WorldWideScience

Sample records for cum nuncio sidereo

  1. WRR editor Ronald Cummings

    Science.gov (United States)

    1984-04-01

    It has been nearly a year since Ronald Cummings took over as policy sciences editor of Water Resources Research (WRR), and in that time he has worked to make the journal live up to its role as “an interdisciplinary journal integrating research in the social and natural sciences of water.” Cummings takes the “interdisciplinary” part seriously. “I'd like to see a much broader range of policy issues presented to readers,” he says. “I would hope it would then stimulate interchange between our colleagues concerning evolving issues of the '80s and '90s.”Cummings brings a solid background as a resource economist to his 4-year term as editor, which began last January and runs until December 1987. Cummings succeeds Jared Cohon as policy sciences editor. Stephen J. Burges is the WRR editor for hydrological, physical, chemical, and biological sciences. Now a Professor of Economics and Director of the Program in Natural Resources Economics at the University of New Mexico, Cummings is a past president of the Association of Environmental and Resource Economists. He has been a consultant in matters of water resources management, forestry management, and energy policy for more than a decade, working on projects in both the United States and Latin America. Since joining the faculty at New Mexico in 1975, he has, among other things, worked with engineers at the Los Alamos National Laboratory in developing operation'management models for hot, dry rock geothermal systems.

  2. Jaynes-Cummings photonic superlattices.

    Science.gov (United States)

    Longhi, Stefano

    2011-09-01

    A classical realization of the Jaynes-Cummings (JC) model, describing the interaction of a two-level atom with a quantized cavity mode, is proposed based on light transport in engineered waveguide superlattices. The optical setting enables us to visualize in Fock space dynamical regimes not yet accessible in quantum systems, providing new physical insights into the deep strong coupling regime of the JC model. In particular, bouncing of photon number wave packets in Hilbert space and revivals of populations are explained as generalized Bloch oscillations in an inhomogeneous tight-binding lattice.

  3. Jaynes--Cummings photonic superlattices

    Science.gov (United States)

    Longhi, Stefano

    2011-09-01

    A classical realization of the Jaynes--Cummings (JC) model, describing the interaction of a two-level atom with a quantized cavity mode, is proposed based on light transport in engineered waveguide superlattices. The optical setting enables us to visualize in Fock space dynamical regimes not yet accessible in quantum systems, providing new physical insights into the deep strong coupling regime of the JC model. In particular, bouncing of photon number wave packets in Hilbert space and revivals of populations are explained as generalized Bloch oscillations in an inhomogeneous tight-binding lattice.

  4. Two-mode generalization of the Jaynes-Cummings and Anti-Jaynes-Cummings models

    Science.gov (United States)

    Choreño, E.; Ojeda-Guillén, D.; Salazar-Ramírez, M.; Granados, V. D.

    2017-12-01

    We introduce two generalizations of the Jaynes-Cummings (JC) model for two modes of oscillation. The first model is formed by two Jaynes-Cummings interactions, while the second model is written as a simultaneous Jaynes-Cummings and Anti-Jaynes-Cummings (AJC) interactions. We study some of its properties and obtain the energy spectrum and eigenfunctions of these models by using the tilting transformation and the Perelomov number coherent states of the two-dimensional harmonic oscillator. Moreover, as physical applications, we connect these new models with two important and novel problems: The relativistic non-degenerate parametric amplifier and the relativistic problem of two coupled oscillators.

  5. Fifty years of Jaynes-Cummings physics

    Science.gov (United States)

    Greentree, Andrew D.; Koch, Jens; Larson, Jonas

    2013-11-01

    This special issue commemorates the 50th anniversary of the seminal paper published by E T Jaynes and F W Cummings [1], the fundamental model which they introduced and now carries their names, and celebrates the remarkable host of exciting research on Jaynes-Cummings physics throughout the last five decades. The Jaynes-Cummings model has been taking the prominent stance as the 'hydrogen atom of quantum optics' [2]. Generally speaking, it provides a fundamental quantum description of the simplest form of coherent radiation-matter interaction. The Jaynes-Cummings model describes the interaction between a single electromagnetic mode confined to a cavity, and a two-level atom. Energy is exchanged between the field and the atom, which leads directly to coherent population oscillations (Rabi oscillations) and superposition states (dressed states). Being exactly solvable, the Jaynes-Cummings model serves as a most useful toy model, and as such it is a textbook example of the physicists' popular strategy of simplifying a complex problem to its most elementary constituents. Thanks to the simplicity of the Jaynes-Cummings model, this caricature of coherent light-matter interactions has never lost its appeal. The Jaynes-Cummings model is essential when discussing experiments in quantum electrodynamics (indeed the experimental motivation of the Jaynes-Cummings model was evident already in the original paper, dealing as it does with the development of the maser), and it has formed the starting point for much fruitful research ranging from ultra-cold atoms to cavity quantum electrodynamics. In fact, Jaynes-Cummings physics is at the very heart of the beautiful experiments by S Haroche and D Wineland, which recently earned them the 2012 Nobel Prize in physics. Indeed, as with most significant models in physics, the model is invoked in settings that go far beyond its initial framework. For example, recent investigations involving multi-level atoms, multiple atoms [3, 4], multiple

  6. La documentación de los nuncios y auditores pontificios: los pleitos de Francisco Gasca Salazar, Abad de San Isidoro de León (1599-1621

    Directory of Open Access Journals (Sweden)

    Osorio Alonso, María

    2006-12-01

    Full Text Available This article intends to deepen in the documentation of papal nuncio and other officials of the Roman curia, leaving from the examples sent to the abbot of the monastery of San Isidoro de León, Francisco Gasca Salazar, personage that starred in numerous lawsuits while occupied that position. This way, we try to develop the lawsuits and to make a diplomatic study of this kind of documents, found in San Isidoro’s archive.Este trabajo pretende profundizar en la documentación de los nuncios pontificios y de otros oficiales pertenecientes a la curia romana, partiendo de los ejemplos referidos al abad del monasterio de San Isidoro de León, Francisco Gasca Salazar, personaje que protagonizó numerosos pleitos eclesiásticos durante los veinte años que ocupó dicho cargo. Así, además de desarrollar los procesos judiciales, se realiza un estudio diplomático de los documentos de este tipo encontrados en el archivo del propio monasterio de San Isidoro.

  7. Excitation functions of $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions up to 50 MeV

    OpenAIRE

    Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.

    2014-01-01

    Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...

  8. [Pediamécum: one year of experience].

    Science.gov (United States)

    Piñeiro Pérez, R; Martínez Fernández-Llamazares, C; Calvo Rey, C; Piñeiro Pérez, A P; Criado Vega, E A; Bravo Acuña, J; Cabrera García, L; Mellado Peña, M J

    2014-10-01

    In 2011, the Spanish Association of Pediatrics decided to support the most ambitious project of its newly created Committee for Medicinal Products: Pediamécum. This is the first free on-line database with information on medicinal products for pediatric use in Spain. The web page http://pediamecum.es/ started on December 17 December 2012. One year later, Pediamécum includes 580 registered drugs. The website achieved more than one million page views by the end of 2013. Because of the first anniversary of Pediamécum, a survey was performed to request the feeling of users. Four hundred eighty-three responses were obtained. Ninety-five percent believed that it is easy to navigate through the web, and 74% said that their doubts about the use of medicines in children were always resolved. The overall rating of Pediamécum is 7.5/10. The aims of Pediamécum are being accomplished; which is reflected essentially due to it becoming a useful tool for all professionals who care for children in their daily clinical practice. Copyright © 2014 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.

  9. e.e. cummings as an Expressionist poet

    Directory of Open Access Journals (Sweden)

    S. Coetzee-Van Rooy

    1994-05-01

    Full Text Available This study investigates the poetry of e.e. cummings from what is considered a novel hut productive point of view: it holds that in order to categorize cummings as an Expressionist poet (an enterprise which, it is maintained, will provide the reader with a useful frame for grappling with certain troubling aspects of cummings poetry it is necessary to develop a reading strategy based on a method derived from the social sciences and the study of linguistics to make the categorization both feasible and responsible. Using techniques of choice suggested by critics, and developing further techniques of randomizing developed in accordance with the social sciences and linguistics, it was possible to arrive at a representative corpus of poetry, which could then be tested against criteria of Expressionism developed from a comprehensive literature study involving both poetry and the fine arts. This modus operandi has enabled the authors to assert that cummings could most fruitfully be read as an Expressionist poet. It is also suggested that this method could be most fruitfully extrapolated to similar studies involving other 'schools' and styles and other poets.

  10. HISTORIOGRAPHY OF THE PRINT MEDIA: A GLOBAL-CUM ...

    African Journals Online (AJOL)

    user

    2012-07-01

    Jul 1, 2012 ... HISTORIOGRAPHY OF THE PRINT MEDIA: A GLOBAL-CUM-NIGERIAN. PERSPECTIVE. Akpobo Odorume. Oduduwa University, Ipetumodu, Ile-Ife, Osun State. Abstract. The print media as we know them today have developed over a number of centuries. Any discourse on its (print media) evolution ...

  11. Performance Of Animal-drawn, Ripper Attached Maize-Cum ...

    African Journals Online (AJOL)

    EIAR),. P.O.Box 436, Melkassa, ... In seed emergence/plant population/ test, it was found that there was significant variation among the means of ... planter and sweeper attached, animal-drawn seed-cum-fertilizer planter. Hand operated jab ...

  12. Gravitational Jaynes–Cummings model beyond the rotating wave ...

    Indian Academy of Sciences (India)

    In this paper, the quantum properties of a two-level atom and the cavity-field in the Jaynes–Cummings model with the gravity beyond the rotating wave approximation are investigated. For this purpose, by solving the Schrödinger equation in the interaction picture, the evolving state of the system is found by which the ...

  13. Advanced adsorption cooling cum desalination cycle: A thermodynamic framework

    KAUST Repository

    Chakraborty, Anutosh

    2011-01-01

    We have developed a thermodynamic framework to calculate adsorption cooling cum desalination cycle performances as a function of pore widths and pore volumes of highly porous adsorbents, which are formulated from the rigor of thermodynamic property surfaces of adsorbent-adsorbate system and the adsorption interaction potential between them. Employing the proposed formulations, the coefficient of performance (COP) and overall performance ratio (OPR) of adsorption cycle are computed for various pore widths of solid adsorbents. These results are compared with experimental data for verifying the proposed thermodynamic formulations. It is found from the present analysis that the COP and OPR of adsorption cooling cum desalination cycle is influenced by (i) the physical characteristics of adsorbents, (ii) characteristics energy and (iii) the surface-structural heterogeneity factor of adsorbent-water system. The present study confirms that there exists a special type of adsorbents having optimal physical characteristics that allows us to obtain the best performance.

  14. Dispersive regime of the Jaynes-Cummings and Rabi lattice

    Science.gov (United States)

    Zhu, Guanyu; Schmidt, Sebastian; Koch, Jens

    2013-11-01

    Photon-based strongly correlated lattice models like the Jaynes-Cummings and Rabi lattices differ from their more conventional relatives like the Bose-Hubbard model by the presence of an additional tunable parameter: the frequency detuning between the pseudo-spin degree of freedom and the harmonic mode frequency on each site. Whenever this detuning is large compared to relevant coupling strengths, the system is said to be in the dispersive regime. The physics of this regime is well-understood at the level of a single Jaynes-Cummings or Rabi site. Here, we extend the theoretical description of the dispersive regime to lattices with many sites, for both strong and ultra-strong coupling. We discuss the nature and spatial range of the resulting qubit-qubit and photon-photon coupling, demonstrate the emergence of photon-pairing and squeezing and illustrate our results by exact diagonalization of the Rabi dimer.

  15. Qudit quantum computation in the Jaynes-Cummings model

    DEFF Research Database (Denmark)

    Mischuck, Brian; Mølmer, Klaus

    2013-01-01

    - and two-qudit gates necessary for universal quantum computation by breaking down the desired unitary transformations into a series of state preparations implemented with the Law-Eberly scheme [ Law and Eberly Phys. Rev. Lett. 76 1055 (1996)]. The second method replaces some of the analytical pulse......We have developed methods for performing qudit quantum computation in the Jaynes-Cummings model with the qudits residing in a finite subspace of individual harmonic oscillator modes, resonantly coupled to a spin-1/2 system. The first method determines analytical control sequences for the one...

  16. Generalized Jaynes-Cummings Hamiltonians by shape-invariant hierarchies and their SUSY partners

    Energy Technology Data Exchange (ETDEWEB)

    Hussin, V [Centre de recherches mathematiques et Departement de mathematiques et de statistique, Universite de Montreal, C P 6128, succ. Centre-ville, Montreal (Quebec), H3C 3J7 (Canada); Kuru, S [Departamento de Fisica Teorica, Atomica y Optica, Universidad de Valladolid, 47071 Valladolid (Spain); Negro, J [Departamento de Fisica Teorica, Atomica y Optica, Universidad de Valladolid, 47071 Valladolid (Spain)

    2006-09-08

    A generalization of the matrix Jaynes-Cummings model in the rotating wave approximation is proposed by means of the shape-invariant hierarchies of scalar factorized Hamiltonians. A class of Darboux transformations (sometimes called SUSY transformations in this context) suitable for these generalized Jaynes-Cummings models is constructed. Finally one example is worked out using the methods developed.

  17. Quantum phase transition in a multiconnected Jaynes-Cummings lattice

    Science.gov (United States)

    Xue, Jian; Seo, Kangjun; Tian, Lin; Xiang, Tao

    2017-11-01

    The rapid progress in quantum technology enables the implementation of artificial many-body systems with correlated photons and polaritons. A multiconnected Jaynes-Cummings (MCJC) lattice can be constructed by connecting qubits and cavities alternately. Such models can be realized with superconducting qubits coupled to superconducting microwave resonators or with quantum dots coupled to optical nanocavities. We study the physical properties of a one-dimensional MCJC lattice using the density-matrix renormalization-group method. This model has an intrinsic symmetry between the left and right qubit-cavity couplings. The competition between these couplings may drive the ground state either to a Mott-insulating phase or to a superfluid phase at integer fillings. We calculate the single-particle and density-density correlation functions, the correlation lengths in the Mott-insulating phase, and the Luttinger parameters in the superfluid phase and determine accurately the critical points that separate these two phases.

  18. A quantum heat engine based on Tavis-Cummings model

    Science.gov (United States)

    Sun, Kai-Wei; Li, Ran; Zhang, Guo-Feng

    2017-09-01

    This paper will investigate a four-stroke quantum heat engine based on the Tavis-Cummings model. The cycle of the heat engine is similar to the Otto cycle in classical thermodynamics. The relationship between output power as well as cycle efficiency and external physical system parameters are given. Under this condition, the entanglement behavior of the system will be studied. The system can show considerable entanglement by strictly controlling relevant parameters. Unlike common two-level quantum heat engines, efficiency is a function of temperature, showing interesting and unexpected phenomena. Several ways to adjust engine properties by external parameters are proposed, with which the output power and efficiency can be optimized. The heat engine model exhibits high efficiency and output power with the participation of a small number of photons, and decay rapidly as the number of photons increases in entangled area but shows interesting behaviors in non-entangled area of photon numbers.

  19. Isabelle Alfandary. E.E. Cummings. Eric Athenot. Walt Whitman.

    Directory of Open Access Journals (Sweden)

    Alain Suberchicot

    2006-04-01

    Full Text Available On doit louer Marc Chénetier pour avoir suscité l’écriture de ces deux volumes consacrés à Cummings et à Whitman, et encouragé ainsi les chercheurs à consacrer leurs travaux à la poésie américaine. Isabelle Alfandary et Eric Athenot s’acquittent avec passion et finesse de la tâche qui leur a été confiée de présenter une synthèse dans un espace relativement restreint. Dans les deux cas, nous sommes devant des ensembles littéraires ambitieux, quoique très différents, et nés d’époques qui ne se ...

  20. The Effects Of A Nigerian Specie Of cum abum tletoe) Leaf Extract ...

    African Journals Online (AJOL)

    The Effects Of A Nigerian Specie Of cum abumtletoe) Leaf Extract On The Blood Pressure Of Normotensive And Doca-Induced Hypertensive Rats. AE Eno, UE Ibokette, OE Ofem, FB Unoh, E Nkanu, N Azah, JO Ibu ...

  1. Oscillator-like coherent states for the Jaynes-Cummings Model

    Science.gov (United States)

    Berubelauziere, Y.; Hussin, V.; Nieto, Michael M.

    1995-01-01

    A new way of diagonalizing the Jaynes-Cummings Hamiltonian is proposed, which allows the definition of annihilation operators and coherent states for this model. Mean values and dispersions over these states are computed and interpreted.

  2. Essays on Incompatibilities: A study of E. E. Cummings' poetry and the concept of the uncanny.

    OpenAIRE

    Mukhiya, Shradha

    2016-01-01

    This thesis explores the poetry of E. E. Cummings and the concept of the uncanny to locate how Cummings through the adaptation of various deviations positions the reader and the text in a circle of familiarity and strangeness. The relationship between habit, uncertainty and familiarity is proposed as the axis that simultaneously becomes the cause and the solution for the perception. Eight poems together with deviation styles found in Cummings’ poem is analyzed in this paper.

  3. E. E. Cummings: From Parenthesis to Personality (Part II

    Directory of Open Access Journals (Sweden)

    Uroš Mozetič

    2007-06-01

    Full Text Available The paper presents the unique oeuvre of E.E. Cummings; who claims an outstanding position in the heritage of American poetry; as a case of Bildungsdichtung. This status is largely due to his highly innovative and iconoclastic approach to poetic composition; starting from his early rebellious endeavours drawing on an astounding variety of non-standard and downright shocking potentialities of the English language (including such peculiar linguistic and stylistic idiosyncracies as drastic changes of the syntactic English word order; shifts at the morphology and word-formation level; unorthodox use of punctuation; extravagant typography and spacing or arrangement of space between the lines; a diversity of meters and rhymes; as well as seemingly eccentric imagery; to his later and invariably maturer poetic diction – the diction of one who has apparently come to terms with the world and his fellow-beings; realising that genuine wisdom resides in the understanding and forgiveness of the inherently fallible human nature rather than in its continuous sardonic scrutiny.

