polygonal cell complexes, which interacts nicely with the tensor product of link graphs of complexes. We also develop the unique factorization property of polygonal cell complexes with respect to the tensor product, and study the symmetries of tensor products of polygonal cell complexes.

Organization structures for dealing with complexity

NARCIS (Netherlands)

Meijer, B.R.

2006-01-01

"Complexity is in the eye of the beholder" is a well known quote in the research field of complexity. In the world of managers the word complex is often a synonym for difficult, complicated, involving many factors and highly uncertain. A complex business decision requires careful preparation and

Epidemic modeling in complex realities.

Science.gov (United States)

Colizza, Vittoria; Barthélemy, Marc; Barrat, Alain; Vespignani, Alessandro

2007-04-01

In our global world, the increasing complexity of social relations and transport infrastructures are key factors in the spread of epidemics. In recent years, the increasing availability of computer power has enabled both to obtain reliable data allowing one to quantify the complexity of the networks on which epidemics may propagate and to envision computational tools able to tackle the analysis of such propagation phenomena. These advances have put in evidence the limits of homogeneous assumptions and simple spatial diffusion approaches, and stimulated the inclusion of complex features and heterogeneities relevant in the description of epidemic diffusion. In this paper, we review recent progresses that integrate complex systems and networks analysis with epidemic modelling and focus on the impact of the various complex features of real systems on the dynamics of epidemic spreading.

Provability, complexity, grammars

CERN Document Server

Beklemishev, Lev; Vereshchagin, Nikolai

1999-01-01

The book contains English translations of three outstanding dissertations in mathematical logic and complexity theory. L. Beklemishev proves that all provability logics must belong to one of the four previously known classes. The dissertation of M. Pentus proves the Chomsky conjecture about the equivalence of two approaches to formal languages: the Chomsky hierarchy and the Lambek calculus. The dissertation of N. Vereshchagin describes a general framework for criteria of reversability in complexity theory.

Complexation and molecular modeling studies of europium(III)-gallic acid-amino acid complexes.

Science.gov (United States)

Taha, Mohamed; Khan, Imran; Coutinho, João A P

2016-04-01

With many metal-based drugs extensively used today in the treatment of cancer, attention has focused on the development of new coordination compounds with antitumor activity with europium(III) complexes recently introduced as novel anticancer drugs. The aim of this work is to design new Eu(III) complexes with gallic acid, an antioxida'nt phenolic compound. Gallic acid was chosen because it shows anticancer activity without harming health cells. As antioxidant, it helps to protect human cells against oxidative damage that implicated in DNA damage, cancer, and accelerated cell aging. In this work, the formation of binary and ternary complexes of Eu(III) with gallic acid, primary ligand, and amino acids alanine, leucine, isoleucine, and tryptophan was studied by glass electrode potentiometry in aqueous solution containing 0.1M NaNO3 at (298.2 ± 0.1) K. Their overall stability constants were evaluated and the concentration distributions of the complex species in solution were calculated. The protonation constants of gallic acid and amino acids were also determined at our experimental conditions and compared with those predicted by using conductor-like screening model for realistic solvation (COSMO-RS) model. The geometries of Eu(III)-gallic acid complexes were characterized by the density functional theory (DFT). The spectroscopic UV-visible and photoluminescence measurements are carried out to confirm the formation of Eu(III)-gallic acid complexes in aqueous solutions. Copyright © 2016 Elsevier Inc. All rights reserved.

Complexity factors and prediction of performance

International Nuclear Information System (INIS)

Braarud, Per Oeyvind

1998-03-01

Understanding of what makes a control room situation difficult to handle is important when studying operator performance, both with respect to prediction as well as improvement of the human performance. A factor analytic approach identified eight factors from operators' answers to an 39 item questionnaire about complexity of the operator's task in the control room. A Complexity Profiling Questionnaire was developed, based on the factor analytic results from the operators' conception of complexity. The validity of the identified complexity factors was studied by prediction of crew performance and prediction of plant performance from ratings of the complexity of scenarios. The scenarios were rated by both process experts and the operators participating in the scenarios, using the Complexity Profiling Questionnaire. The process experts' complexity ratings predicted both crew performance and plant performance, while the operators' rating predicted plant performance only. The results reported are from initial studies of complexity, and imply a promising potential for further studies of the concept. The approach used in the study as well as the reported results are discussed. A chapter about the structure of the conception of complexity, and a chapter about further research conclude the report. (author)

50 CFR 32.8 - Areas closed to hunting.

Science.gov (United States)

2010-10-01

... 16936. 2748 Oct. 1, 1947 Illinois Honshoe Lake, Alexander County 3 CFR, 1947 Supp. 12 FR 6521. Sept. 9... Wildlife Regudge 21 FR 6513. 2370 Oct. 16, 1939 Virginia Back Bay National Wildlife Refuge 3 CFR, Cum. Supp... .......do Back Bay National Wildlife Refuge 27 FR 104; 27 FR 858. Aug. 21, 1963 .......do Mackay Island...

Untitled

Indian Academy of Sciences (India)

Thus 1746 m cum of water consisting of excess storage and excess inflows was used over and above the ... 1972 indicates that (i) the depletion period inflows are correlated to the filling period inflows and planning should be based on appropriate estimates of depletion period inflows; (ii) an RF of 0.85 or above can be ...

Normal D-Region Models for Weapon Effects Code

Science.gov (United States)

1985-09-18

ATTN: DNA REP) ATTN: DRSMI-YSO J GAMBLE ATTN: JLKS ATTN: JPTM US ARMY WHITE SANDS MISSILE RANGE ATTN: JPTP ATTN: STEWS -TE-N K CUMMINGS NATIONAL SECURITY... LAMB ATTN: G SMITH ATTN: F GILMORE ATTN: J VICKREY ATTN: M GANTSWEG ATTN: R LEADABRAND ATTN: W KARZAS ATTN: R TSUNODA ATTN: W CHESNUT a R & D ASSOCIATES

Information Management for an Automated Battlefield Command and Control System

Science.gov (United States)

1980-05-01

DD) I u FJ i EDITION OF" I NOV 65, IS OSSOLIETIES"-- iUnclassified1SECURITY CLASSIFICATION OF THIS PAGE (When Data Entered) t// II. Unclassified...DIRELIOk oý INSTIhJTIONAL RSCH I USA AIP DEFENSE SCHOUL ATTN: AISA -CU)-MS I iJSAADS-LIBRARY-OUCUMLNTS) I USA AIW DEFENSE ZL~N HDAU IN: fILLS

south african naval personnel seconded to the royal navy during

African Journals Online (AJOL)

Cdr H. R. Gordon-Cumming has written that in the early days of the Second World War large drafts of RNVR (SA) officers and ratings were taken by the few British Warships which called at. Simonstown and Durban to make up their war complements and that later on 'Union nationals took part in nearly every major naval ...

An Analysis of the Root Causes of Delays and Deficiencies in the Development of Embedded Software for Air Force Weapon Systems

Science.gov (United States)

1993-12-01

the ability to pull up sharply to avoid hitting hills. To maintain the ability to pull up at the level desired by the Air Force (2.4 g’s, or...by whadmss. la& akon ?dmuenua;c Alniinal Fm’mmname. Small Rcducszms in Samlmlactima in Ssghcua DagUdam in as Taedaclm Goali Cum Impac Taclmncul

Ionization and excitation of some atomic targets and metal oxides by ...

Indian Academy of Sciences (India)

son et al [2] performed experimental-cum-model studies on the VUV excitation– emission processes. The measured .... is rather small in many cases so that a choice ∆ = Eth would make Vabs excessively large. Hence the ... For almost all the targets investigated by us [10–14] this choice of ∆ results in a general accord of our ...

Centrifuge experiments for removal of aluminium turbidity from Dhruva heavy water

International Nuclear Information System (INIS)

Shetiya, R.S.; Unny, V.K.P.; Nayak, A.P.