  4. Sol-gel-cum-hydrothermal synthesis of mesoporous Co-Fe@Al2O3 ...

    Indian Academy of Sciences (India)

    A combined sol-gel-cum-hydrothermal method has been employed to synthesize novel monometal- lic (Mn, Fe, Co) and bimetallic (Co-Fe, .... Mesoporous Al2O3 was synthesized by sol-gel method. Cetyltrimethylammonium bromide ... TEOS silica source was added to the mixture and stirred for. 2 h (solution A) to obtain ...

  5. A noble additive cum compatibilizer for dispersion of nanoclay into ethylene octene elastomer

    CSIR Research Space (South Africa)

    Mondal, S

    2016-06-01

    Full Text Available This paper introduces a poly(ethylene-co-octene)-poly(ethylene-co-vinyl acetate) double network hybrid as a noble additive cum compatibilizer for poly(ethylene-co-octene) (POE). The addition of only 0.5 mass% of the hybrid into POE has raised...

  6. A Stylistic Study on the Linguistic Deviations in E. E. Cummings' Poetry

    Science.gov (United States)

    Li, Xin; Shi, Mengchen

    2015-01-01

    Regarded as the pioneer of experimental poetry, E. E. Cummings' unconventional treatment of poetic language has reached an unprecedented acme, which has intrigued and baffled numerous scholars, researchers and readers alike. Nevertheless, the very existence of poetry, like other types of literary texts, demonstrates the significance and value of…

  7. Sol-gel-cum-hydrothermal synthesis of mesoporous Co-Fe ...

    Indian Academy of Sciences (India)

    A combined sol-gel-cum-hydrothermalmethod has been employed to synthesize novelmonometallic (Mn, Fe, Co) and bimetallic (Co-Fe, Mn-Co, Fe-Mn) nanoparticles loaded onto Al₂O₃−MCM-41. Powder XRD, N2 sorption, field emission scanning electron microscopy (FESEM) and high resolution transmission electron ...

  8. Structural stability and magnetic properties of CumConNO (m + n = 2 ...

    Indian Academy of Sciences (India)

    2017-09-27

    Sep 27, 2017 ... P-Y Huo et al configuration, stability, adsorption properties and magnetic properties of the NO molecules adsorbed on CumCon (2 ≤ m+n ≤ 7) clusters are studied, which may provide a research foundation for application of mechanism of NO adsorption on. Cu–Co alloy clusters. 2. Computational method.

  9. Advertisement for the position of “Copy Editor cum Proof Reader ...

    Indian Academy of Sciences (India)

    user

    science (please visit www.ias.ac.in for more details). The Academy is looking for a position of “Copy Editor cum Proof. Reader” on contract basis. Applications are invited from resourceful persons with excellent skills in copy editing original research articles and publishing them under tight deadlines. Candidates with LaTeX.

  10. Polyculture and fish yield in rice-cum-fish culture system in Dadin ...

    African Journals Online (AJOL)

    Rice-cum-fish culture was carried out in Dadin Kowa rice fields, Gombe State, Nigeria with a view to determining the effect of different combination of Clarias gariepinus, Oreochromis niloticus and Cyprinus carpio on fish yield. Six rice paddy fields labeled A – C were used for the sudy. Raised riceseedlings (FARO 27) were ...

  11. Synthetic gauge fields and homodyne transmission in Jaynes-Cummings lattices

    Energy Technology Data Exchange (ETDEWEB)

    Nunnenkamp, A; Girvin, S M [Departments of Physics and Applied Physics, Yale University, New Haven, CT 06520 (United States); Koch, Jens, E-mail: andreas.nunnenkamp@yale.edu [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States)

    2011-09-15

    Many-body physics is traditionally concerned with systems of interacting massive particles. Recent studies of effective interactions between photons, induced in the circuit quantum electrodynamics (QED) architecture by coupling the microwave field to superconducting qubits, have paved the way for photon-based many-body physics. We derive the magnitude and intrinsic signs of photon hopping amplitudes in such circuit QED arrays. For a finite, ring-shaped Jaynes-Cummings lattice exposed to a synthetic gauge field, we show that degeneracies in the single-excitation spectrum emerge, which can give rise to strong correlations for the interacting system with multiple excitations. We calculate the homodyne transmission for such a device, explain the generalization of vacuum Rabi splittings known for the single-site Jaynes-Cummings model and identify fingerprints of interactions beyond the linear response regime.

  12. Synthetic gauge fields and homodyne transmission in Jaynes-Cummings lattices

    Science.gov (United States)

    Nunnenkamp, A.; Koch, Jens; Girvin, S. M.

    2011-09-01

    Many-body physics is traditionally concerned with systems of interacting massive particles. Recent studies of effective interactions between photons, induced in the circuit quantum electrodynamics (QED) architecture by coupling the microwave field to superconducting qubits, have paved the way for photon-based many-body physics. We derive the magnitude and intrinsic signs of photon hopping amplitudes in such circuit QED arrays. For a finite, ring-shaped Jaynes-Cummings lattice exposed to a synthetic gauge field, we show that degeneracies in the single-excitation spectrum emerge, which can give rise to strong correlations for the interacting system with multiple excitations. We calculate the homodyne transmission for such a device, explain the generalization of vacuum Rabi splittings known for the single-site Jaynes-Cummings model and identify fingerprints of interactions beyond the linear response regime.

  13. A DCCP Congestion Control Mechanism for Wired- cum-Wireless Environments

    OpenAIRE

    Naqvi, Ijaz Haider; Pérennou, Tanguy

    2007-01-01

    International audience; Existing transport protocols, be it TCP, SCTP or DCCP, do not provide an efficient congestion control mechanism for heterogeneous wired-cum-wireless networks. Solutions involving implicit loss discrimination schemes have been proposed but were never implemented. Appropriate mechanisms can dramatically improve bandwidth usage over the Internet, especially for multimedia transport based on partial reliability. In this paper we have implemented and evaluated a congestion ...

  14. A CATASTROPHIC-CUM-RESTORATIVE QUEUING SYSTEM WITH CORRELATED BATCH ARRIVALS AND VARIABLE CAPACITY

    Directory of Open Access Journals (Sweden)

    Rakesh Kumar

    2008-07-01

    Full Text Available In this paper, we study a catastrophic-cum-restorative queuing system with correlated batch arrivals and service in batches of variable sizes. We perform the transient analysis of the queuing model. We obtain the Laplace Transform of the probability generating function of system size. Finally, some particular cases of the model have been derived and discussed. Keywords: Queue length, Catastrophes, Correlated batch arrivals, Broadband services, Variable service capacity, and Restoration.

  15. A generalized Jaynes-Cummings model: The relativistic parametric amplifier and a single trapped ion

    Energy Technology Data Exchange (ETDEWEB)

    Ojeda-Guillén, D., E-mail: dojedag@ipn.mx [Escuela Superior de Cómputo, Instituto Politécnico Nacional, Av. Juan de Dios Bátiz esq. Av. Miguel Othón de Mendizábal, Col. Lindavista, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico); Mota, R. D. [Escuela Superior de Ingeniería Mecánica y Eléctrica, Unidad Culhuacán, Instituto Politécnico Nacional, Av. Santa Ana No. 1000, Col. San Francisco Culhuacán, Delegación Coyoacán, C.P. 04430 Ciudad de México (Mexico); Granados, V. D. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico)

    2016-06-15

    We introduce a generalization of the Jaynes-Cummings model and study some of its properties. We obtain the energy spectrum and eigenfunctions of this model by using the tilting transformation and the squeezed number states of the one-dimensional harmonic oscillator. As physical applications, we connect this new model to two important and novelty problems: the relativistic parametric amplifier and the quantum simulation of a single trapped ion.

  16. Roles de los Centros Universitarios Municipales (CUM en el desarrollo local de los municipios cubanos

    Directory of Open Access Journals (Sweden)

    Carlos A. Hernández M.

    2012-06-01

    Full Text Available Se conceptualiza en el aporte de la Educación Superior al Desarrollo Local en los municipios, cómo se inserta en el proceso, las amenazas a su participación y las oportunidades generadas por su inclusión. Se analiza la situación actual y perspectiva y las Estrategias a seguir por la Educación Superior en los municipios. Se define como se trabaja la seguridad alimentaria en función del Desarrollo Local, la superación de Postgrado en el CUM, la formación y superación de los cuadros, la participación en proyectos pertinentes en energía, medio ambiente, servicios a la población, industrias locales y problemas socio - comunitarios y la formación vocacional y articulación pertinente con la Enseñanza Técnico Profesional. Por último se hace una propuesta de Indicadores y herramientas para medir el impacto de la Gestión del Conocimiento y la Innovación dentro del Programa de Desarrollo Local dividida en 2 grupos: Indicadores de funcionamiento interno del CUM e Indicadores de funcionamiento del CUM hacia el Desarrollo Local del Municipio.

  17. NLRP3 gene knockout blocks NF-κB and MAPK signaling pathway in CUMS-induced depression mouse model.

    Science.gov (United States)

    Su, Wen-Jun; Zhang, Yi; Chen, Ying; Gong, Hong; Lian, Yong-Jie; Peng, Wei; Liu, Yun-Zi; Wang, Yun-Xia; You, Zi-Li; Feng, Shi-Jie; Zong, Ying; Lu, Guo-Cai; Jiang, Chun-Lei

    2017-03-30

    Abundant researches indicate that neuroinflammation has important roles in the pathophysiology of depression. Our previous study found that the NLRP3 inflammasome mediated stress-induced depression-like behavior in mice via regulating neuroinflammation. However, it still remains unclear that how the NLRP3 inflammasome influences related inflammatory signaling pathway to contribute to neuroinflammation in depression. We used wild-type mice and NLRP3 gene knockout mice to explore the role of NLRP3 inflammasome and related inflammatory signaling pathways in chronic unpredictable mild stress (CUMS) induced depression mouse model. Both wild-type and NLRP3 knockout stress group mice gained less weight than control group mice after 4 weeks CUMS exposure. The wild-type mice subjected to 4 weeks CUMS displayed depression-like behaviors, including decreased sucrose preference and increased immobility time in the tail suspension test. The NLRP3 knockout stress group mice didn't demonstrate depression-like behaviors. The levels of interleukin-1β protein in serum and hippocampi of CUMS exposed wild-type mice were significantly higher, while the NLRP3 knockout stress group mice didn't show an elevation of interleukin-1β levels. Similarly to early researches, we found that CUMS led to promoted NLRP3 expression in hippocampi. In addition, the hippocampi in CUMS exposed wild-type mice had higher p-JNK and p-p38 protein expression, which indicated activation of the mitogen-activated protein kinases (MAPK) pathway. The knockout of NLRP3 gene inhibited CUMS-induced activation of the MAPK pathway. The nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) protein complex was activated in the hippocampi of wild-type mice after CUMS exposure, while knockout of NLRP3 gene hindered its activation. These data further proved that the NLRP3 inflammasome mediated CUMS-induced depression-like behavior. The NLRP3 inflammasome regulated CUMS-induced MAPK pathway and NF

  18. Cum se traduce ‘rușinea’. Abordare traductologică (I

    Directory of Open Access Journals (Sweden)

    Magda Jeanrenaud

    2017-03-01

    Full Text Available Pornind de la sfera semantică și lexicală a conceptelor honte (limba franceză și, respectiv, rușine (limba română, îmi propun să examinez modul cum se traduce acesta în limba română pornind de la un studiu de caz. În acest scop, voi încerca să elaborez un studiu traductologic comparativ al lucrării lui Boris Cyrulnik, intitulată Mourir de dire. La honte (Éditions Odile Jacob, Paris, 2010 și a traducerii sale în limba română, intitulată Mai bine mor decît să spun. Rușinea (traducere din limba franceză de Valentin Protopopescu, Editura Trei, col. „Psihologia pentru toți”, București, 2012. Textul lui Cyrulnik are o particularitate: oscilează între factura literară și cea a unui text specializat. Din acest punct de vedere, transpunerea lui pune la încercare teoriile funcționaliste ale traducerii și, mai ales, teoria skopos-ului elaborată de Katharina Reiss și Hans Vermeer: este interesant de analizat cum „decodează” traducătorul „intenționalitatea” acestui tip de text, totuși specializat, cum decide el să transpună sfera sa semantică și lexicală în limba română.

  19. Applications of the Jaynes-Cummings model for the detection of nonorthogonal quantum states

    Science.gov (United States)

    Sasaki, M.; Usuda, T. S.; Hirota, O.; Holevo, A. S.

    1996-03-01

    This paper presents two kinds of applications of the Jaynes-Cummings model to improve detection schemes for the binary phase-shift-keyed signals of the coherent states ||α> and ||-α>. The first application raises the amount of exact retrodiction of a mixture made by choosing at random from ||α> and ||-α>. The second application is concerned with realizing the optimum receiver to achieve a low decision error. Instead of optical detection, atomic level detection after mapping from them to two-level states of an atom will be proposed.

  20. A classical simulation of nonlinear Jaynes-Cummings and Rabi models in photonic lattices

    Science.gov (United States)

    Rodríguez-Lara, B. M.; Soto-Eguibar, Francisco; Cárdenas, Alejandro Zárate; Moya-Cessa, H. M.

    2013-05-01

    The interaction of a two-level atom with a single-mode quantized field is one of the simplest models in quantum optics. Under the rotating wave approximation, it is known as the Jaynes-Cummings model and without it as the Rabi model. Real-world realizations of the Jaynes-Cummings model include cavity, ion trap and circuit quantum electrodynamics. The Rabi model can be realized in circuit quantum electrodynamics. As soon as nonlinear couplings are introduced, feasible experimental realizations in quantum systems are drastically reduced. We propose a set of two photonic lattices that classically simulates the interaction of a single two-level system with a quantized field under field nonlinearities and nonlinear couplings as long as the quantum optics model conserves parity. We describe how to reconstruct the mean value of quantum optics measurements, such as photon number and atomic energy excitation, from the intensity and from the field, such as von Neumann entropy and fidelity, at the output of the photonic lattices. We discuss how typical initial states involving coherent or displaced Fock fields can be engineered from recently discussed Glauber-Fock lattices. As an example, the Buck-Sukumar model, where the coupling depends on the intensity of the field, is classically simulated for separable and entangled initial states.

  1. Dynamics of Entanglement in Jaynes–Cummings Nodes with Nonidentical Qubit-Field Coupling Strengths

    Directory of Open Access Journals (Sweden)

    Li-Tuo Shen

    2017-07-01

    Full Text Available How to analytically deal with the general entanglement dynamics of separate Jaynes–Cummings nodes with continuous-variable fields is still an open question, and few analytical approaches can be used to solve their general entanglement dynamics. Entanglement dynamics between two separate Jaynes–Cummings nodes are examined in this article. Both vacuum state and coherent state in the initial fields are considered through the numerical and analytical methods. The gap between two nonidentical qubit-field coupling strengths shifts the revival period and changes the revival amplitude of two-qubit entanglement. For vacuum-state fields, the maximal entanglement is fully revived after a gap-dependence period, within which the entanglement nonsmoothly decreases to zero and partly recovers without exhibiting sudden death phenomenon. For strong coherent-state fields, the two-qubit entanglement decays exponentially as the evolution time increases, exhibiting sudden death phenomenon, and the increasing gap accelerates the revival period and amplitude decay of the entanglement, where the numerical and analytical results have an excellent coincidence.

  2. Knowledge-cum-values Management belongs to the Way out from Global Crisis

    Directory of Open Access Journals (Sweden)

    Ženko Zdenka

    2017-03-01

    Full Text Available Background: The contemporary world-wide socio-economic crisis tends to escalate and contribute to the global crisis. Limitation of education to one-sided ‘knowledge management’ rather than socially responsible ‘knowledge-cum-values-management’ is one of the crisis’s causes. Objectives: The limitations to current knowledge management should be analyzed with systemic thinking. Which values are prevailing in it now and which values will enable the survival of humankind? Methods/Approach: In the first part, literature is reviewed for analysis and conceptual generalization of knowledge management. The theoretical framework based on ‘system theory’, ‘knowledge management’ and ‘knowledge-cum-values management’, and ‘values of social responsibility’ is introduced. In the second part a new theoretical concept “A potential methodological support for human transition from one-sided to requisitely holistic behavior via social responsibility” is discussed. Results: Knowledge management is a too narrow concept, it tends to leave aside human values, an impact on the natural environment, and extremely growing differences. Humankind needs consideration of responsibility, interdependence and holism in order to minimize detrimental impact of individual behaviour on society, i.e. humans and nature. Conclusions: The research indicates that individuals should attain more requisite holism, and should not be irrational by trying to attain only rationalism in human decision-making and action.

  3. Note: Compact, reusable inductive-storage-cum-opening-switch based 1.5 GW single-shot pulsed power generator

    Science.gov (United States)

    Shukla, Rohit; Shyam, Anurag

    2014-03-01

    The results of a very-compact (Marx generator-cum-inductor confined into 0.20 m cylindrical diameter and 0.75 m length) and light-weight (Marx generator used as primary energy source and opening switch of exploding wire) make device very attractive. Marx generator shape itself provides the desired inductance for the inductive storage.

  4. Competitive-cum-cooperative interfirm relations and dynamics in the Japanese semiconductor industry

    CERN Document Server

    Okada, Yoshitaka

    2000-01-01

    Japanese semiconductor firms are well known for obtaining dynamics in a short period of time and achieving even global leadership. A significant portion of their success are attributable to cooperative interfirm relations and the development of intermediate organizational structure based on long-term relationship between firms. The purpose of this book is to explain how interfirm relations contributed to their dynamics during the golden age of the semiconductor industry. Meanwhile this book clarifies the real source of dynamics in interfirm relations and how the firms have interacted. The author concludes that the competitive-cum-cooperative (CCC) interfirm interaction are observed. Quantitative and qualitative findings show that firms enjoy not only flexible cooperation based synergy effects, but also dynamics market-like effects by creating competition among partners through CCC interaction.

  5. Equivalent spin-orbit interaction in the two-polariton Jaynes-Cummings-Hubbard model.

    Science.gov (United States)

    Li, C; Zhang, X Z; Song, Z

    2015-07-10

    A cavity quantum electrodynamics (cavity-QED) system combines two or more distinct quantum components, exhibiting features not seen in the individual systems. In this work, we study the one-dimensional Jaynes-Cummings-Hubbard model in the two-excitation (two-polariton) subspace. We find that the centre momentum of two-excitation induces a magnetic flux piercing the equivalent Hamiltonian Hk in the invariant subspace with momentum k, which can be described as a 4-leg ladder in the auxiliary space. Furthermore, it is shown that the system in π-centre-momentum subspace is equivalent to a lattice system for spin-1 particle with spin-orbit coupling. On the basis of this concise description, a series of bound-pair eigenstates which display long-range polaritonic entanglement is presented as a simple application.

  6. Quantum Entanglement in Double Quantum Systems and Jaynes-Cummings Model.

    Science.gov (United States)

    Jakubczyk, Paweł; Majchrowski, Klaudiusz; Tralle, Igor

    2017-12-01

    In the paper, we proposed a new approach to producing the qubits in electron transport in low-dimensional structures such as double quantum wells or double quantum wires (DQW). The qubit could arise as a result of quantum entanglement of two specific states of electrons in DQW structure. These two specific states are the symmetric and antisymmetric (with respect to inversion symmetry) states arising due to tunneling across the structure, while entanglement could be produced and controlled by means of the source of nonclassical light. We examined the possibility to produce quantum entanglement in the framework of Jaynes-Cummings model and have shown that at least in principle, the entanglement can be achieved due to series of "revivals" and "collapses" in the population inversion due to the interaction of a quantized single-mode EM field with a two-level system.

  7. Biorthogonal quantum mechanics for non-Hermitian multimode and multiphoton Jaynes-Cummings models

    Science.gov (United States)

    Hounguevou, J. V.; Dossa, F. A.; Avossevou, G. Y. H.

    2017-10-01

    We develop a biorthogonal formalism for non-Hermitian multimode and multiphoton Jaynes-Cummings models. For these models, we define supersymmetric generators, which are especially convenient for diagonalizing the Hamiltonians. The Hamiltonian and its adjoint are expressed in terms of supersymmetric generators having the Lie superalgebra properties. The method consists in using a similarity dressing operator that maps onto spaces suitable for diagonalizing Hamiltonians even in an infinite-dimensional Hilbert space. We then successfully solve the eigenproblems related to the Hamiltonian and its adjoint. For each model, the eigenvalues are real, while the eigenstates do not form a set of orthogonal vectors. We then introduce the biorthogonality formalism to construct a consistent theory.

  8. Management of open olecranon fractures using clamp-cum-compressor device

    Directory of Open Access Journals (Sweden)

    Kundu Zile

    2009-01-01

    Full Text Available Background: Open fractures of olecranon are not a rare occurrence in patients with road traffic accidents particularly motor bike riders who don′t use elbow guards. Definitive treatment has to be delayed in many till the wound heals. The present study was conducted to evaluate the results of open fractures of olecranon using clamp-cum-compressor device. Materials and Methods: Seventeen patients between the ages of 20 and 45 years of open olecranon fractures reported 5-20 days after injury were treated using an indigenous clamp-cum-compressor. All fractures were Mayo type II-A, i.e., displaced, stable and noncomminuted. Four patients had Gustilo-Anderson grade I and 13 had Gustilo-Anderson grade II open fractures. The patients with transverse or short oblique fractures were included in the study. The apparatus was applied under regional anesthesia after thorough washing and debridement of wounds with few loose sutures applied wherever needed. The wounds healed within 2-4 weeks and fractures united within 8-10 weeks. The elbow was mobilized with apparatus still in place. The results were evaluated by MayoElbow performance score. Results: We achieved excellent results in twelve patients, good in four and poor in one patient, who reported late, hooks of the apparatus were cut through the proximal fragment, leading to union of fracture in elongation and restricted elbow movements. Conclusion: The apparatus was found to be quite useful in transverse and short oblique fractures with contamination or infection, where internal fixation has to be delayed or avoided.

  9. Seminar Cum Meeting Report: Codata Task Group for Exchangeable Material Data Representation to Support Research and Education

    Directory of Open Access Journals (Sweden)

    T Ashino

    2008-11-01

    Full Text Available On March 4-5, 2008, the CODATA Task Group for Exchangeable Material Data Representation to Support Research and Education held a two day seminar cum meeting at the National Physical Laboratory (NPL, New Delhi, India, with NPL materials researchers and task group members representing material activities and databases from seven countries: European Union (The Czech Republic, France, and the Netherlands, India, Korea, Japan, and the United States. The NPL seminar included presentations about the researchers' work. The Task Group meeting included presentations about current data related activities of the members. Joint discussions between NPL researchers and CODATA task group members began an exchange of viewpoints among materials data producers, users, and databases developers. The seminar cum meeting included plans to continue and expand Task Group activities at the 2008 CODATA 21st Meeting in Kyiv, Ukraine.

  10. Mixed Rabi Jaynes-Cummings model of a three-level atom interacting with two quantized fields

    Science.gov (United States)

    Torosov, Boyan T.; Longhi, Stefano; Della Valle, Giuseppe

    2015-07-01

    The quantum Rabi model describes the ultrastrong interaction of a two-level atom coupled to a single quantized bosonic mode. As compared to the Jaynes-Cummings model, in the Rabi model the absorption and emission processes do not need to satisfy energy conservation and the usual rotating wave approximation (RWA) breaks down. As a result, the atom-field dynamics in the Hilbert space splits into two independent parity chains, exhibiting a collapse-revival pattern and exact periodic dynamics in the limit of degenerate atomic levels. Here we introduce a mixed Rabi Jaynes-Cummings model by considering a three-level atom interacting with two quantized bosonic fields, in which the RWA is made for one transition (with a weak atom-field coupling) but not for the other one (with an ultrastrong atom-field coupling). As a result, we show that the field in the weak coupled atomic transition can be used as a tool to control the atom-field dynamics of the other (strong coupled) transition, thus realizing an effective two-level quantum Rabi model with a controllable field. In particular, a periodic temporal dynamics of the atom-field state can be realized by appropriate tuning of the weak control field, even for non-degenerate atomic levels. A photonic simulator of the mixed Rabi Jaynes-Cummings model, based on light transport in evanescently coupled optical waveguide lattices, is also briefly discussed.

  11. Quantum Phase Transition in the Finite Jaynes-Cummings Lattice Systems

    Science.gov (United States)

    Hwang, Myung-Joong; Plenio, Martin B.

    2016-09-01

    Phase transitions are commonly held to occur only in the thermodynamical limit of a large number of system components. Here, we exemplify at the hand of the exactly solvable Jaynes-Cummings (JC) model and its generalization to finite JC lattices that finite component systems of coupled spins and bosons may exhibit quantum phase transitions (QPTs). For the JC model we find a continuous symmetry-breaking QPT, a photonic condensate with a macroscopic occupation as the ground state, and a Goldstone mode as a low-energy excitation. For the two site JC lattice we show analytically that it undergoes a Mott-insulator to superfluid QPT. We identify as the underlying principle of the emergence of finite system QPTs the combination of increasing atomic energy and increasing interaction strength between the atom and the bosonic mode, which allows for the exploration of an increasingly large portion of the infinite dimensional Hilbert space of the bosonic mode. This suggests that finite system phase transitions will be present in a broad range of physical systems.

  12. Theoria cum Praxi? The (In- Compatibility of Demands in Science and Business World

    Directory of Open Access Journals (Sweden)

    Monika Kritzmöller

    2004-05-01

    Full Text Available The necessity for co-operation between (scientific theory and (management praxis is apparent more than ever. There are countless parallels in the goals and objectives of social and marketing research, for example, learning more about communities—respectively customers—and explaining their behavior. Extending social research services to businesses can create synergistic effects. On the one hand, the scientists can benefit financially in dimensions not feasible at universities and have a fruitful dialogue with business practitioners. On the other hand, the business management have access to the latest scientific results of high quality before these results are available to competitors as official publications. These opportunities and advantages can no longer permit a prejudice-based, mutual ideological rejection, which can still be found in both spheres. In the course of my "Habilitation" at the University of St. Gallen (Switzerland, I created a successful method for combining theory with practice. I developed a sociological theory of social structure, which can be put into practice in order to analyze and comprehend the behavior of target groups in marketing. I co-operated with selected furniture manufacturers and received advanced payments during the entire period of my research. In return, these manufacturers received my consulting services. I applied the research findings directly to their business demands after the end of my project. On the one hand, this procedure requires that a scientist is experienced in business affairs and has the ability and readiness for transferring scientific results into every-day practice. On the other hand, management needs to give up short-term thinking of "KISS" (keep it short and simple and care about understanding things instead of merely describing them. My co-operation in the project and the implementation of "theoria cum praxi" approach was a positive experience, which I will continue using in future

  13. "Sentire cum Ecclesia" –Archbishop Oscar Romero in a crossfire of dissent

    Directory of Open Access Journals (Sweden)

    Andrzej Dobrzyński

    2006-12-01

    Full Text Available The article Sentire cum Ecclesia Archbishop Romero caught between the fires of division: presents a clear picture of the difficult situation the Archbishop was involved in while ministering the war torn politically explosive Archdiocese of San Salvador (1977-1998 and the importance of maintaining his relationship with Rome. He lived his life between two burning fires: the cold war and the revolution, right and left wing factions, the unity of the Church and Liberation theology, and at the same time bearing within the strain of the dichotomy between the tendency for the mystic and his prophetic gift. The Archbishop was committed to put into practice the teaching of Vatican II, the social doctrine of the Church, and to the documents written by the Latin American Bishops in the conferences of Medellin (1968 and Puebla (1979. Paying attention to the circumstances of the Archdiocese and to the needs of Salvadorian society as a whole, Romero searched for solutions, taking into account his conscience and the Magisterium of the Church, while living a deeply spiritual life. His Episcopal motto, “To be of one mind with the Church” signifies his dedication and compassion with the suffering poor and disenfranchised, and the Church as an institution. Proof of this stems from always referring his feelings back to Rome and his dedication to the poor and persecuted. Even though it is not easy to draw any conclusions or make any judgments regarding Oscar Romero’s mission of the Church in the midst of the countries crisis, the article underlines the Historical-Ecclesiastical perspective that allows the avoidance of myths that continue to exist, in both liberal and conservative Catholic surroundings.

  14. Standardization of the manufacturing procedure for Pinelliae Rhizoma Praeparatum cum Zingibere et Alumine.

    Science.gov (United States)

    Su, Tao; Zhang, Wei-Wei; Zhang, Ya-Ming; Cheng, Brian Chi-Yan; Fu, Xiu-Qiong; Li, Ting; Guo, Hui; Li, Ya-Xi; Zhu, Pei-Li; Cao, Hui; Yu, Zhi-Ling

    2016-12-04

    Pinelliae Rhizoma (PR), the dried tuber of Pinellia ternata (Thunb.) Breit., is a traditional Chinese medicinal herb. It is commonly used for treating cancer, cough and phlegm. To treat cancer, Chinese medicine practitioners often use raw PR; while to treat cough and phlegm, they usually use Pinelliae Rhizoma Praeparatum cum Zingibere et Alumine (PRZA, raw PR processed with ginger juice and alumen as adjuvant materials). Currently, the producing protocol of PRZA varies greatly among different places in China. This study aims to standardize the manufacturing procedure for PRZA. We also evaluated the impact of processing on the bioactivities and chemical profile of raw PR. We used the orthogonal design to optimize the manufacturing procedure of PRZA at bench scale, and validated the optimized procedure in pilot-scale production. The MTT assay was used to compare the cytotoxicities of raw PR and PRZA in hepatocellular carcinoma HepG2 cells. Animal models (ammonia liquor-induced cough model and phenol red secretion model) were used to compare the antitussive and expectorant effects of raw PR and PRZA, respectively. The chemical profiles of raw PR and PRZA samples were compared using a newly developed ultra-performance liquid chromatography/quadrupole-time-of-flight mass spectrometry (UPLC/Q-TOF-MS) method. The standardized manufacturing procedure for PRZA is as follows: soak raw PR in water until the center of the cut surface is devoid of a dry core, after that, boil the herb in water (for each 100kg raw PR, 12.5kg alumen and 25L freshly squeezed ginger juice are added) for 6h, and then take out and dry them. The cytotoxicity of PRZA was less potent than that of raw PR. Intragastric administration of raw PR or PRZA demonstrated antitussive and expectorant effects in mice. These effects of PRZA were more potent than that of raw PR at the dose of 3g/kg. By comparing the chemical profiles, we found that six peaks were lower, while nine other peaks were higher in PRZA than

  15. Theoretical investigation of the structural, electronic, magnetic and spectral properties of CumXn (X = Se, Te; m + n = 5) clusters

    Science.gov (United States)

    Guo, Jia-Xing; Wu, Shao-Yi; Peng, Li; Wu, Li-Na; Chen, Xiao-Hong

    2017-11-01

    Based on the density functional theory (DFT), the geometric structures, relative stability as well as electronic, magnetic and spectral properties of CumXn (X = Se, Te; m + n = 5) clusters are systematically investigated with Gaussian 09. The ground state structures of CumXn clusters are found to be largely similar for X = Se and Te with minor differences. Characterized by energy gap, the stability of the CumXn clusters increases with increasing the number of Cu-X bonds and reaches the maximum for Cu2Se3 or Cu3Te2 (with the ratio m/n closest to unity). The electronic properties of CumXn clusters are related to the geometrical structures and the value of m. Particularly, Cu3Te2 cluster is found to exhibit superalkali nature with very low vertical electron affinity of 0.94 eV. The magnitudes of local magnetic moments are more than 99.99% and less than 0.01% for X and Cu atoms, respectively. The equivalent Cu or X atoms with respect to the symmetrical axis of the CumXn clusters demonstrate the same local magnetic moments due to the symmetry of the electron angular momentum related to the symmetrical axis. The IR and Raman spectra of CumXn clusters exhibit similarity for X = Se and Te. The intense UV absorption peaks at 200-250 nm for Cu4X and Cu3×2 clusters may reveal that they can act as potential UV absorption materials.

  16. Effects of cavity–cavity interaction on the entanglement dynamics of a generalized double Jaynes–Cummings model

    Science.gov (United States)

    Pandit, Mahasweta; Das, Sreetama; Singha Roy, Sudipto; Shekhar Dhar, Himadri; Sen, Ujjwal

    2018-02-01

    We consider a generalized double Jaynes–Cummings model consisting of two isolated two-level atoms, each contained in a lossless cavity that interact with each other through a controlled photon-hopping mechanism. We analytically show that at low values of such a mediated cavity–cavity interaction, the temporal evolution of entanglement between the atoms, under the effects of cavity perturbation, exhibits the well-known phenomenon of entanglement sudden death (ESD). Interestingly, for moderately large interaction values, a complete preclusion of ESD is achieved, irrespective of its value in the initial atomic state. Our results provide a model to sustain entanglement between two atomic qubits, under the adverse effect of cavity induced perturbation, by introducing a non-intrusive inter-cavity photon exchange that can be physically realized through cavity-QED setups in contemporary experiments.

  17. Dynamics of single photon transport in a one-dimensional waveguide two-point coupled with a Jaynes-Cummings system

    KAUST Repository

    Wang, Yuwen

    2016-09-22

    We study the dynamics of an ultrafast single photon pulse in a one-dimensional waveguide two-point coupled with a Jaynes-Cummings system. We find that for any single photon input the transmissivity depends periodically on the separation between the two coupling points. For a pulse containing many plane wave components it is almost impossible to suppress transmission, especially when the width of the pulse is less than 20 times the period. In contrast to plane wave input, the waveform of the pulse can be modified by controlling the coupling between the waveguide and Jaynes-Cummings system. Tailoring of the waveform is important for single photon manipulation in quantum informatics. © The Author(s) 2016.

  18. A simple LC-MS/MS method for quantitative analysis of underivatized neurotransmitters in rats urine: assay development, validation and application in the CUMS rat model.

    Science.gov (United States)

    Zhai, Xue-jia; Chen, Fen; Zhu, Chao-ran; Lu, Yong-ning

    2015-11-01

    Many amino acid neurotransmitters in urine are associated with chronic stress as well as major depressive disorders. To better understand depression, an analytical LC-MS/MS method for the simultaneous determination of 11 underivatized neurotransmitters (4-aminohippurate, 5-HIAA, glutamate, glutamine, hippurate, pimelate, proline, tryptophan, tyramine, tyrosine and valine) in a single analytical run was developed. The advantage of this method is the simple preparation in that there is no need to deconjugate the urine samples. The quantification range was 25-12,800 ng mL(-1) with >85.8% recovery for all analytes. The nocturnal urine concentrations of the 11 neurotransmitters in chronic unpredictable mild stress (CUMS) model rats and control group (n = 12) were analyzed. A series of significant changes in urinary excretion of neurotransmitters could be detected: the urinary glutamate, glutamine, hippurate and tyramine concentrations were significantly lower in the CUMS group. In addition, the urinary concentrations of tryptophan as well as tyrosine were significantly higher in chronically stressed rats. This method allows the assessment of the neurotransmitters associated with CUMS in rat urine in a single analytical run, making it suitable for implementation as a routine technique in depression research. Copyright © 2015 John Wiley & Sons, Ltd.

  19. What can we learn from the dynamics of entanglement and quantum discord in the Tavis-Cummings model?

    Science.gov (United States)

    Restrepo, Juliana; Rodriguez, Boris A.

    We revisit the problem of the dynamics of quantum correlations in the exact Tavis-Cummings model. We show that many of the dynamical features of quantum discord attributed to dissipation are already present in the exact framework and are due to the well known non-linearities in the model and to the choice of initial conditions. Through a comprehensive analysis, supported by explicit analytical calculations, we find that the dynamics of entanglement and quantum discord are far from being trivial or intuitive. In this context, we find states that are indistinguishable from the point of view of entanglement and distinguishable from the point of view of quantum discord, states where the two quantifiers give opposite information and states where they give roughly the same information about correlations at a certain time. Depending on the initial conditions, this model exhibits a fascinating range of phenomena that can be used for experimental purposes such as: Robust states against change of manifold or dissipation, tunable entanglement states and states with a counterintuitive sudden birth as the number of photons increase. We furthermore propose an experiment called quantum discord gates where discord is zero or non-zero depending on the number of photons. This work was supported by the Vicerrectoria de Investigacion of the Universidad Antonio Narino, Colombia under Project Number 20141031 and by the Departamento Administrativo de Ciencia, Tecnologia e Innovacion (COLCIENCIAS) of Colombia under Grant Number.