1989-01-01

Aluminium turbidity and associated radioactivity was observed in the moderator cum coolant system of Dhruva during initial power operation. Ion exchange resin beds of the purification system were not able to remove aluminium turbidity and radioactivity of system heavy water. Centrifuge technique was used as a convenient alternative method to remove the turbidity and radioactivity. (author)

Principals of Design for High Performing Organizations: A Suggested Research Program. Appendixes

Science.gov (United States)

1994-03-01

unit trust and organizational effectiveness (Cummings), biases in management perceptions of organization and environmental characteristics ( Starbuck ...including subcontracting, franchises , work-family issues (Bailyn), the hierarchy problem in organization design (Ettlie), linkages among HRM activities and...was the call for longitudinal studies. Bartunek called for longitudinal field studies and Starbuck noted the need for parallel case studies involving

Further X-Ray Observations of EXO 0748-676 in Quiescence: Evidence for a Cooling Neutron Star Crust

Science.gov (United States)

2010-07-01

the unambiguous determination of the orbital period of the binary (Parmar et al. 1986; Wolff et al. 2009). At the time of its discovery , EXO 0748–676...L41 Jonker P. G., 2008, in C. Bassa, Z. Wang, A. Cumming, & V. M. Kaspi eds, 40 Years of Pulsars : Millisecond Pulsars , Magnetars and More, AIP Conf

Design and Study of a Low-Cost Laboratory Model Digital Wind Power Meter

Science.gov (United States)

Radhakrishnan, Rugmini; Karthika, S.

2010-01-01

A vane-type low-cost laboratory model anemometer cum power meter is designed and constructed for measuring low wind energy created from accelerating fluids. The constructed anemometer is a device which records the electrical power obtained by the conversion of wind power using a wind sensor coupled to a DC motor. It is designed for its…

Neurosurgical implications of Carney complex.

Science.gov (United States)

Watson, J C; Stratakis, C A; Bryant-Greenwood, P K; Koch, C A; Kirschner, L S; Nguyen, T; Carney, J A; Oldfield, E H

2000-03-01

The authors present their neurosurgical experience with Carney complex. Carney complex, characterized by spotty skin pigmentation, cardiac myxomas, primary pigmented nodular adrenocortical disease, pituitary tumors, and nerve sheath tumors (NSTs), is a recently described, rare, autosomal-dominant familial syndrome that is relatively unknown to neurosurgeons. Neurosurgery is required to treat pituitary adenomas and a rare NST, the psammomatous melanotic schwannoma (PMS), in patients with Carney complex. Cushing's syndrome, a common component of the complex, is caused by primary pigmented nodular adrenocortical disease and is not secondary to an adrenocorticotropic hormone-secreting pituitary adenoma. The authors reviewed 14 cases of Carney complex, five from the literature and nine from their own experience. Of the 14 pituitary adenomas recognized in association with Carney complex, 12 developed growth hormone (GH) hypersecretion (producing gigantism in two patients and acromegaly in 10), and results of immunohistochemical studies in one of the other two were positive for GH. The association of PMSs with Carney complex was established in 1990. Of the reported tumors, 28% were associated with spinal nerve sheaths. The spinal tumors occurred in adults (mean age 32 years, range 18-49 years) who presented with pain and radiculopathy. These NSTs may be malignant (10%) and, as with the cardiac myxomas, are associated with significant rates of morbidity and mortality. Because of the surgical comorbidity associated with cardiac myxoma and/or Cushing's syndrome, recognition of Carney complex has important implications for perisurgical patient management and family screening. Study of the genetics of Carney complex and of the biological abnormalities associated with the tumors may provide insight into the general pathobiological abnormalities associated with the tumors may provide insight into the general pathobiological features of pituitary adenomas and NSTs.

Is dense codeswitching complex?

NARCIS (Netherlands)

Dorleijn, M.

In this paper the question is raised to what extent dense code switching can be considered complex. Psycholinguistic experiments indicate that code switching involves cognitive costs, both in production and comprehension, a conclusion that could indicate that code switching is indeed complex. In

Ternary complex formation at mineral/solution interfaces

International Nuclear Information System (INIS)

Leckie, J.O.

1995-01-01

Adsorption of trace concentrations of radionuclides and heavy metals from aqueous solution is dependent on pH, absorbent and adsorbate concentration, and speciation of the metal in solution. In particular, complexation of metal ions by organic and inorganic ligands can dramatically alter adsorption behavior compared to ligand-free systems. The presence of complexing ligands can cause the formation of ''metal like'' or ''ligand like'' ternary surface complexes depending on whether adsorption of the ternary complex increases or decreases with increasing pH, respectively. Examples of ternary surface complexes behaving ''metal like'' include uranyl-EDTA surface complexes on goethite, neptunyl-EDTA surface complexes on hematite and neptunyl-humic surface complexes on gibbsite. Examples of ''ligand like'' ternary surface complexes include uranyl-carbonato and neptunyl-carbonato surface complexes on iron oxides. The effects of complex solutions and multimineralic systems are discussed. (authors). 39 refs., 16 figs., 8 tabs