  20. Tensioned metastable fluids and nanoscale interactions with external stimuli-Theoretical-cum-experimental assessments and nuclear engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Taleyarkhan, Rusi [Purdue University, W. Lafayette, IN 47907-1290 (United States)], E-mail: rusi@purdue.edu; Lapinskas, J.; Xu, Y. [Purdue University, W. Lafayette, IN 47907-1290 (United States)

    2008-07-15

    The field of tensioned (sub-zero pressure) metastability of organic and inorganic fluids and their responses to external stimuli is under study at Purdue University. Unique properties related to energy storage and sub-nano scale response to external stimuli have been found that give rise to the capability for causing localized supercritical states leading to fluid boiling by visible light photons and other fundamental particles over eight orders of magnitude in the energy range (i.e., from the sub -eV to MeV range). A theoretical model is developed for predicting limits of tension metastability and validated against experimental data. Resonant acoustics and centrifugal force-based systems are described for attaining as-desired tension metastable states along with triggering mechanisms for nano-to-macroscale energy storage-cum-release. Finite-element modeling and simulation framework for design of such systems with experimental benchmarking are described. Technological impacts on diverse fields such as nuclear material detection, physics-based spectroscopy, monitoring of power levels in nuclear systems, general cavitation physics of fluids, acoustically driven thermonuclear fusion, and super compression states attainment are discussed.

  1. Extraction Optimization, Characterization, and Bioactivities of Polysaccharides from Pinelliae Rhizoma Praeparatum Cum Alumine Employing Ultrasound-Assisted Extraction.

    Science.gov (United States)

    Liu, Yu-Jie; Mo, Xue-Lin; Tang, Xiao-Zhang; Li, Jiang-Hua; Hu, Mei-Bian; Yan, Dan; Peng, Wei; Wu, Chun-Jie

    2017-06-09

    In this study, the ultrasound-assisted extraction of polysaccharides (PSA) from Pinelliae Rhizoma Praeparatum Cum Alumine (PRPCA) was optimized by response surface methodology (RSM). The structural characteristics of PSA were analyzed by UV-vis spectroscopy, infrared spectroscopy, scanning electron microscopy, high performance gel permeation chromatography and high performance liquid chromatography, respectively. In addition, antioxidant and antimicrobial activities of PSA were studied by different in vitro assays. Results indicated that the optimal extraction conditions were as follows: the ratio of water to raw of 30 mL/g, extraction time of 46.50 min, ultrasonic temperature of 72.00 °C, and ultrasonic power of 230 W. Under these conditions, the obtained PSA yield (13.21 ± 0.37%) was closely agreed with the predicted yield by the model. The average molecular weights of the PSA were estimated to be 5.34 × 10³ and 6.27 × 10⁵ Da. Monosaccharide composition analysis indicated that PSA consisted of mannose, galactose uronic acid, glucose, galactose, arabinose with a molar ratio of 1.83:0.55:75.75:1.94:0.45. Furthermore, PSA exhibited moderate antioxidant and antibacterial activities in vitro. Collectively, this study provides a promising strategy to obtain bioactive polysaccharides from processed products of herbal medicines.

  2. Extraction Optimization, Characterization, and Bioactivities of Polysaccharides from Pinelliae Rhizoma Praeparatum Cum Alumine Employing Ultrasound-Assisted Extraction

    Directory of Open Access Journals (Sweden)

    Yu-Jie Liu

    2017-06-01

    Full Text Available In this study, the ultrasound-assisted extraction of polysaccharides (PSA from Pinelliae Rhizoma Praeparatum Cum Alumine (PRPCA was optimized by response surface methodology (RSM. The structural characteristics of PSA were analyzed by UV-vis spectroscopy, infrared spectroscopy, scanning electron microscopy, high performance gel permeation chromatography and high performance liquid chromatography, respectively. In addition, antioxidant and antimicrobial activities of PSA were studied by different in vitro assays. Results indicated that the optimal extraction conditions were as follows: the ratio of water to raw of 30 mL/g, extraction time of 46.50 min, ultrasonic temperature of 72.00 °C, and ultrasonic power of 230 W. Under these conditions, the obtained PSA yield (13.21 ± 0.37% was closely agreed with the predicted yield by the model. The average molecular weights of the PSA were estimated to be 5.34 × 103 and 6.27 × 105 Da. Monosaccharide composition analysis indicated that PSA consisted of mannose, galactose uronic acid, glucose, galactose, arabinose with a molar ratio of 1.83:0.55:75.75:1.94:0.45. Furthermore, PSA exhibited moderate antioxidant and antibacterial activities in vitro. Collectively, this study provides a promising strategy to obtain bioactive polysaccharides from processed products of herbal medicines.

  3. Tripodal bis(imidazole) thioether copper(I) complexes: mimics of the Cu(M) site of copper hydroxylase enzymes.

    Science.gov (United States)

    Zhou, Lei; Powell, Douglas; Nicholas, Kenneth M

    2007-09-17

    Tripodal bis(imidazole) thioether ligands, (N-methyl-4,5-diphenyl-2-imidazolyl)2C(OR)C(CH3)2SR' (BIT(OR,SR'); R = H, CH3; R' = CH3, C(CH3)3, C(C6H5)3), have been prepared, offering the same N2S donor atom set as the CuM binding site of the hydroxylase enzymes, dopamine beta hydroxylase and peptidylglycine hydroxylating monooxygenase. Isolable copper(I) complexes of the type [(BIT(OR,SMe))Cu(CO)]PF6 (3a and 3b) are produced in reactions of the respective tripodal ligands 1a (R = H) and 1b (R = Me) with [Cu(CH3CN)4]PF6 in CH2Cl2 under CO (1 atm); the pyramidal structure of 3a has been determined crystallographically. The infrared (IR) nu(CO)'s of 3a and 3b (L = CO) are comparable to those of the Cu(M)-carbonylated enzymes, indicating similar electronic character at the copper centers. The reaction of [(BIT(OH,SMe))Cu(CH3CN)]PF6 (2a) with dioxygen produces [(BIT(O,SOMe))2Cu2(DMF)2](PF6)2 (4), whose X-ray structure revealed the presence of bridging BIT-alkoxo ligands and terminal -SOMe groups. In contrast, oxygenation of 2b (R = Me) affords crystallographically defined [(BIT(OMe,SMe))2Cu2(mu-OH)2](OTf)2 (5), in which the copper centers are oxygenated without accompanying sulfur oxidation. Complex 5 in DMF is transformed into five-coordinate, mononuclear [CuII(BIT(OMe,SMe))(DMF)2](PF6)2 (6). The sterically hindered BIT(OR,SR') ligands 9 and 10 (R' = t-Bu; R = H, Me) and 11 and 12 (R' = CPh3; R = H, Me) were also prepared and examined for copper coordination/oxygenation. Oxygenation of copper(I) complex 13b derived from the BIT(OMe,SBu-t) ligand is slow, relative to 2b, producing a mixture of (BIT(OMe,SBu-t))2Cu2(mu-OH)2-type complexes 14b and 15b in which the -SBu-t group is uncoordinated; one of these complexes (15b) has been ortho-oxygenated on a neighboring aryl group according to the X-ray analysis and characterization of the free ligand. Oxygenation of the copper(I) complex derived from BIT(OMe,SCPh3) ligand 12 produces a novel dinuclear disulfide complex, [(BIT

  4. 'Mr Cummings clearly does not understand the science of genetics and should maybe go back to school on the subject': an exploratory content analysis of the online comments beneath a controversial news story.

    Science.gov (United States)

    Crosswaite, Madeline; Asbury, Kathryn

    2016-12-01

    An article published in the UK Guardian on 11/10/2013 with the headline 'Genetics outweighs teaching, Gove advisor tells his boss' reported a leaked document written by special advisor Dominic Cummings to the then UK Secretary of State for Education, Michael Gove. The article generated 3008 on-line reader comments from the public. These reader comments offer a naturalistic opportunity to understand public opinion regarding Cummings' controversial suggestions and ideas. We conducted a content analysis of n = 800 reader comments, coding them on the basis of level of agreement with the ideas and opinions expressed in the article. Of all aspects of education mentioned, Cummings' reported views on genetics were commented upon most frequently and were subject to the most opposition from commenters, but also the most support. Findings offer some insight into the challenges involved in conducting public discourse about the relevance of genes in education. We discuss the accuracy with which Cummings' views were presented and the effect this may have had on reader responses to the points being raised.

  5. The Blood-Brain Barrier Permeability of Six Indole Alkaloids from Uncariae Ramulus Cum Uncis in the MDCK-pHaMDR Cell Monolayer Model

    Directory of Open Access Journals (Sweden)

    Yi-Nan Zhang

    2017-11-01

    Full Text Available Uncariae Ramulus Cum Uncis (URCU is a widely used traditional Chinese medicine, and is reported to have various central nervous system effects. Alkaloids have been demonstrated to be the predominant pharmacological active components of URCU. In order to evaluate the blood-brain barrier (BBB permeability and transport mechanism of six typical indole alkaloids from URCU, the MDCK-pHaMDR cell monolayer model was used as an in vitro surrogate model for BBB. The samples were analyzed by high-performance liquid chromatography, and the apparent permeability coefficients (Papp were calculated. Among the six alkaloids, isorhynchophylline (2, isocorynoxeine (4, hirsutine (5 and hirsuteine (6 showed high permeability, with Papp values at 10−5 cm/s level in bidirectional transport. For rhynchophylline (1 and corynoxeine (3, they showed moderate permeability, with Papp values from the apical (AP side to the basolateral (BL side at 10−6 cm/s level and efflux ratio (Papp BL→AP/Papp AP→BL above 2. The time- and concentration-dependency experiments indicated that the main mechanism for 2, 4, 5 and 6 through BBB was passive diffusion. The efflux mechanism involved in the transports of compounds 1 and 3 could be reduced significantly by verapamil, and molecular docking screening also showed that 1 and 3 had strong bindings to P-glycoprotein. This study provides useful information for predicting the BBB permeability for 1–6, as well as better understanding of their central nervous system pharmacological activities.

  6. Improvement of Asthma and Gastroesophageal Reflux Disease With Oral Pulvis stomachicus cum Belladonna, a Combination of Matricaria recutita, Atropa belladonna, Bismuth, and Antimonite: A Pediatric Case Report.

    Science.gov (United States)

    von Schoen-Angerer, Tido; Madeleyn, René; Kiene, Helmut; Kienle, Gunver S; Vagedes, Jan

    2016-01-01

    The association between gastroesophageal reflux disease (GERD) and asthma, although well established in adults, is less strong in the pediatric age group. Benefits of proton pump therapy are limited across age ranges. While there is a growing body of literature on the use of complementary treatments for both asthma and GERD, few studies have focused on treatment benefits for the GERD-asthma association. We present the case of a 2-year-old boy with asthma and GERD who was not responding to inhaled, low-dose corticosteroids, beta-mimetic therapy, and a 6-week course of proton pump inhibitor treatment. We noted a gradual disappearance of symptoms when he was given an oral preparation of Pulvis stomachicus cum Belladonna, an anthroposophic medication containing Matricaria recutita, Atropa belladonna, bismuth, and antimonite. Matricaria recutita and bismuth have known gastric protective properties, and Atropa belladonna contains anticholinergic agents that have a bronchodilatory effect. These complementary medications appear promising in terms of relieving the symptoms of GERD-associated asthma.

  7. Desigualdades de género en la medicación: un tortuoso recorrido por el Vademécum

    Directory of Open Access Journals (Sweden)

    Lourdes Pérez González

    2010-12-01

    Full Text Available Análisis de las diferencias de género en la medicalización —entendida como la apropiación de parcelas de la vida cotidiana por el ámbito médico/farmacéutico— y sus repercusiones en la vida y la salud de las mujeres. Este análisis utiliza como referencia fundamental el Vademécum, base de datos que nos ha permitido la búsqueda de los fármacos (centrándonos en los efectos adversos y las interacciones que se expiden sin receta y están destinados fundamentalmente, o únicamente, a las mujeres ―sanas Analysis of gender differences in medicalization - understood as the appropriation of daily life areas by the medical/pharmaceutical field - and their impact on women’s health and lives. This study relies on the Vademecum as the main reference, database that has allowed us the search of drugs (focusing on the adverse effects and the interactions that are given without a prescription and are basically, or only, addressed to ―healthy‖ women.

  8. Reply to "Comment on `Thermal-light-induced dynamics: Coherence and revivals in V -type and molecular Jaynes-Cummings systems' "

    Science.gov (United States)

    Avisar, David; Wilson-Gordon, A. D.

    2017-06-01

    We recently presented an extended Jaynes-Cummings model for the interaction of a realistic molecular system of two Born-Oppenheimer potential energy surfaces and a quantized electromagnetic field [Avisar and Wilson-Gordon, Phys. Rev. A 93, 033843 (2016), 10.1103/PhysRevA.93.033843]. We studied the interaction of this molecular model, and also a prototype V -type system, with single-mode and multimode thermal states of the field, characterized by low and high average photon number n ¯. Among our results, we showed that the three-mode thermal state of the field induces excited-state material coherence and that a thermal state of high n ¯ can induce "coherentlike" collapse and revival patterns. The preceding Comment by Dodin and Brumer [Phys. Rev. A 95, 067801 (2017), 10.1103/PhysRevA.95.067801] criticizes our work for allegedly drawing conclusions regarding sunlight-induced dynamics from our results, and for unjustified citation of previous work. However, we think the Comment fails to represent the contents of our paper, and we therefore reply to it. We show it is based on misinterpretation of our paper.

  9. Fatty Acid Composition Of Two Nigerian Masticatories Cum Traditional Snacks African Walnut Plukenetia Conophora Kernel And African Elemi Canarium Schweinfurthii Pulp.

    Directory of Open Access Journals (Sweden)

    Anyalogbu Ernest A. A.

    2017-07-01

    Full Text Available Fatty acid composition of plant food oil is important for its economic and nutritional value. Assessment of fatty acid contents of two Nigerian masticatories cum traditional snacks African walnut kernel AW and African elemi pulp AE were carried out. Samples were subjected to graded wet heat contact time based on their traditional methods of processing and their oil extract evaluated for fatty acid FA contents using chromatographic method. The processing methods had no statistically significant effect on both the oil and FA contents of the samples. Both samples contain nutritionally relevant levels of fat ranging respectively from 49.81.08 to 52.82.70g100g sample and 41.936.03 to 42.84.61g100g sample in AW and AE. A total of six fatty acids including two essential ones namely omega-6 C182 and omega-3 C183 were identified and quantified in the two plant foods. The predominant FAs in the plant foods were oleic acid 16.121.86 - 17.111.31g100g fat linoleic acid 16.881.66 - 18.801.52g100g fat and linolenic acid 55.955.68 - 57.086.57g100g fat in AW and palmitic acid 48.594.35 - 50.513.29g100g fat oleic acid 32.023.27 - 35.741.46g100g fat and linoleic acid 15.153.57 - 15.403.82g100g fat in AE. The study shows that on the average one serving of AW could supply about 41.52 and 647.09 of the Recommended Daily Intakes RDIs for the essential FAs Linoleic and Linolenic acids respectively while that of AE will supply about 29.13 of the RDI for Lineleic acid. Based on their essential FAs contents the plant foods apparently have potentials for applications as nutraceuticals.

  10. Solubility and solubilizing capabilities of aqueous solutions of Extractum Taraxaci e radix cum herba aqu. siccum in light of selected values of general Hildebrand-Scatchard-Fedors theory of solubility

    Directory of Open Access Journals (Sweden)

    Marczyński Zbigniew

    2016-12-01

    Full Text Available Introduction: The general Hildebrand-Scatchard theory of solubility supplemented by Fedors’ solubility parameter −δ12$- \\delta ^{{1 \\over 2}} $ was used to estimate the real solubility by −log x2 (log of the mole fraction of phytochemicals contained in Ext. Taraxaci e radix cum herba aqu. siccum. Surface activity of aqueous solution of extracts was determined and quantified – solubilizing capabilities of solutions of cexp. ≥cmc in relation to cholesterol particle size of Ø=1.00 mm, as well as of ketoprofen were defined.

  11. Cum on Feel the Noiz

    Directory of Open Access Journals (Sweden)

    Jamie Allen

    2012-04-01

    Full Text Available A brief review of Joseph Nechvatal's Immersion Into Noise available from Open Humanities Press. We include here a series of videos created using C++ and sounds. For more than twenty years Nechvatal has created art works at the intersections of robotics, noise, and video.

  12. SOCIO CUM LINGUISTIC INTERPLAY IN LANGUAGE CHOICE ...

    African Journals Online (AJOL)

    Sir George

    2016-06-02

    Jun 2, 2016 ... and of course his linguistic ability. Therefore, Winkler (2007:211) asserts: “Most of the world‟s people live in bi- and multilin- gual communities, a result of which is that many peo- ple have communicative competence in at least two languages. Sometimes in these communities, the two languages co-exist.

  13. Economic differential of integrated fish, rice cum piggery and fish ...

    African Journals Online (AJOL)

    The results obtained from the study, clearly indicate that the two integrated synergies have the potential to help solve the problems of hunger and poverty in Sierra Leone, especially among the rural poor that constituted more than 70% of the population. Key words: Cost-benefit, Integrated aquaculture, Water quality, Sierra ...

  14. 31 PLEA BARGAINING AND THE RELIGIOUS CUM SOCIO ...

    African Journals Online (AJOL)

    HP

    2016-07-09

    Jul 9, 2016 ... N32.8 billion Police Pension Fund He was sentenced to only two years' imprisonment with an option of fine of N750,000.00, which of course, he promptly paid, an option not extended to every criminal. There is no gainsaying the fact that the country finds itself in this sorry state as a result of the way people.