Information geometric methods for complexity

Science.gov (United States)

Felice, Domenico; Cafaro, Carlo; Mancini, Stefano

2018-03-01

Research on the use of information geometry (IG) in modern physics has witnessed significant advances recently. In this review article, we report on the utilization of IG methods to define measures of complexity in both classical and, whenever available, quantum physical settings. A paradigmatic example of a dramatic change in complexity is given by phase transitions (PTs). Hence, we review both global and local aspects of PTs described in terms of the scalar curvature of the parameter manifold and the components of the metric tensor, respectively. We also report on the behavior of geodesic paths on the parameter manifold used to gain insight into the dynamics of PTs. Going further, we survey measures of complexity arising in the geometric framework. In particular, we quantify complexity of networks in terms of the Riemannian volume of the parameter space of a statistical manifold associated with a given network. We are also concerned with complexity measures that account for the interactions of a given number of parts of a system that cannot be described in terms of a smaller number of parts of the system. Finally, we investigate complexity measures of entropic motion on curved statistical manifolds that arise from a probabilistic description of physical systems in the presence of limited information. The Kullback-Leibler divergence, the distance to an exponential family and volumes of curved parameter manifolds, are examples of essential IG notions exploited in our discussion of complexity. We conclude by discussing strengths, limits, and possible future applications of IG methods to the physics of complexity.

European Conference on Complex Systems 2012

CERN Document Server

Kirkilionis, Markus; Nicolis, Gregoire

2013-01-01

The European Conference on Complex Systems, held under the patronage of the Complex Systems Society, is an annual event that has become the leading European conference devoted to complexity science. ECCS'12, its ninth edition, took place in Brussels, during the first week of September 2012. It gathered about 650 scholars representing a wide range of topics relating to complex systems research, with emphasis on interdisciplinary approaches. More specifically, the following tracks were covered:  1. Foundations of Complex Systems 2. Complexity, Information and Computation 3. Prediction, Policy and Planning, Environment 4. Biological Complexity 5. Interacting Populations, Collective Behavior 6. Social Systems, Economics and Finance This book contains a selection of the contributions presented at the conference and its satellite meetings. Its contents reflect the extent, diversity and richness of research areas in the field, both fundamental and applied.  

Influence of Hydrophobicity on Polyelectrolyte Complexation

Energy Technology Data Exchange (ETDEWEB)

Sadman, Kazi [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Wang, Qifeng [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Chen, Yaoyao [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States; Keshavarz, Bavand [Department; Jiang, Zhang [X-ray; Shull, Kenneth R. [Department; amp, Engineering, Northwestern University, Evanston, Illinois 60208, United States

2017-11-16

Polyelectrolyte complexes are a fascinating class of soft materials that can span the full spectrum of mechanical properties from low viscosity fluids to glassy solids. This spectrum can be accessed by modulating the extent of electrostatic association in these complexes. However, to realize the full potential of polyelectrolyte complexes as functional materials their molecular level details need to be clearly correlated with their mechanical response. The present work demonstrates that by making simple amendments to the chain architecture it is possible to affect the salt responsiveness of polyelectrolyte complexes in a systematic manner. This is achieved by quaternizing poly(4-vinylpyridine) (QVP) with methyl, ethyl and propyl substituents– thereby increasing the hydrophobicity with increasing side chain length– and complexing them with a common anionic polyelectrolyte, poly(styrene sulfonate). The mechanical 1 ACS Paragon Plus Environment behavior of these complexes is compared to the more hydrophilic system of poly(styrene sulfonate) and poly(diallyldimethylammonium) by quantifying the swelling behavior in response to salt stimuli. More hydrophobic complexes are found to be more resistant to doping by salt, yet the mechanical properties of the complex remain contingent on the overall swelling ratio of the complex itself, following near universal swelling-modulus master curves that are quantified in this work. The rheological behavior of QVP complex coacervates are found to be approximately the same, only requiring higher salt concentrations to overcome strong hydrophobic interactions, demonstrating that hydrophobicity can be used as an important parameter for tuning the stability of polyelectrolyte complexes in general, while still preserving the ability to be processed “saloplastically”.

Complexity leadership: a healthcare imperative.

Science.gov (United States)

Weberg, Dan

2012-01-01

The healthcare system is plagued with increasing cost and poor quality outcomes. A major contributing factor for these issues is that outdated leadership practices, such as leader-centricity, linear thinking, and poor readiness for innovation, are being used in healthcare organizations. Complexity leadership theory provides a new framework with which healthcare leaders may practice leadership. Complexity leadership theory conceptualizes leadership as a continual process that stems from collaboration, complex systems thinking, and innovation mindsets. Compared to transactional and transformational leadership concepts, complexity leadership practices hold promise to improve cost and quality in health care. © 2012 Wiley Periodicals, Inc.

COMPLEX TRAINING: A BRIEF REVIEW

Directory of Open Access Journals (Sweden)

William P. Ebben

2002-06-01

Full Text Available The effectiveness of plyometric training is well supported by research. Complex training has gained popularity as a training strategy combining weight training and plyometric training. Anecdotal reports recommend training in this fashion in order to improve muscular power and athletic performance. Recently, several studies have examined complex training. Despite the fact that questions remain about the potential effectiveness and implementation of this type of training, results of recent studies are useful in guiding practitioners in the development and implementation of complex training programs. In some cases, research suggests that complex training has an acute ergogenic effect on upper body power and the results of acute and chronic complex training include improved jumping performance. Improved performance may require three to four minutes rest between the weight training and plyometrics sets and the use of heavy weight training loads

European Conference on Complex Systems

CERN Document Server

Pellegrini, Francesco; Caldarelli, Guido; Merelli, Emanuela

2016-01-01

This work contains a stringent selection of extended contributions presented at the meeting of 2014 and its satellite meetings, reflecting scope, diversity and richness of research areas in the field, both fundamental and applied. The ECCS meeting, held under the patronage of the Complex Systems Society, is an annual event that has become the leading European conference devoted to complexity science. It offers cutting edge research and unique opportunities to study novel scientific approaches in a multitude of application areas. ECCS'14, its eleventh occurrence, took place in Lucca, Italy. It gathered some 650 scholars representing a wide range of topics relating to complex systems research, with emphasis on interdisciplinary approaches. The editors are among the best specialists in the area. The book is of great interest to scientists, researchers and graduate students in complexity, complex systems and networks.

The Seis Lagos Carbonatite Complex

International Nuclear Information System (INIS)

Issler, R.S.; Silva, G.G. da.

1980-01-01

The Seis Lagos Carbonatite Complex located about 840 Km from Manaus, on the northwestern part of the Estado do Amazonas, Brazil is described. Geological reconnaissance mapping by Radam Project/DNPM, of the southwestern portion of the Guianes Craton, determined three circular features arranged in a north-south trend and outcroping as thick lateritic radioactive hills surrounded by gneisses and mignatites of the peneplained Guianense Complex. Results of core drilling samples analysis of the Seis Lagos Carbonatite Complex are compared with some igneous rocks and limestones of the world on the basis of abundance of their minor and trace elements. Log-log variation diagram of strontium and barium in carbonatite and limestone, exemplifield by South Africa and Angola carbonatites, are compared with the Seis Lagos Carbonatite Complex. The Seis Lagos Carbonatite Complex belongs to the siderite-soevite type. (E.G.) [pt

Complex/Symplectic Mirrors

Energy Technology Data Exchange (ETDEWEB)

Chuang, Wu-yen; Kachru, Shamit; /Stanford U., ITP /SLAC; Tomasiello, Alessandro; /Stanford U., ITP

2005-10-28

We construct a class of symplectic non-Kaehler and complex non-Kaehler string theory vacua, extending and providing evidence for an earlier suggestion by Polchinski and Strominger. The class admits a mirror pairing by construction. Comparing hints from a variety of sources, including ten-dimensional supergravity and KK reduction on SU(3)-structure manifolds, suggests a picture in which string theory extends Reid's fantasy to connect classes of both complex non-Kaehler and symplectic non-Kaehler manifolds.