  15. Socio cum linguistic interplay in language choice and performance ...

    African Journals Online (AJOL)

    The data for the study were randomly collected from people, including students, artisans, businessmen, traders and other civil populace in the city. The result of the study indicates that the language that most people speak and the extent of their performance is a consequence of two variables: the linguistic knowledge of the ...

  16. Is "In Consortio Cum Parentibus" the New "In Loco Parentis?"

    Science.gov (United States)

    Henning, Gavin

    2007-01-01

    "In loco parentis" had been the philosophical foundation of higher education policy and practice since 1913 when it was established as a legal doctrine in Gott v. Berea. The doctrine defined the relationship between colleges, students, and parents. That relationship has changed with the death of "in loco parentis" in Dixon v. Alabama Board of…

  17. Solutions of two-mode Jaynes–Cummings models

    Indian Academy of Sciences (India)

    Graphical features of the time dependence of the population inversion have been analysed when one of the field modes is prepared initially in a coherent state while the other one in a vacuum state. The paper aims to show that a straightforward method, that of unitary transfor- mation in quantum mechanics by Sudha Singh ...

  18. Modul cum reflectă clasificarea bibliografică societatea - cazul sistemului suedez SAB

    Directory of Open Access Journals (Sweden)

    Joacim Hansson

    2006-01-01

    Full Text Available Articolul prezintă un studiu al sistemului de clasificare suedez, sistemul SAB, şi a capacităţii sale de a ilustra anumite structuri sociale şi ideologice în societatea suedeză la începutul secolului al XX-lea. Metodologia se bazează pe hermeneutica critică şi analiza ideologică. Rezultatele arată că sistemul de clasificare prezintă corespondenţe semnificative între structura ierarhiilor sale disciplinare şi idealuri din societatea înconjurătoare.

  19. Cum latranti/fraganti nomine: a possible reading of Plautus Casina 31-34

    Directory of Open Access Journals (Sweden)

    Analía Sapere

    2008-06-01

    Full Text Available The title of the comedy transmitted as Casina has been discussed by the main Plautine critics, especially because of the enigmatic verses 31-34, which offer an alternative translation of the original Greek title (Sortientes and, moreover, describe as “barking” (latranti a name that, from its etymology, recalls a spice and seems to have no connection with dogs. Our paper aims to contribute to the discussion, holding the view that the name Casina may be explained as an anagram of the words casia and canis, which remit to the semantic fields of scents and animals, and are related all over the comedy with two female characters: the elusive and ideal Casina, and the too concrete and real Cleostrata. Assuming the authenticity of the transmitted title, we suggest reading this passage of the prologue as a clue of the central subject of the comedy: the substitution of the matrona for the pleasing lover, with the resulting mockery and punishment of the senex.

  20. Flexible bacterial cellulose / permalloy nanocomposite xerogel sheets - Size scalable magnetic actuator-cum-electrical conductor

    Science.gov (United States)

    Thiruvengadam, V.; Vitta, Satish

    2017-03-01

    Permalloy nanoparticles containing bacterial cellulose hydrogel obtained after reduction was compressed into a xerogel flexible sheet by hot pressing at 60 ° C at different pressures. The permalloy nanoparticles with an ordered structure have a bimodal size distribution centered around 25 nm and 190 nm. The smaller nanoparticles are superparamagnetic while the larger particles are ferromagnetic at room temperature. The sheets have a room temperature magnetisation of 20 emug-1 and a coercivity of 32 Oe. The electrical conductivity of the flexible sheets increases with hot pressing pressure from 7 Scm-1 to 40 Scm-1 at room temperature.

  1. Oo sulnis spontaanne : [luuletused] / E. E. Cummings ; tõlk. Jüri Talvet, Andres Ehin

    Index Scriptorium Estoniae

    Cummings, E. E.

    2008-01-01

    Sisu: Oo sulnis spontaanne ; Buffalo Bill ; Luuletus, ehk ilu riivab hr. Vinali ; "Just..." ; "Inimkond ma armastan sind..." ; Mu tüdruk on kõrget kasvu ; Armastus on tahedam tükk kui uni ; Sinu südant kannan kaasas. Elu- ja loomeloolisi andmeid autori kohta lk. 506-507

  2. A classical simulation of nonlinear Jaynes-Cummings and Rabi models in photonic lattices: comment.

    Science.gov (United States)

    Lo, C F

    2014-01-27

    Recently Rodriguez-Lara et al. [Opt. Express 21(10), 12888 (2013)] proposed a classical simulation of the dynamics of the nonlinear Rabi model by propagating classical light fields in a set of two photonic lattices. However, the nonlinear Rabi model has already been rigorously proven to be undefined by Lo [Quantum Semiclass. Opt. 10, L57 (1998)]. Hence, the proposed classical simulation is actually not applicable to the nonlinear Rabi model and the simulation results are completely invalid.

  3. Phytoplankton and zooplankton of some paddy-cum-prawn culture fields in and around Cochin

    Digital Repository Service at National Institute of Oceanography (India)

    Gopalakrishnan, T.C.; Devi, C.B.L.; Aravindakshan, P.N.; Nair, K.K.C.; Balasubramanian, T.; Kutty, M.K.

    in the 4 areas showed that the striking regional differences in salinity and nutrient concentrations have not exerted appreciable effect on them to demarcate these regions on the basis of such differences. (More frequent occurrence of unialgal blooms...

  4. Plea bargaining and the religious cum socio-cultural concept of ...

    African Journals Online (AJOL)

    The seemingly unending arguments on these debates about plea bargaining call for a scholarly attention, if the current efforts of government at eradicating corruption in the country will not be a mere political statement. On this issue, various researches have been carried out, some for the removal of this aspect of criminal ...

  5. Remo cum fratre Quirinus: Metamorphoses of the Roman Foundation Myth from its Beginnings to Horace

    Directory of Open Access Journals (Sweden)

    Špela Tomažinčič

    2008-07-01

    Full Text Available From the first reference to Romulus by Alcimus, a historian from the mid-fourth century BC, where the hero appears alone, down to the age of Augustus, the story of the foundation of Rome underwent considerable plot changes. The two most important are, firstly, Romulus' later role not merely as a conditor urbis, but – in keeping with the Hellenistic tradition of ktiseis poleon – mainly as a creator gentis and a model of the new Roman, who can subsequently embody a new ethnic identity; and, secondly, the later dichotomy of the founders. The interpretation of the Roman foundation myth must be therefore closely associated with the symbolism of numbers – one founder as opposed to twin founders – as it is reflected in different socio-political and historical contexts. In addition to shaping society, myth also documents all its changes. In the context of replacing a single founder with twin founders, Romulus and Remus, the first critical change is the introduction of Remus. The twin founders imply a double community, a notion which becomes meaningful in Rome only after the plebeian achievement of political equality between 367 and 342 BC. The second significant change is the death of Remus, involving the notion of a foundation sacrifice, for which the evidence points to the crisis of 296 BC. The foundation story also serves as an explanation model for the events in the Late Roman Republic. Horace's pessimistic Seventh Epode evokes the foundation crime of fratricide to explain the tragic pattern of civil wars. As Romulus' successors, the Romans are also heirs to his crime, to the scelus fraternae necis, from which they cannot escape. Moreover, Romulus as a creator gentis represents a potential source for the Roman change of identity, which was regarded as coincidental with the foundation act. This recurring theme is elaborated first in Ennius' Annals and later in Vergil's Aeneid and Horace's Third ‘Roman Ode’. The central motif is Ennius’ concilium deorum and its discussion of Romulus' apotheosis, which is opposed by Juno on account of his Trojan identity. Juno, the traditional mythological opponent of the Trojans, demands in exchange for Romulus' apotheosis a break with the old Trojan concept. This break is to be reflected in a new name for the city, which shall be named after its founder, chosen by the auspicium contest. The auspicium thus represents the divine election of the Trojans' legitimate successors, while Romulus' apotheosis symbolically fulfils the idea of a cosmic Roman empire predicted in Juno's Roman Ode speech. The two mythological exempla of Troy and Romulus serve as two opposing models, Troy being the eastern, un-Roman principle, and Romulus the embodiment of the Roman principle. In effect, they present the conflict of two different value systems, which is based on moral criteria and a negative characterisation of the eastern principle. These models are intended to guide the political, ideological and moral assessments of Augustan readers faced with watershed historical events. The contemporary allusions can hardly escape an attentive modern reader. The main characteristic that defines the Roman foundation story as a myth is precisely its sensitivity to social and political changes – a prerequisite for its transmission and continuity, as well as an indicator of its social relevance at different moments in history.

  6. Application of the two coupled models for water quality management: facultative pond cum constructed wetland models

    Science.gov (United States)

    Mashauri, D. A.; Kayombo, S.

    Recent work has emphasized the potential importance of the constructed wetland systems for purification of effluents from secondary biological treatment plants for prevention of pollution to the receiving water bodies. A model for transformation of organic carbon in facultative pond (FP) was formulated and was coupled with a model of organic carbon transformation in the constructed wetland (CW) for downstream water resources management. The main essence of coupling the model was to have simultaneous simulation of PFP and CW processes. Simultaneous run of the two models imply that the disturbance on parameters in PFP will have a direct effect on CW processes. The model was formulated on the basis fundamental principle that the growth of active biomass in the system defines the transformation of organic carbon. The growth rate of microorganisms was model based on the Monod kinetic equation. The forcing functions to the model were formulated based on multiplicative function. The removal of organic carbon in the FP based on the unfiltered sample was 66% with an average concentration of 206 mg COD/l in the effluent. The removal of organic carbon in the CW was 87.5% with an average concentration of 40 mg COD/l in the effluent. The overall performance of the coupled model was 93%. The main processes of organic carbon removal in the FP and CW were due to uptake by heterotrophic bacteria followed by oxidation. It was found that 80% of the total organic carbon in the CW was due to the biological growth. Oxidation of organic carbon in the PFP was a source of high growth of algae. The constants and coefficients obtained after validation of the model reflect the simultaneous performance of the coupled model of PFP and CW.

  7. Stationary concentrating reflector cum tracking absorber solar energy collector: optical design characteristics.

    Science.gov (United States)

    Steward, W G; Kreith, F

    1975-07-01

    This article presents an analysis of the optical design characteristics of a stationary reflecting/tracking absorber solar energy collector. This type of collector consists of a segment of a spherical mirror placed in a stationary position facing the sun, but having a linear absorber that can track the image of the sun by a simple pivoting motion about the center of curvature of the reflector. The optical characteristics of this system and the axial variation of its concentration ratio are developed to provide information for the engineering design and sizing of this type of solar energy collector system.

  8. Tracks in the Sand: Hooke's Pendulum "Cum Grano Salis"

    Science.gov (United States)

    Babovic, Vukota; Babovic, Miloš

    2014-01-01

    The history of science remembers more than just formal facts about scientific discoveries. These side stories are often inspiring. One of them, the story of an unfulfilled death wish of Jacob Bernoulli regarding spirals, inspired us to look around ourselves. And we saw natural spirals around us, which led to the creation of a Hooke's…

  9. A classical simulation of nonlinear Jaynes-Cummings and Rabi models in photonic lattices: comment

    National Research Council Canada - National Science Library

    Lo, C F

    2014-01-01

    Recently Rodriguez-Lara et al. [Opt. Express 21(10), 12888 (2013)] proposed a classical simulation of the dynamics of the nonlinear Rabi model by propagating classical light fields in a set of two photonic lattices...

  10. HYPERTROPHICALUM ADENOIDIS IN RE-LATIUM CUM SECRETUM OTTITIS IN MEDIAM

    Directory of Open Access Journals (Sweden)

    Lidija DUBROVSKA-MILETIC

    1999-11-01

    Full Text Available In this study we presented the treatment of 20 children with secretory otitis media (SOM. The treatment was surgical and it considened-ventilaton tube insertion and adenoidectomy in case of enlarged adenoid. In this clinical investigation was enroll 15 boys and 5 girls in age 5 to 10 were divided in two main groups:1. 9 children without enlarged adenoid2. 11 children with confirmed enlarged adenoidClinical material was analyzed according to hearing level, middle ear condition estimated by pure toneaudiiometry and tympanometry before and after the treatment. The result showed that adenoidectomy in combination with ventilation tube insertion facilitate secretory otitis media. That’s enable timely improving of hearing function us a important on development of speech, social, emotional and academic development in the early childhood.

  11. theCN.com: An Academic-cum-Social Networking Online Platform

    Directory of Open Access Journals (Sweden)

    Mandar Lakshmikant Bhanushe

    2013-09-01

    Full Text Available This article is a review of theCN, an online virtual learning environment. CN is more than a learning management system, as it not only focuses on course content delivery and management, but takes it a step further by introducing the networking of courses and their content. In comparison with existing LMS’s, which are housed in closed walls with limited access to learners and instructors within institutions, used to merely manage courses online, CN is an open, free, academic and social networking framework scalable to massive numbers of learners from any place in the world within a single environment. CN is free for all to use across the globe. With some minor improvements, CN, as an LMS is surely one of very useful and helpful virtual learning technology tool available to distance learners and institutions to make learning entertaining and fruitful in achieving its learning objectives.

  12. Very Weak Signals (VWS detected by stacking method according to different astronomical periodicities (HiCum

    Directory of Open Access Journals (Sweden)

    M. van Ruymbeke

    2007-11-01

    Full Text Available A stacking method to detect very weak signals is introduced in this paper. This method is to stack observed data in different well known periodicities according to the astronomical clock since majority geophysical observations are time based. We validated this method by applying it in four different cases. Interactions behind the observed parameters become obviously after it is stacked in two diurnal and semidiurnal tidal periodical waves. Amplitude and phase variations will be also measurable when a sliding windows stacking is used. This could be an important reference to find precursors before some earthquakes and volcanic events, corresponding to attenuations of medium patterns.

  13. The Tradition of Ancient Logic-cum-Grammar in the Middle Ages - What's the Problem?

    DEFF Research Database (Denmark)

    Ebbesen, Sten

    2007-01-01

    Middelalderlig grammatik og logik udvikledes i frugtbar spænding mellem arvet stof af stoisk og peripatetisk oprindelse, mens neoplatonismen stort set er ligegyldig i netop denne sammenhæng. Der slås til lyd for ved siden af de traditionelle antikke skoler at regne med en "hellenistisk standardlæ...

  14. Performance of animal-drawn, ripper attached maize-cum-fertilizer ...

    African Journals Online (AJOL)

    To overcome the problem, a new ripper attached animal-drawn maizecum- fertilizer planter (RAP) was developed. The implement was compared with a sweeper attached planter (SAP) and the conventional method of planting in rows (CMP) as a check in RCBD with three replication in a plot size of 10x40m2 at Melkassa ...

  15. Environmental conditions of some paddy cum prawn culture fields of Cochin backwaters, southwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, K.K.C.; Sankaranarayanan, V.N.; Gopalakrishnan, T.C.; Balasubramanian, T.; Devi, C.B.L.; Aravindakshan, P.N.; Kutty, M.K.

    ecological distortions because of its proximity to the sea. The results indicate that the fields in areas 1 and 3 have environmental conditions highly suited for prawn culture whereas in area 2 the salinity conditions are not very conducive for prawn growth...

  16. Study on a waste heat-driven adsorption cooling cum desalination cycle

    KAUST Repository

    Ng, Kim Choon

    2012-05-01

    This article presents the performance analysis of a waste heat-driven adsorption cycle. With the implementation of adsorption-desorption phenomena, the cycle simultaneously produces cooling energy and high-grade potable water. A mathematical model is developed using isotherm characteristics of the adsorbent/adsorbate pair (silica gel and water), energy and mass balances for the each component of the cycle. The cycle is analyzed using key performance parameters namely (i) specific cooling power (SCP), (ii) specific daily water production (SDWP), (iii) the coefficient of performance (COP) and (iv) the overall conversion ratio (OCR). The numerical results of the adsorption cycle are validated using experimental data. The parametric analysis using different hot and chilled water temperatures are reported. At 85°C hot water inlet temperature, the cycle generates 3.6 m 3 of potable water and 23 Rton of cooling at the produced chilled water temperature of 10°C. © 2012 Elsevier Ltd and IIR. All rights reserved.

  17. Historiography of the Print Media: A global-cum-Nigerian perspective

    African Journals Online (AJOL)

    The print media as we know them today have developed over a number of centuries. Any discourse on its (print media) evolution without recourse to the means of communications that preceded it, would not appreciate the long strenuous stride it had made to this present day. The print media evolved through three historical ...

  18. Miks projektivõrgustikud projektmeeskondadele tuule alla teevad ? / Jonathan Cummings, Carol Pletscher

    Index Scriptorium Estoniae

    Cummings, Jonatahan

    2011-01-01

    Õige ja asjakohase oskusteabe leidmise keerukusest teadmistemahukate meeskonnaprojektide realiseerimisel. Projektvõrgustike analüüs. Skeemid: Mille poolest finaalijõudnud meeskonnad erinesid?, Kuidas projektvõrgustikud laiendavad meeskonna haaret?, Kuidas kasutada projektvõrgustikke?

  19. [From digit-sucking-cum-deglutition to deglutition in dentate subjects].

    Science.gov (United States)

    Fellus, Patrick

    2016-03-01

    Failure to manage function-related problems can lead to failures in the conduct of orthodontic treatment and to poor stability. However, even if the dysfunctions have been diagnosed by the practitioner, he/she will still be dependent on the quality of the rehabilitation. Traditionally, rehabilitation requires intensive participation on the part of patients in order to ensure stimulation to their cortical neural networks. Eric Kandel, winner of the Nobel Prize for Medicine in 2000, has shown that this approach stimulates information transmission by boosting the activity of the neurotransmittors. Likewise, he demonstrated that when rehabilitation is aimed at the sub-cortical pathway, there is no longer augmentation of the neurotransmission but rather the build-up of new circuits involving the creation of new synapses. Today, it is possible to rehabilitate swallowing and breathing by the sub-cortical pathway. © EDP Sciences, SFODF, 2016.

  20. Cum se construiește profilul strategic al unei comunități

    Directory of Open Access Journals (Sweden)

    Călin Emilian HINȚEA

    2015-12-01

    Full Text Available The article presents a particular methodology of strategic planning: building a strategic profile of the community. This model is the result of years of research and applied planning in local communities and tries to help all interested parties to understand and use the strategy.

  1. Dual to Ratio-Cum-Product Estimator in Simple and Stratified Random Sampling

    OpenAIRE

    Yunusa Olufadi

    2013-01-01

    New estimators for estimating the finite population mean using two auxiliary variables under simple and stratified sampling design is proposed. Their properties (e.g., mean square error) are studied to the first order of approximation. More so, some estimators are shown to be a particular member of this estimator. Furthermore, comparison of the proposed estimator with the usual unbiased estimator and other estimators considered in this paper reveals interesting results. These results are fur...

  2. Participatory Action Research (PAR) cum Action Research (AR) in Teacher Professional Development: A Literature Review

    Science.gov (United States)

    Morales, Marie Paz E.

    2016-01-01

    This paper reviews Participatory Action Research as an approach to teacher professional development. It maps the origins of Participatory Action Research (PAR) and discusses the benefits and challenges that have been identified by other researchers in utilizing PAR approaches in conducting research. It draws ideas of combining the features of…

  3. Atomic Dipole Squeezing in the Correlated Two-Mode Two-Photon Jaynes-Cummings Model

    Science.gov (United States)

    Dong, Zhengchao; Zhao, Yonglin

    1996-01-01

    In this paper, we study the atomic dipole squeezing in the correlated two-mode two-photon JC model with the field initially in the correlated two-mode SU(1,1) coherent state. The effects of detuning, field intensity and number difference between the two field modes are investigated through numerical calculation.

  4. Structural stability and magnetic properties of CumConNO (m+ n= 2 ...

    Indian Academy of Sciences (India)

    Co 2 NO, Co 3 NO, Cu 2 Co 2 NO, Co 5 NO, Cu 2 Co 4 NO and Cu 6 CoNO clusters have larger adsorption energies, indicating that NO of these clusters are more easily adsorbed. After adsorption, N–O bond is weakened and the activity is enhanced as a result of vibration frequency of N–O bond getting lower than that of a ...

  5. Dirac bi-spinor entanglement under local noise and its simulation by Jaynes-Cummings interactions

    Science.gov (United States)

    Bittencourt, Victor A. S. V.; Bernardini, Alex E.

    2017-08-01

    A description of the effects of the local noise on the quantum entanglement constraining the internal degrees of freedom of Dirac bi-spinor structures driven by arbitrary Poincaré invariant potentials is proposed. Given that the Dirac equation dynamics including external potentials can be simulated by a suitable four level trapped ion setup, quantum entanglement of two-qubit ionic states with quantum numbers related to the total angular momentum and to its projection onto the direction of the external magnetic field (used for lift the ions degeneracy), are recovered by means of a suitable ansatz. This formalism allows the inclusion of noise effects, which leads to disentanglement in the four level trapped ion quantum system. Our results indicate the role of interactions in bi-spinor entanglement, as well as the description of disentanglement in ionic states under local noises. For a state prepared initially in one of the ionic levels, local noise induces entanglement sudden death followed by sudden revivals driven by the noiseless dynamics of the state. Residual quantum correlations are observed in the intervals where such state is separable. Schrödinger cat and Werner states partially loose their initial entanglement content due to the interaction with the noisy environment but presenting entanglement oscillations without sudden death. Because Dirac equation describes low energy excitations of mono layer and bi-layer graphene, the formalism can also be applied to compute, for instance, electron-hole or electron/electron entanglement in various circumstances.

  6. Teste Albumasare cum Sibylla: astrology and the Sibyls in medieval Europe.

    Science.gov (United States)

    Smoller, Laura Ackerman

    2010-06-01

    In the 1480s Dominican humanist Filippo de' Barbieri published an illustration of a supposedly ancient female seer called the 'Sybilla Chimica', whose prophetic text repeated the words of the ninth-century astrologer Abu Ma'shar. In tracing the origins of Barbieri's astrological Sibyl, this article examines three sometimes interlocking traditions: the attribution of an ante-diluvian history to the science of the stars, the assertion of astrology's origins in divine revelation, and the belief in the ancient Sibyls' predictions of the birth of Christ and other Christian truths. Medieval authors from the twelfth century on began to cite these traditions together, thereby simultaneously authorizing the use of astrology to predict religious changes and blurring the categories of natural and supernatural as applied to human understanding. This blending of astrology and prophecy appears notably in works by such authors as John of Paris, John of Legnano, Johannes Lichtenberger, and Marsilio Ficino. Ultimately the trajectory that produced Barbieri's astrological Sibyl would lead to a wave of astrological apocalyptic predictions in the sixteenth and seventeenth centuries, as well as to the harnessing of astrology for the defense of the faith in the form of an astrological natural theology, sacralizing science as well as nature.

  7. A class-cum-class estimators for population ratio in poststratified ...

    African Journals Online (AJOL)

    Conditions under-which some of the estimators in the proposed class perform better than the others (in terms of having smaller mean square errors) are obtained for repeated samples of fixed sizes. Keywords: Successive sampling, poststratified sampling, ratio estimation, matching (or replacement) fraction, repeated ...

  8. Quantum teleportation via entangled states generated by the Jaynes-Cummings model

    Energy Technology Data Exchange (ETDEWEB)

    Metwally, N.; Abdelaty, M.; Obada, A.-S.F. E-mail: asobada@yahoo.com

    2004-11-01

    In this contribution, quantum channels induced from an atom-field interaction (JCM), are used to teleport one and two qubit states. The initial state of the filed is taken to be in a coherent state while the atom starts from its excited state. The field parameters could be used as control parameters. It is shown that the fidelity of the teleported state depends on the fidelity of the input state, the degree of entanglement and the mixedness of the quantum channels. Finally, we find that a higher entangled channel is needed for a higher entangled state to be teleported.

  9. Company Tax Coordination cum Tax Rate Competition in the European Union

    OpenAIRE

    Eggert, Wolfgang; Haufler, Andreas

    2006-01-01

    This paper reviews the recent theoretical literature that analyses the European Union's policy to eliminate preferential corporate tax regimes and the proposal to introduce a consolidated EU tax base with formula apportionment for the taxation of multinational firms. Since neither proposal includes a harmonisation of corporate tax rates, a core issue is how tax competition between member states will be affected by these partial coordination measures. The conclusions from our review are suppor...

  10. Teologia, ordini religiosi e rapporti politici: la questione dell’Immacolata Concezione di Maria tra Roma e Madrid (1614-1663)

    National Research Council Canada - National Science Library

    Broggio, Paolo

    2013-01-01

    The article analyses the first moments of the doctrinal controversy about the dogmatic definition of the Immaculate Conception of Mary form the point of view of the relationships, managed by nuncio...

  11. Cum descriu oamenii experienta schimbarii locului de munca din mediul public in cel privat? O analiza interpretativ fenomenologica

    Directory of Open Access Journals (Sweden)

    Mateiana, Roxana

    2012-12-01

    Full Text Available The current research aims to present a detailed idiographic analysis regarding the experience of changing jobs from public service to private sector. The study was conducted on a sample consisting of five participants, ages between 24 and 46 years old. Each participant was interviewed based on semi-structured interviews and their transcripts were further analyzed using the interpretative phenomenological analysis. This specific method implied analyzing the experiential responses and their respective meanings line by line, retaining the first impressions followed by identifying the emergent topics from the experiential material, with focus on similarities and discrepancies within each case, as well as between all cases. Five themes emerged from the experiential material provided by the participants: the job characteristics in the public sector, the causes that lead to changing the workplace, the job characteristics in the private sector, barriers in adapting to the new work settings, changes regarding the relationship work – family life. Based on the “verbatim” content obtained, there could be outlined a certain “portrait” of the public sector as a product of a specific cultural, economic, social and even political environment, presented mainly as opposed to the private sector. The propensity to the “family” type work group, the institutional disorganization, the chaos represented by the bureaucracy, the lack of motivation and the routine are among the issues that matter, but „lack” to the participants in the new workplace. We consider that this kind of approach provides new insights regarding the experience of changing the workplace from public to private sector, based on first-hand information from people who went trough the experience.

  12. An Investigation into Occasional White Spot Syndrome Virus Outbreak in Traditional Paddy Cum Prawn Fields in India

    Directory of Open Access Journals (Sweden)

    Deborah Gnana Selvam

    2012-01-01

    Full Text Available A yearlong (September 2009–August 2010 study was undertaken to find out possible reasons for occasional occurrence of White Spot Syndrome Virus (WSSV outbreak in the traditional prawn farms adjoining Cochin backwaters. Physicochemical and bacteriological parameters of water and sediment from feeder canal and four shrimp farms were monitored on a fortnightly basis. The physicochemical parameters showed variation during the two production cycles and between the farms studied. Dissolved oxygen (DO content of water from feeder canal showed low oxygen levels (as low as 0.8 mg/L throughout the study period. There was no disease outbreak in the perennial ponds. Poor water exchange coupled with nutrient loading from adjacent houses resulted in phytoplankton bloom in shallow seasonal ponds which led to hypoxic conditions in early morning and supersaturation of DO in the afternoon besides considerably high alkaline pH. Ammonia levels were found to be very high in these ponds. WSSV outbreak was encountered twice during the study leading to mass mortalities in the seasonal ponds. The hypoxia and high ammonia content in water and abrupt fluctuations in temperature, salinity and pH might lead to considerable stress in the shrimps triggering WSSV infection in these traditional ponds.

  13. Eco-friendly and facile integrated biological-cum-photo assisted electrooxidation process for degradation of textile wastewater.

    Science.gov (United States)

    Aravind, Priyadharshini; Subramanyan, Vasudevan; Ferro, Sergio; Gopalakrishnan, Rajagopal

    2016-04-15

    The present article reports an integrated treatment method viz biodegradation followed by photo-assisted electrooxidation, as a new approach, for the abatement of textile wastewater. In the first stage of the integrated treatment scheme, the chemical oxygen demand (COD) of the real textile effluent was reduced by a biodegradation process using hydrogels of cellulose-degrading Bacillus cereus. The bio-treated effluent was then subjected to the second stage of the integrated scheme viz indirect electrooxidation (InDEO) as well as photo-assisted indirect electro oxidation (P-InDEO) process using Ti/IrO2-RuO2-TiO2 and Ti as electrodes and applying a current density of 20 mA cm(-2). The influence of cellulose in InDEO has been reported here, for the first time. UV-Visible light of 280-800 nm has been irradiated toward the anode/electrolyte interface in P-InDEO. The effectiveness of this combined treatment process in textile effluent degradation has been probed by chemical oxygen demand (COD) measurements and (1)H - nuclear magnetic resonance spectroscopy (NMR). The obtained results indicate that the biological treatment allows obtaining a 93% of cellulose degradation and 47% of COD removal, increasing the efficiency of the subsequent InDEO by a 33%. In silico molecular docking analysis ascertained that cellulose fibers affect the InDEO process by interacting with the dyes that are responsible of the COD. On the other hand, P-InDEO resulted in both 95% of decolorization and 68% of COD removal, as a result of radical mediators. Free radicals generated during P-InDEO were characterized as oxychloride (OCl) by electron paramagnetic resonance spectroscopy (EPR). This form of coupled approach is especially suggested for the treatment of textile wastewater containing cellulose. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Low-voltage Organic Thin Film Transistors (OTFTs) with Solution-processed High-k Dielectric cum Interface Engineering

    Science.gov (United States)

    Su, Yaorong

    Although impressive progress has been made in improving the performance of organic thin film transistors (OTFTs), the high operation voltage resulting from the low gate areal capacitance of traditional SiO 2 remains a severe limitation that hinders OTFTs' development in practical applications. In this regard, developing new materials with high- k characteristics at low cost is of great scientific and technological importance in the area of both academia and industry. In this thesis, we first describe a simple solution-based method to fabricate a high-k bilayer Al2Oy/TiOx (ATO) dielectric system at low temperature. Then the dielectric properties of the ATO are characterized and discussed in detail. Furthermore, by employing the high-k ATO as gate dielectric, low-voltage copper phthalocyanine (CuPc) based OTFTs are successfully developed. Interestingly, the obtained low-voltage CuPc TFT exhibits outstanding electrical performance, which is even higher than the device fabricated on traditional low-k SiO2. The above results seem to be contradictory to the reported results due to the fact that high-k usually shows adverse effect on the device performance. This abnormal phenomenon is then studied in detail. Characterization on the initial growth shows that the CuPc molecules assemble in a "rod-like" nano crystal with interconnected network on ATO, which probably promotes the charge carrier transport, whereas, they form isolated small islands with amorphous structure on SiO2. In addition, a better metal/organic contact is observed on ATO, which benefits the charge carrier injection. Our studies suggest that the low-temperature, solution-processed high-k ATO is a promising candidate for fabrication of high-performance, low-voltage OTFTs. Furthermore, it is well known that the properties of the dielectric/semiconductor and electrode/semiconductor interfaces are crucial in controlling the electrical properties of OTFTs. Hence, investigation the effects of interfaces engineering on improving the electrical characteristics of OTFTs is of great technological importance. For the dielectric/semiconductor interface, an octadecylphosphonic acid (ODPA) self-assembled monolayer (SAM) is used to modify the surface of ATO (ODPA/ATO). For the electrode/semiconductor interface, a simple in-situ modified Cu (M-Cu) is employed as source-drain (S/D) electrodes in stead of commonly used Au. The electrical characteristics of pentacene TFT are drastically enhanced upon interfaces modification. Moreover, by encapsulating the M-Cu with a thin layer of Au (Au/ M-Cu), the device performance is further improved. The detailed mechanism is systematically explored. Finally, organic electronic devices on flexible plastic substrates have attracted much attention due to their low-cost, rollability, large-area processability, and so on. One of the most critical issues in realization flexible OTFTs is the integration of gate dielectrics with flexible substrates. We have successfully incorporated the ODPA/ATO with Au coated flexible polyimide (PI) substrate. By using Au/M-Cu as S/D electrode, the flexible pentacene TFTs show outstanding electrical performance. In addition, the mechanical flexibility and reliability of the devices are studied in detail. Our approach demonstrates an effective way to realize low-cost, high-performance flexible OTFTs.

  15. Diversidad de enterobacterias asociadas a frutos de tomate (Lycopersi-cum sculentum Mill y suelos de invernadero

    Directory of Open Access Journals (Sweden)

    M. Lorena Luna-Guevara

    2012-01-01

    Full Text Available El objetivo de este trabajo fue determinar la diversidad de enterobacterias presentes en suelo y tomates provenientes de tres invernaderos de fertirrigación. Estos sistemas de cultivo son una alternativa importante de producción en agricultura protegida, sin embargo, existe escasa información acerca de la calidad microbiológica de los frutos y su relación con las características químicas del suelo. Las evaluaciones del suelo consistieron en analizar el contenido de materia orgánica y pH. En los análisis microbiológicos se aislaron e identificaron enterobacterias en muestras compuestas de suelo y frutos con diferentes grados de madurez (0, 50 y 100%, utilizando medios de cultivo selectivos, diferenciales y pruebas confirmatorias con el sistema VITEK. Los patogrupos de Escherichia coli enteropatogena (EPEC y enterotoxigénica (ETEC se caracterizaron genotípicamente mediante la técnica de reacción en cadena de la polimerasa (PCR, amplificándose los genes bfpA y lngA. Con las especies identificadas se calcularon los índices de diversidad Simpson (D y Shannon-Wiener (H´ y estimador de Chao (SChao1. Las especies Enterobacter cloacae, Citrobacter freundii y C. brakii presentaron mayor frecuencia de aislamiento, EPEC y ETEC fueron identificadas en muestras de suelo y en frutos con 100% de madurez. En suelo, los porcentajes de materia orgánica se correlacionaron positivamente con los índices H´. En fruto, aunque H´ y D reflejaron comunidades bacterianas menos diversas, el aislamiento de ETEC y Shigella boydii sobre la superficie del fruto comprometen su inocuidad debido a que habitualmente se consume en forma cruda.