Disentangling Complexity from Randomness and Chaos

Directory of Open Access Journals (Sweden)

Lena C. Zuchowski

2012-02-01

Full Text Available This study aims to disentangle complexity from randomness and chaos, and to present a definition of complexity that emphasizes its epistemically distinct qualities. I will review existing attempts at defining complexity and argue that these suffer from two major faults: a tendency to neglect the underlying dynamics and to focus exclusively on the phenomenology of complex systems; and linguistic imprecisions in describing these phenomenologies. I will argue that the tendency to discuss phenomenology removed from the underlying dynamics is the main root of the difficulties in distinguishing complex from chaotic or random systems. In my own definition, I will explicitly try to avoid these pitfalls. The theoretical contemplations in this paper will be tested on a sample of five models: the random Kac ring, the chaotic CA30, the regular CA90, the complex CA110 and the complex Bak-Sneppen model. Although these modelling studies are restricted in scope and can only be seen as preliminary, they still constitute on of the first attempts to investigate complex systems comparatively.

Extending Life Concepts to Complex Systems

Directory of Open Access Journals (Sweden)

Jean Le Fur

2013-01-01

Full Text Available There is still no consensus definition of complex systems. This article explores, as a heuristic approach, the possibility of using notions associated with life as transversal concepts for defining complex systems. This approach is developed within a general classification of systems, with complex systems considered as a general ‘living things’ category and living organisms as a specialised class within this category. Concepts associated with life are first explored in the context of complex systems: birth, death and lifetime, adaptation, ontogeny and growth, reproduction. Thereafter, a refutation approach is used to test the proposed classification against a set of diverse systems, including a reference case, edge cases and immaterial complex systems. The summary of this analysis is then used to generate a definition of complex systems, based on the proposal, and within the background of cybernetics, complex adaptive systems and biology. Using notions such as ‘birth’ or ‘lifespan’ as transversal concepts may be of heuristic value for the generic characterization of complex systems, opening up new lines of research for improving their definition.

Complexation of buffer constituents with neutral complexation agents: part I. Impact on common buffer properties.

Science.gov (United States)

Riesová, Martina; Svobodová, Jana; Tošner, Zdeněk; Beneš, Martin; Tesařová, Eva; Gaš, Bohuslav

2013-09-17

The complexation of buffer constituents with the complexation agent present in the solution can very significantly influence the buffer properties, such as pH, ionic strength, or conductivity. These parameters are often crucial for selection of the separation conditions in capillary electrophoresis or high-pressure liquid chromatography (HPLC) and can significantly affect results of separation, particularly for capillary electrophoresis as shown in Part II of this paper series (Beneš, M.; Riesová, M.; Svobodová, J.; Tesařová, E.; Dubský, P.; Gaš, B. Anal. Chem. 2013, DOI: 10.1021/ac401381d). In this paper, the impact of complexation of buffer constituents with a neutral complexation agent is demonstrated theoretically as well as experimentally for the model buffer system composed of benzoic acid/LiOH or common buffers (e.g., CHES/LiOH, TAPS/LiOH, Tricine/LiOH, MOPS/LiOH, MES/LiOH, and acetic acid/LiOH). Cyclodextrins as common chiral selectors were used as model complexation agents. We were not only able to demonstrate substantial changes of pH but also to predict the general complexation characteristics of selected compounds. Because of the zwitterion character of the common buffer constituents, their charged forms complex stronger with cyclodextrins than the neutral ones do. This was fully proven by NMR measurements. Additionally complexation constants of both forms of selected compounds were determined by NMR and affinity capillary electrophoresis with a very good agreement of obtained values. These data were advantageously used for the theoretical descriptions of variations in pH, depending on the composition and concentration of the buffer. Theoretical predictions were shown to be a useful tool for deriving some general rules and laws for complexing systems.

Alanine water complexes.

Science.gov (United States)

Vaquero, Vanesa; Sanz, M Eugenia; Peña, Isabel; Mata, Santiago; Cabezas, Carlos; López, Juan C; Alonso, José L

2014-04-10

Two complexes of alanine with water, alanine-(H2O)n (n = 1,2), have been generated by laser ablation of the amino acid in a supersonic jet containing water vapor and characterized using Fourier transform microwave spectroscopy. In the observed complexes, water molecules bind to the carboxylic group of alanine acting as both proton donors and acceptors. In alanine-H2O, the water molecule establishes two intermolecular hydrogen bonds forming a six-membered cycle, while in alanine-(H2O)2 the two water molecules establish three hydrogen bonds forming an eight-membered ring. In both complexes, the amino acid moiety is in its neutral form and shows the conformation observed to be the most stable for the bare molecule. The microsolvation study of alanine-(H2O)n (n = 1,2) can be taken as a first step toward understanding bulk properties at a microscopic level.