  16. Les débuts de la communauté œcuménique du Mont Athos

    Directory of Open Access Journals (Sweden)

    D. NASTASE

    1985-09-01

    Full Text Available  Δ. Ναστάσε  Οἱ ἀπαρχὲς τῆς οἰκουμενικῆς κοινότητας τοῦ Ἁγίου Ὄρους  Τὴν ἵδρυση τῆς μονῆς τῆς Λαύρας τοῦ ἁγίου Ἀθανασίου (ποὺ ὁλοκληρώθηκε στὰ 963/4 ἀκολούθησε μία θεαματική αὔξηση τοῦ ἀριθμοῦ τῶν μονῶν τοῦ Ἄθω. Στὴ μεγάλη τους πλειοψηφία, αὐτὲς οἱ μονὲς ἦταν ἑλληνικές, ἀλλὰ πολὺ γρήγορα ἐμφανίστηκαν καὶ μερικὲς μονὲς τῶν ὁποίων οἱ ἱδρυτές (ή οἱ νεοκτήτορες καὶ οἱ μοναχοὶ ἦταν Γεωργιανοὶ (Ἴβηρες, Ἀρμένιοι, Ἰταλοὶ («Λατίνοι» ἀπὸ τὸ Βενεβέντο καὶ τὸ Ἀμάλφι, ἀλλὰ καὶ Ἕλληνες άπὸ τὴν Καλαβρία καὶ τὴ Σικελία, Ρῶσοι, Βούλγαροι καὶ ἀργότερα Σέρβοι. Ἔτσι δημιουργήθηκε στὸν Ἄθω μία πολυεθνικὴ μοναστικὴ κοινότητα μὲ οἰκουμενικὸ χαρακτήρα. Τὶς ἀπαρχὲς αὐτῆς τῆς κοινότητας ἐρευνᾶ ὁ συγγραφέας, στρέ­φοντας τὴν προσοχή του ιδιαιτέρως στὶς «ξένες» ἀθωνίτικες μονές.Θεωρεῖται ἕως τώρα ὅτι ἡ ἵδρυση αὐτῶν τῶν μονῶν ὀφείλεται στὸ πνευματικὸ κῦρος τοῦ Ἄθω καὶ ἀρχικὰ στὴν προσωπικὴ φήμη τοῦ ἁγίου Ἀθανασίου. Ἀλλὰ ἡ ἔρευνα τῶν ἱστορικῶν συνθηκῶν κάτω ἀπὸ τὶς ὁποῖες ἐγκαθίστανται στὸν Ἄθω οἱ ξένοι μοναχοὶ ὁδηγεῖ ἀναφορικὰ μὲ τὸ θέμα αὐτὸ στὰ ἑξῆς διαφορετικὰ ἀποτελέσματα.Ἡ οἰκουμενικὴ ἀθωνίτικη κοινότητα δημιουργήθηκε μὲ τὴ θέληση τῶν βυ­ζαντινῶν αὐτοκρατόρων, στὰ πλαίσια ἑνὸς πραγματικὰ πολιτικοῦ προγράμμα­τος μὲ θρησκευτικὴ μορφή. Αὐτή ἡ κοινότητα ἀντικατοπτρίζει πιστά, κατὰ τὴν πρώτη της φάση, τὴ στρατιωτική, πολιτική, καὶ ἐκκλησιαστικὴ ἐπέκτα­ση τοῦ Βυζαντίου, ὑπὸ τὸν Νικηφόρο Φωκά, τὸν Ἰωάννη Τσιμισκῆ καὶ τὸν Βασίλειο Β', καὶ προοριζόταν ἀπὸ τὴν ἀρχὴ νὰ ἀποτελέσει ἕνα ζωντανὸ σύμ­βολο τῆς χριστιανικῆς αὐτοκρατορικῆς οἰκουμένης, ποὺ ἐπικεφαλῆς της, σύμφωνα μὲ τὴ βυζαντινὴ ἰδεολογία, ἦταν οἱ αὐτοκράτορες τῆς Κωνσταντινούπολης. Στὴν κορυφὴ αὐτῆς τῆς κοινότητας, βρισκόταν ἡ Λαύρα τοῦ Ἀθανασίου, ἐκ­προσωπώντας τὴν οἰκουμενικὴ κυριαρχία αὐτῶν τῶν αὐτοκρατόρων. Ὅσον ἀφορᾶ στὶς ξένες μονές, αὐτὲς ὑποδείκνυαν καὶ ἐγγυόνταν τὴν ἀναγνώριση αὐτῆς τῆς κυριαρχίας ἀπὸ τοὺς ἡγεμόνες τῶν ἀντίστοιχων χωρῶν. Ἔτσι εξηγεῖται γιατί, σὲ ὅλες τὶς γνωστές μας περιπτώσεις, οἱ ἱδρυτὲς καὶ πρῶτοι ἡγούμενοι αὐτῶν τῶν μονῶν (τῆς μονῆς Ἰβήρων, τῆς μονής τοῦ Λέοντα τοῦ Βενεβέντο καὶ ἀργότερα τῆς σερβικῆς μονῆς τοῦ Χιλανδαρίου ἀνῆκαν στὶς ἡγεμονικὲς οἰκογένειες τοῦ τόπου τους: στὴν πραγματικότητα, αὐτὰ τὰ σημαντικὰ πρό­σωπα ἔρχονταν στὸν Ἄθω, ὄχι μὲ τὴ δική τους πρωτοβουλία, ἀλλὰ μὲ τὴ θέ­ληση τῶν βυζαντινῶν αὐτοκρατόρων. Μὲ τὸν ἴδιο τρόπο -δηλαδὴ ἱδρύοντας ἤ ξαναχτίζοντας μία ἀθωνίτικη μονὴ- φαίνεται ὅτι ἀποδείκνυαν τὴν ὄχι καὶ τόσο σίγουρη πίστη τους πρὸς αὐτοὺς τοὺς αὐτοκράτορες, καί ἄλλοι ξένοι, εἴτε πρώην ἡγεμόνες, εἴτε ἀξιωματοῦχοι ποὺ ὑπηρετοῦσαν στὸ Βυζάντιο, ἤ ἀκόμα καὶ μερικὲς μεγάλες βυζαντινὲς οἰκογένειες.Ἄλλες μονὲς «ἀντιπροσώπευαν» στὴν κοινότητα περιφερειακὲς βυζαντινὲς ἐπαρχίες ποὺ ἀπειλοῦντο ἀπὸ ἐχθροὺς (ὅπως ἡ Καλαβρία ἤ ποὺ εἶχαν ἤδη χαθεῖ, ἀλλὰ ποὺ τὸ Βυζάντιο συνέχισε νὰ διεκδικεῖ (ὅπως ἡ Σικελία.Μετὰ τὴν κατάκτηση τῆς Βουλγαρίας (ποὺ ὁλοκληρώθηκε στὰ 1018, παραχωρήθηκε στοὺς Βούλγαρους, μὲ τὴν ἴδια συμβολικὴ σημασία τῆς ὑπο­ταγῆς τους, ἡ παλαιότερη μονὴ τοῦ Ζωγράφου». Περίπου τὴν ἴδια ἐποχή, ἡ ἵδρυση μιᾶς ρωσικῆς μονῆς στὸ Ἅγιον Ὄρος ἀντιστοιχεῖ μὲ τὴν εἴσοδο τῆς ἡγεμονίας τοῦ Κιέβου στὴ «χριστιανικὴ οἰκουμένη» καί, πιὸ συγκεκριμένα, στὴ βυζαντινὴ «ζώνη ἐπιρροής».Λίγο ἀργότερα, ὁ πρῶτος σουλτάνος τοῦ Ροὺμ ἀναγνώρισε τυπικὰ τὴν κυ­ριαρχία τοῦ Ἀλεξίου Α' τοῦ Κομνηνοῦ: ἔτσι ἱδρύθηκε στὸ Ἅγιον Ὄρος ἡ μονὴ τοῦ Κουτλουμουσίου, ὁ κτήτωρ τῆς ὁποίας ἦταν ἕνας σελτζοῦκος πρίγκηπας ἀπὸ τὴ δυναστεία τῶν «Qutlumuš», ποὺ ἔγινε μ' αὐτὸν τὸν τρόπο χριστιανὸς ὀρθόδοξος καὶ ἁγιορείτης μοναχός.Αὐτὲς οἱ τελευταῖες περιπτώσεις δείχνουν ὅτι ἡ «διεθνὴς ἀναγνώριση» νέων κρατῶν -χριστιανικῶν καὶ μὴ- ἐξαρτιόταν ἀπὸ τὸ Ἅγιον Ὄρος καί, συνεπῶς, ὅτι μέσω τῆς οἰκουμενικῆς ἀθωνίτικης κοινότητας ποὺ εἶχε δημιουρ­γήσει, τὸ Βυζάντιο μποροῦσε νὰ ἐπιβληθεῖ στὸ διεθνὴ χῶρο ἀκόμα κ'ἐκεῖ ποὺ δὲν κατάφερε νὰ τὸ πετύχει μὲ τὴν ἰσχὺ τῶν ὅπλων.Ἡ ἔρευνα σταματᾶ στὰ 1204, ὁπότε ἡ ἱστορία τοῦ Ἁγίου Ὄρους εἰσέρχεται σὲ μία καινούργια φάση, μὲ τὴν ὁποία ὁ συγγραφέας ἀσχολήθηκε ἀλλοῦ.Τὰ ἀποτελέσματα αὐτῆς τῆς ἔρευνας, δείχνουν ὅτι ὁ ρόλος ποὺ ἔπαιξε τὸ Ἅγιον Ὄρος στὴν ἱστορία τοῦ Βυζαντίου καὶ τοῦ Ἑλληνισμοῦ, ἀλλὰ καὶ ἄλλων λαῶν, ὀρθόδοξων καὶ μή, ἦταν πολὺ πιὸ σημαντικὸς καὶ πολυδιάστατος, ἀπ' ὅ,τι θὰ μπορούσαμε νὰ φανταστοῦμε.

  17. Législation canonique, œcuménique, du V-e siècle

    Directory of Open Access Journals (Sweden)

    Ghenadie Serban

    2009-12-01

    Full Text Available The Fifth Century has been affected by internal and external struggles. The great Roman Empire began to fall apart. Since the Fourth Century, the center of gravity was moving from Rome to Constantinople. The Church was never safe from turmoil. The doctrinal errors or heresies required the meeting of two Ecumenical Councils, which made teaching to be in line with the text of Holy Scripture and with the teaching of Christ the Savior. Thus, the Councils of Ephesus and Chalcedon were able to raise matters of dogma and doctrine. At the same time, they were concerned about canonical rules, which regulated the discipline and order of the Church. The Third and the Fourth Ecumenical Councils decisions contributed to the good of the Church, to bring peace and understanding in the life of Christians and within nations. In addition to the Ecumenical Councils, the local council of Carthage and the writings of Theophilus of Alexandria and St. Cyril of Alexandria, showed the homogeneity of the Fifth Century patristic thought, stemming from work and the care of the Holy Spirit invoked at the beginning of each Synod. Forming a closer analysis of the material presented, the Church has managed to settle doctrinal and organizational life on a normal path and to evolve through its believers. However, it was not protected from internal turmoil, completed in 1054 with the schism between West and East and from the fights, and heresies. Also, the Arab Muslims attack shook it from exterior. Nevertheless, it emerged stronger, and this was not because of its authority, which had a human origin, but because of the High Priest Christ and the Holy Spirit’s blessing.

  18. Législation canonique, œcuménique, du V-e siècle

    OpenAIRE

    Ghenadie Serban

    2009-01-01

    The Fifth Century has been affected by internal and external struggles. The great Roman Empire began to fall apart. Since the Fourth Century, the center of gravity was moving from Rome to Constantinople. The Church was never safe from turmoil. The doctrinal errors or heresies required the meeting of two Ecumenical Councils, which made teaching to be in line with the text of Holy Scripture and with the teaching of Christ the Savior. Thus, the Councils of Ephesus and Chalcedon were able to rais...

  19. Studies of absorption coefficient cum electro-optic performance of polymer dispersed liquid crystal doped with CNT and dichroic dye

    Science.gov (United States)

    Sharma, Vandna; Kumar, Pankaj

    2017-11-01

    Absorption coefficient of doped polymer dispersed liquid crystals (PDLCs) is a critical factor for their device performance and depends on dopants parameters like solubility, order parameter and extinction coefficients, in addition to configuration and orientation of the droplets. In this study, a fixed amount (0.125% wt/wt) of multiwall carbon nanotubes (CNTs) and orange azo dichroic dye was doped in PDLC and measured the OFF state absorption coefficient. Considering the theory based on Beer's law and followed by extinction coefficients of CNT and dye, the OFF state transmission for dye doped PDLC was found lower compared to CNT doped PDLC. As a result, absorption coefficient for dye doped PDLC was higher and resulted in the superior contrast ratio. The experimental results were found be consistent with the theoretical results.

  20. A framework for evaluating the performance of automated teller machine in banking industries: A queuing model-cum-TOPSIS approach

    Directory of Open Access Journals (Sweden)

    Christopher Osita Anyaeche

    2018-04-01

    Full Text Available The improvement in the provision of banking services to customers enhances bank’s performance (profitability and productivity and the amounts of dividend declared to shareholders as well as bank’s competitiveness. One means of fast tracking the service time for bank customers is through the use of self-servicing machines, such as automated teller machine (ATM. Total service cost, expected waiting time in queue, ATM utilization and percentage of customer loss are some of the performance indices that are used to evaluate the service rendered by a bank’s ATM. This study proposes a framework for evaluating the performance of ATM by integrating queuing model and Technique for Order of Preference by Similarity to Ideal Solution (TOPSIS methodology. Applicability of the framework was tested using practical data obtained from four banks in Nigeria. It was observed that the average ATM usage in the study area was less than 50%. The TOPSIS results identified Bank A as the best ranked bank. In addition, the results obtained revealed that banks with two ATM were ranked higher than banks with more than two ATM

  1. Tenuitas cum bona fama : éthique et architecture dans le De architectura de Vitruve

    Directory of Open Access Journals (Sweden)

    Mireille Courrént

    2011-05-01

    Full Text Available La question du rôle de l’éthique dans la pratique de l’architecte fait, depuis quelques années, l’objet de nombreux débats, techniques, politiques et sociaux, nés à la fois de la place dévolue à l’architecte dans le processus de mise en forme de l’espace urbain et de la complexification constante de ses relations avec les commanditaires. Ces débats reposent sur trois notions fondamentales, incessamment convoquées : la déontologie, la responsabilité et l’esthétique. Par leur ancrage dans la co...

  2. Exactly-solvable generalization of the Jaynes-Cummings model and its application to atom-molecule systems

    Energy Technology Data Exchange (ETDEWEB)

    Pittel, S. [Bartol Research Institute, University of Delaware, Newark, Delaware 19716 (United States); Dukelsky, J. [Instituto de Estructura de la Materia, Consejo Superior de Investigaciones Cientificas, Serrano 123, 28006 Madrid (Spain); Dussel, G.G. [Departamento de Fisica Juan Jose Giambiagi, Universidad de Buenos Aires, 1428 Buenos Aires (Argentina)

    2004-12-01

    We present a family of exactly-solvable models involving the interaction of an ensemble of coupled SU(2) or SU(1,1) systems with a single bosonic field. They arise from the trigonometric Richardson-Gaudin models by replacing one SU(2) or SU(1,1) degree of freedom by an ideal boson. A first application to a system of bosonic atoms and a molecule dimer is reported. (Author) 14 refs., 3 figs.

  3. Sea level and currents in the upper reaches of the Cochin estuarine system during October 2000

    Digital Repository Service at National Institute of Oceanography (India)

    Srinivas, K.; Revichandran, C.; Asharaf, T.T.M.; Thottam, T.J.; Maheswaran, P.A.; Murukesh, N.

    Sciences Vol. 33(2), June 2004, pp 155-163 Sea level and currents in the upper reaches of the Cochin estuarine system during October 2000 K. Srinivas * , C. Revichandran, T.T. Mohamed Asharaf, T.J. Thottam, P.A. Maheswaran & Nuncio Murukesh... C, Maheswaran P A, Mohamed Asharaf T T & Nuncio M, Propagation of tides in the Cochin estuarine system, southwest coast of India, Indian J. Mar. Sci., 32 (2003) 14-24. 5 Joseph J & Kurup P G, Stratification and salinity distribution in Cochin...

  4. Phytochemical investigation of Crataegi folium cum flos (hawthorn leaves and flowers and Hyperici herba (st johns wort aerial parts hydroalcoholic extracts

    Directory of Open Access Journals (Sweden)

    Ruxandra Cretu

    2011-12-01

    Full Text Available Hawthorn (Crataegus monogyna hydroalcoholic extract was prepared by extraction of powdered dried leaves and flowers with ethanol 70% v/v (1:10, by reflux for two hours. St Johns Wort (Hypericum perforatum hydroalcoholic extract was prepared by extraction of powdered dried flowering aerial parts with ethanol 70% v/v (1:10, by reflux for two hours. Both extracts were qualitative and quantitative analyzed. The qualitative analysis consisted in phytochemical screening and spectroanalytical profile by HPTLC and UV/VIS absorption spectroscopy. Quantitative analyses consisted in determination of total flavonoid content (as rutin by following colorimetric aluminum chloride method, and total polyphenol content (as gallic acid by Folin- Ciocalteu method. Results were evaluated statistically and presented as mean of three determinations ± SD (standard deviation. These analyses revealed their complex composition and either some similarities and differences between these two extracts.

  5. Theoria cum praxi: la vuelta a la complejidad (Apuntes para una filosofía práctica desde el perspectivismo leibniziano

    Directory of Open Access Journals (Sweden)

    Roldán, Concha

    1997-11-01

    Full Text Available Not available

    Este trabajo trata de elaborar una hipótesis sobre el papel de Leibniz en la formación de las grandes categorías de la filosofía práctica moderna, poniendo de relieve una idea de racionalidad «hermenéutica» o «imperfecta» que, partiendo del concepto leibniziano de perspectivismo, constaría de tres grandes vertientes que aquí se denominan (de acuerdo con el espíritu de la metodología de Leibniz «principios»: de contingencia, autonomía y tolerancia. Lo que a Leibniz le interesa es asegurar una libertad autodeterminista de cuño rigurosamente moderno, subrayando que el universo de la praxis humana está presidido por el [actum de lo contingente o de «aquello que puede ser de otra manera». Desde su concepto de individuación no se enfatiza la autonomía racional de un yo desencarnado ni mucho menos de un «autómata previsible», sino la consciencia de una subjetividad autodiferenciada que se propone a sí misma hipótesis viables para salvar la coherencia de sus acciones. El espíritu de tolerancia constituye la conclusión ética de las dos premisas anteriores: la idea general de justicia sólo es asequible desde el peculiar punto de vista de la place d'autruy, que viene a constituir el fundamento de aquélla

  6. Külaskäik Kimbelli kunstimuuseumisse = A Visit to the Kimbell Art Museum / Patricia Cummings Loud ; tõlk. Ingrid Ruudi

    Index Scriptorium Estoniae

    Loud, Patricia Cummings

    2007-01-01

    Kimbelli kunstimuuseumi arhitektuurikuraator Patricia C. Loud Lous I. Kahni projekteeritud Kimbelli kunstimuuseumist Fort Worthis Texases (ehitatud 1966-1972), muuseumi külastajatest. Maastikuarhitekt George Patton. 1998. a. tunnustas Ameerika Arhitektuuriinstituut Kimbelli muuseumihoonet Kahekümne Viie Aasta auhinnaga, nimetatud sama auhinna saanud teised neli L. I. Kahni projekteeritud hoonet. Ill. lõige, sisevaade, värv. välisvaade

  7. "Quid puellae cum armis?" Una aproximación a Doña Beatriz Bernal y a su cristalián de España

    OpenAIRE

    Gagliardi, Donatella

    2003-01-01

    Consultable des del TDX Títol obtingut de la portada digitalitzada El Don Cristalián de España, publicado en Valladolid en 1545 por Juan de Villaquirán, no se cuenta entre los libros de caballerías de mayor éxito comercial (sólo fue reeditado una vez, más de cuarenta años después), pero destaca entre las demás obras de este género literario por haber salido de la pluma de una mujer, doña Beatriz Bernal, por lo que resulta aún más sorprendente que la novela no haya merecido hasta hoy tod...