Solution chemistry of lanthanide complexes

International Nuclear Information System (INIS)

Brittain, H.G.

1979-01-01

Intermolecular energy transfer from Tb 3+ to Eu 3+ , luminescence intensity measurements, potentiometric titrations, differential absorption spectroscopy, and spectroscopic titrations were all used to study the binding of lanthanide ions by serine and threonine. At low pH (3.0 to 6.0) the complexes are mononuclear and ligand is only weakly bound. In the pH interval of 6.0 to 8.5 stronger interaction takes place between the ligand and the metal (with possible coordination of the undissociated hydroxyl group), and self-association of complexes becomes important. Above pH 8.5, base hydrolysis of the complexes leads to highly associated species in solution and shortly above this pH an insoluble precipitate is formed. It was found that energy could be transferred from Tb 3+ to Eu 3+ more efficiently among complexes prepared from racemic ligands than in complexes made from resolved ligand, but this stereoselectivity was only observed at pH values greater than 6.5 and in solutions having a 1:10 ratio of metal-to-ligand. No stereoselectivity was found in solutions having 1:5 ratios, and this observation was explained by the existence of 1:2 metal-ligand complexes existing in solutions having the higher ratio of metal-to-ligand (only 1:1 complexes are then found at lower ratios of metal-to-ligand). (author)

Real and complex analysis

CERN Document Server

Apelian, Christopher; Taft, Earl; Nashed, Zuhair

2009-01-01

The Spaces R, Rk, and CThe Real Numbers RThe Real Spaces RkThe Complex Numbers CPoint-Set Topology Bounded SetsClassification of Points Open and Closed SetsNested Intervals and the Bolzano-Weierstrass Theorem Compactness and Connectedness Limits and Convergence Definitions and First Properties Convergence Results for SequencesTopological Results for Sequences Properties of Infinite SeriesManipulations of Series in RFunctions: Definitions and Limits DefinitionsFunctions as MappingsSome Elementary Complex FunctionsLimits of FunctionsFunctions: Continuity and Convergence Continuity Uniform Continuity Sequences and Series of FunctionsThe DerivativeThe Derivative for f: D1 → RThe Derivative for f: Dk → RThe Derivative for f: Dk → RpThe Derivative for f: D → CThe Inverse and Implicit Function TheoremsReal IntegrationThe Integral of f: [a, b] → RProperties of the Riemann Integral Further Development of Integration TheoryVector-Valued and Line IntegralsComplex IntegrationIntroduction to Complex Integrals Fu...

Unifying Complexity and Information

Science.gov (United States)

Ke, Da-Guan

2013-04-01

Complex systems, arising in many contexts in the computer, life, social, and physical sciences, have not shared a generally-accepted complexity measure playing a fundamental role as the Shannon entropy H in statistical mechanics. Superficially-conflicting criteria of complexity measurement, i.e. complexity-randomness (C-R) relations, have given rise to a special measure intrinsically adaptable to more than one criterion. However, deep causes of the conflict and the adaptability are not much clear. Here I trace the root of each representative or adaptable measure to its particular universal data-generating or -regenerating model (UDGM or UDRM). A representative measure for deterministic dynamical systems is found as a counterpart of the H for random process, clearly redefining the boundary of different criteria. And a specific UDRM achieving the intrinsic adaptability enables a general information measure that ultimately solves all major disputes. This work encourages a single framework coving deterministic systems, statistical mechanics and real-world living organisms.

Workspace Program for Complex-Number Arithmetic

Science.gov (United States)

Patrick, M. C.; Howell, Leonard W., Jr.

1986-01-01

COMPLEX is workspace program designed to empower APL with complexnumber capabilities. Complex-variable methods provide analytical tools invaluable for applications in mathematics, science, and engineering. COMPLEX written in APL.

Is a "Complex" Task Really Complex? Validating the Assumption of Cognitive Task Complexity

Science.gov (United States)

Sasayama, Shoko

2016-01-01

In research on task-based learning and teaching, it has traditionally been assumed that differing degrees of cognitive task complexity can be inferred through task design and/or observations of differing qualities in linguistic production elicited by second language (L2) communication tasks. Without validating this assumption, however, it is…