  8. ASİDİK YAGIŞLARIN TRİTİCUM VULGARE ( BUGDAY ve ZEA • • • • • MA YS SACCHARA TA (MISIR BITKILERINE ETKILERI

    Directory of Open Access Journals (Sweden)

    NEVİN YALÇIN

    1999-12-01

    Full Text Available Bu çalışmada, asidik yağışların Triticum Vulgare (Buğday ve Zea Mays Saccbarata ( Mısır bitkile rine et ki leri incel enmiştir. Bu a1naçla, 24 adet 20x20x30 cn1 boyutundaki teneke saksı lara ekilen tohumlar pH 1 � 2, 3, 4. 5, 6 olan HN03 ve H2S04 ç özel til e ri ile bir ay bo yunc a sulanmışlar dır.T. Vulgar e ve Z.M. Saccharata yap r a k lar ı n d a k loroz i s (sa r arma ve flecking (benekleşme görülmüştür.Büyüme, 15. g ünde n sonra durınuştur. pH s ı düşük olan çö zel t i l er ile sulanan bitkilerde boyca enge llennıe görülmüş, çürüme daha önce b aş ! an1ış tı r . Ayrıca as i di k çöz elti lerl e sulamanın tohum çim l e n m es i ni gec i ktirdi ğ i gözlenıniştir. Biyomas değ e r lerinde de k ayıpla r kaydedilıniştir. Düşük pH derecelerinde ka yıp l arı n daha fazla olduğu b eli r le nnı i ş t ir. Her iki bit k inin kök ve gövdelerinin anatemisinde bir bozulına görülmeıniştir. ABSTRACT In this study, the effects of acid rains on Triticum Vu l g a re (\\Vheat and Zea Mays Saccharata (Com were investigated. For this purpose, seeds were sowed to 24 tin pots at diı n ensions of 20x20x30 cm and they were vvatered with HN03 and H2S04 solutions which to be pH L 2, 3, 4, 5, 6 for o ne month. T.Vulgare and Z.M. Saccharata leavcs showed chlorosis and flecking. The growing stopped after 15 days. At solutions with low pH, p I ant l e ngt h s w ere n1easured shorter and rotting w as begun earlier than otlıers. It also inhibited seed gennination by de lay ing the same. The bi o mass values alsa s h owe d a loss and this was the h i g hest at the low pH degree s . The root and stern defo rmat i ons in each the two s p c ci es were not seemed . I. GİRİŞ Atmosferin kirl errmesi sonucu rneydana gelen asit yağmurlar1 veya asit ç ö k e J n 1 es i sanayinin, termik santr allerin , ulaşun araçlan n ın ve fosil yakıtların yaydığı SOx , kükürt oksit ve NOx , azot oksit gazlar ı ndan kaynaklanmaktadır. Havada bul u nan metal l er ve k a rb on; kükürt oksi tleri ni sülfat iyonuna ' so4'- , a zot oks itl erini nitrat iyonuna , N03- . oksitleınektedir. Meydana gelen bu iyonlar, atmo sfe rdeki H katyon u ile bi rleşerek H2S04 ve HN03 asıtlerini olu ş t ururlar [ 1, 2]. SO� ve NOx gazlarının asitlere dönüşerek bulutlardaki su daınlacıklarında ve yağmur dam lalarında adsorbe edilmeleri ile asit yağınuru oluşu r . Buna yaş ç ö k e l ı n e (w et depositian denilmektedir [3 j. Aınerika Birleşik Devletlerinin doğu kesiminde y a ş çö kel m e n in y akla ş ık % 65 i nin H2S04, % 30 unun HN03 ve geri kalanının diğer asit lerden oluştuğu belirlenıniştir [ 4. A d ap azı rı

  9. EXIGENŢE ALE STATULUI DE DREPT AŞA CUM REIES DIN CONSTITUŢIILE UNOR STATE MEMBRE ALE UNIUNII EUROPENE

    Directory of Open Access Journals (Sweden)

    Crina Mihaela Verga

    2006-05-01

    Full Text Available Fondée en Allemagne à la fin de XIX e siècle sur les idées de Kant concernant “la société civile”, société dans laquelle on assure les droits naturels de l’individu, l’idée de l’Ētat de droit est reprise après la deuxième guerre mondiale, inscrite dans certaines constitutions et transformée en un critérium fondamental de la démocratie dans les documents internationales. La recherche énonce et analyse les exigences qui s’imposent pour pouvoir parler de l’existence de l’Ētat de droit, telles comme elles résultent tant des dispositions constitutionnelles de quelques Etats de l’Union Européenne que de leur pratique politique. Il est nécessaire que tout Ētat qui se respecte et qui désire d’adhérer aux structures internationales ait en vue l’inclusion dans la constitution et la réalisation effective des exigences d’un Ētat de droit véritable.

  10. An Alternative Ratio-Cum-Product Estimator of Finite Population Mean Using Coefficient of Kurtosis of Two Auxiliary Variates in Two-Phase Sampling

    Directory of Open Access Journals (Sweden)

    Balkishan Sharma

    2014-10-01

    Full Text Available Normal 0 MicrosoftInternetExplorer4 This paper deals with the problem of estimation of population mean in two-phase sampling. A ratio-product estimator of population mean using known coefficient of kurtosis of two auxiliary variates has been proposed. In fact, it is a two-phase sampling version of Tailor et al. (2010 estimator and its properties are studied. Proposed estimator has been compared with usual unbiased estimator, classical ratio and product estimator in two-phase sampling, and two-phase sampling versions of Singh (1967 and Singh et al. (2004 estimators respectively. To judge the merits of the proposed estimator over other estimators an empirical study is also carried out. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman";}

  11. La batalla eclesial por Madrid (1923-1936. Los conflictos entre Eijo Garay y Federico Tedeschini

    Directory of Open Access Journals (Sweden)

    Rodríguez Lago, José Ramón

    2012-07-01

    Full Text Available The relationships between the leaders of the Catholic hierarchy are determined by their own theological cosmovisions and their different pastoral strategies, but also by the ambitions of power and the expectations of promotion in the “cursus honorum”. The conflicts that took place from 1923 to 1936 between the apostolic nuncio in Spain, Federico Tedeschini, and the bishop of Madrid, Leopoldo Eijo Garay, are an excellent example of these intricate relationships.Las relaciones entre los dirigentes de la jerarquía católica se ven condicionadas por sus propias cosmovisiones teológicas y sus diferentes estrategias pastorales, pero también por las ambiciones de poder y las expectativas de promoción en el “cursus honorum”. Los conflictos suscitados de 1922 a 1936 entre el Nuncio Pontificio en España, Federico Tedeschini, y el Obispo de Madrid, Leopoldo Eijo Garay, son una excelente prueba de ello.

  12. Teologia, ordini religiosi e rapporti politici: la questione dell’Immacolata Concezione di Maria tra Roma e Madrid (1614-1663

    Directory of Open Access Journals (Sweden)

    Broggio, Paolo

    2013-06-01

    Full Text Available The article analyses the first moments of the doctrinal controversy about the dogmatic definition of the Immaculate Conception of Mary form the point of view of the relationships, managed by nuncio Antonio Caetani, between the Holy See and the Spanish Monarchy. Through the correspondence between the nuncio and the Roman Curia it is possible to appreciate Papacy’s will to avoid public “scandals” and to look for a mediation among conflicting religious orders (Dominicans, Franciscans and Jesuits. The controversy represented for the Spanish Monarchy of Philip III (and, later, of Philip IV a further occasion to affirm its right of intervention in doctrinal and ecclesiastical matters on the basis of its prerogative to defend the Roman Church.El artículo analiza los primeros años de las polémicas doctrinales alrededor de la definición dogmática de la Inmaculada Concepción de la Virgen desde el punto de vista de las relaciones entre la Santa Sede y la Monarquía española, gestionadas por el nuncio Antonio Caetani. Sobre la base de la correspondencia epistolar del nuncio con la Curia romana se evidencia la voluntad, por parte de Roma, de evitar los “escándalos” de los alborotos populares y de buscar una mediación entre las órdenes religiosas en lucha (dominicos, franciscanos y jesuitas. Estas polémicas fueron una ocasión más, para la Monarquía hispana de Felipe III (y luego de Felipe IV, para afirmar su propio derecho de intervención en asuntos doctrinales y eclesiásticos en virtud de su prerogativa de defensa de la Iglesia de Roma.

  13. Project on Training of Non-Formal Education Personnel: National Workshops in Bhutan, Nepal, and India cum Study Visits Undertaken by Teams of China, Lao PDR and Viet Nam (June 17-July 5, 1998) (APPEAL).

    Science.gov (United States)

    United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.

    This report is a summary of study visits plus workshops that took place in Bhutan, Nepal, and India in 1998 within the framework of UNESCO's Asia-Pacific Programme of Education for All (APPEAL). Three educators each from China, Lao PDR, and Vietnam and educators from the host countries participated. The project aimed to promote literacy and…

  14. Cum un edificiu realizat conform unui proiect-model a devenit monument de arhitectură (sau cu privire la autorul Catedralei Romano-Catolice din Chişinău

    Directory of Open Access Journals (Sweden)

    Yurchenko

    2017-10-01

    Full Text Available The paper considers the issue of authorship of Catholic church in Kishinev, which was built in 1838–1840. The author proves that brothers Josef and Louis Charlemagne contributed intimately to its building. She thinks that Catholic church in Kishinev was built by model project developed with the direct involvement of brothers Charlemagne. The hypothesis could be validated by a comparison between the model project developed by The Commission of projects and budget of Architectural Committee of The Department of State Economy and Public Buildings in Sankt-Petersburg, and the project of Catholic Church in Kishinev, which was approved by The Commission of The Department of Roads and Public Buildings in the same city on 18 of July, 1838. The careful consideration of the model project led us to conclude that that it is a close analogy to Kishinev’s temple. The identity of these two projects confirms our suggestion about the origin of Kishinev Catholic Church’s image. However, this conclusion does not belittle the architectural value of the temple. The Catholic Church presents a bright example of pure classic architectural tradition which kept on to be a very important part of Kishinev’s architectural style. That’s why the Catholic Church of Kishinev is an architectural monument of the national interest of the Republic of Moldova.

  15. ‘Mr Cummings clearly does not understand the science of genetics and should maybe go back to school on the subject’: an exploratory content analysis of the online comments beneath a controversial news story

    National Research Council Canada - National Science Library

    Crosswaite, Madeline; Asbury, Kathryn

    2016-01-01

    ...’ controversial suggestions and ideas. We conducted a content analysis of n = 800 reader comments, coding them on the basis of level of agreement with the ideas and opinions expressed in the article...

  16. [Policy recommendations based on SWOT analysis for agricultural industrialization of traditional Chinese medicinal materials--a case study of uncariae ramulus cum uncis from Jianhe county in Guizhou province].

    Science.gov (United States)

    Hu, Yong; Huo, Ke-Yi; Xiang, Hua

    2013-09-01

    This thesis reviews the historical background of agricultural industrialization, and analyzes the major theories of agricultural industrialization. It also utilizes SWOT analysis method to discuss the industrialization of traditional Chinese medicinal materials in Jianhe county, and finally it puts forward the recommendations for its further development.

  17. «Cum omnibus eorum cautelis, libris et scripturis». Charters of submission, accounts, statements and information networks in the dissolution of the Principality of Taranto (June 23, 1464 - February 20, 1465

    Directory of Open Access Journals (Sweden)

    Anna Airò

    2008-12-01

    Full Text Available The essay focuses on the system of current public records used in the principality of Taranto during the Orsini rule (first half of the 15th century. The research does not work directly on the surviving accounts or the legislative sources, but is based on the analysis of a peculiar source, produced in the crucial moment of the devolution of the principality to the crown after the death of the last prince of Taranto, Giovanni Antonio del Balzo Orsini (1463. In the late spring 1464 king Ferrante sent to the Salento an équipe of razionali of the Sommaria (the central financial office of the kingdom to analyze and register all the practices and the passages of the devolution of the Tarentine principality through the inspection of the existing account books, in order to take control of the patrimonial, jurisdictional and financial resources of the principality. This operation produced a considerable amount of letters written by the razionali in a couple of months: these sources are the result of the interaction between the Neapolitan officers and the local political powers of the vanished principality, and allow us to get concretely and day by day into the inner mechanism of production and functioning of a whole documentary system. This system, when in use, offered an articulated map of the territory and its resources through the sophisticated elaboration of a multiple-level complex of accounts, inventories, local and central archives. At the same time, it elaborated what we can call a real, huge data-base both of men, places, revenues and of written records.

  18. Nutritive value and biochemical changes in broiler chickens fed ...

    African Journals Online (AJOL)

    There were 10 dietary treatments: a control diet, void of castor bean cake (CBC), 3 diets (at 10, 15 and 20%) each containing either heat cum lye treated CBC, heat cum 5-day fermentation or heat cum 7-day fermentation in a completely randomized design. The chemical constituent of detoxified castor kernel, performance, ...

  19. Role of mesoscale eddies on the variability of biogenic flux in the northern and central Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Vidya, P.J.; PrasannaKumar, S.

    in the NBBT and CBBT matched well with the reported life span of cyclonic eddies in the BoB [Chen et al., 2012; Cheng et al., 2013]. Hence, we examined the role of mesoscale eddies in the above observed variability. 3.3 Eddy identification Mesoscale... periods at NBBT and CBBT. However, we focus our attention to only cyclonic eddy as they can enhance the biological production in the BoB through eddy-pumping of nutrients [Prasanna Kumar et al., 2007; Muraleedharan et al., 2007; Nuncio, 2007; Kurien et...

  20. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cum USDA ... 110] ... Length = 120 ... Query: 354 RIAESRFHRIAMSLGDGLVCTDEDHRITVWNPGASVIFGYMPAEIIGRPFDTLCA...VPTDG 413 ... RIAESRFHRIAMSLGDGLVCTDEDHRITVWNPGASVIFGYMPAEIIGRPFDTLCA...VPTDG Sbjct: 1 ... RIAESRFHRIAMSLGDGLVCTDEDHRITVWNPGASVIFGYMPAEIIGRPFDTLCAVPTDG 60 ...

  1. Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835

    Directory of Open Access Journals (Sweden)

    María José Vilar García

    2016-12-01

    Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.

  2. Human-Centered Command and Control of Future Autonomous Systems

    Science.gov (United States)

    2013-06-01

    Drury & Scott, 2008; Nehme, Scott, Cummings, & Furusho, 2006; Scott & Cummings, 2006). However, there have not been detailed prescriptive task...21 Drury , J. L., & Scott, S. D. (2008). Awareness in unmanned aerial vehicle operations. The International C2 Journal, 2, 1-10. Errington, J

  3. Acoustic Neuroma Educational Video

    Medline Plus

    Full Text Available ... Neuroma Association 600 Peachtree Parkway Suite 108 Cumming, GA 30041 770-205-8211 info@ANAUSA.org The ... Neuroma Association 600 Peachtree Parkway Suite 108 Cumming, GA 30041 770-205-8211 info@ANAUSA.org About ...

  4. The translation of Cummings’ work and the constructon of a domestic/Brazilian canon: a case study regarding Augusto de Campos’s translation project

    Directory of Open Access Journals (Sweden)

    Juliana Cristina Salvadori

    2016-01-01

    choices made by Augusto de Campos, thus, privilege, as he acknowledges, Cummings’s most innovative traits (and poems, that is, the formal aspects, obliterating the lyrical aspects of Cummings and building a domestic/ Brazilian canon for Cummings.

  5. Acoustic Neuroma Educational Video

    Medline Plus

    Full Text Available Acoustic Neuroma Association 600 Peachtree Parkway Suite 108 Cumming, GA 30041 770-205-8211 info@ANAUSA.org The world's #1 acoustic ... Shop ANA Leadership & Staff Annual Reports Acoustic Neuroma Association 600 Peachtree Parkway Suite 108 Cumming, GA 30041 ...

  6. Institution's Title and Shibboleth: A Construct of Grammatical Relationship in Advertising Plates

    Science.gov (United States)

    Dalamu, Taofeek

    2017-01-01

    Institutions are known through the names-cum-titles shown on their signboards, internet websites, letterheads, etc. However, it seems that such cultures could not satisfy the yearning of most organizations. So, they further propagate their core values and traits by constructing short linguistic bursts-cum-contents that can expatiate on what the…

  7. Los campesinos al servicio del señor, según los fueros locales burgaleses de los siglos XI-XIII = Peasants in the Service of the Lord according to Municipal Charters of Burgos from the Eleventh to the Thirteenth Century

    Directory of Open Access Journals (Sweden)

    Luis Martínez García

    2016-06-01

    Full Text Available En el presente trabajo se aborda la naturaleza y el alcance de los servicios debidos por los campesinos dependientes a sus respectivos señores, prestando especial atención a la renta señorial como parte integrante de la renta feudal. Para ello se cuenta con una serie de 50 fueros locales de los siglos XI al XIII pertenecientes a la actual provincia de Burgos. Por tratarse del marco legal en el que se desarrolló la vida laboral y social del campesinado, cada fuero en su localidad fijaba por escrito los servicios más comunes e importantes, entre otros, las infurciones, sernas, nuncios, mañerías, posada y yantar, así como otras formas distintas del servitium que convirtieron la dependencia campesina en un estado de vida permanente.In this paper we examine the nature and scope of the services owed by dependent peasants to their lords, with particular reference to lordship rents. We will examine a series of fifty municipal charters (fueros, consisting of all the extant records dating from the eleventh to the thirteenth centuries from the province of Burgos. As these charters detail the legal framework in which the peasantry’s economic and social life took place, each charter prescribed the most common and significant duties owed in their respective jurisdiction among which we find the following: infurción, serna, nuncio, mañería, posada and yantar, as well as other forms of servitium which transformed the peasantry’s state of dependency into a permanent way of life.

  8. La Diplomacia Española y la Papal en la Corte Imperial de Fernando II

    Directory of Open Access Journals (Sweden)

    Pavel MAREK

    2009-10-01

    Full Text Available RESUMEN: El presente trabajo aborda el estudio de las facciones cortesanas y los grupos de poder en la época del emperador Fernando II de Habsburgo, describiendo la influencia de España y de la Santa Sede en la creación de diferentes grupos de poder y corrientes políticas en la corte vienesa y praguense. El estudio utiliza como fuente principal las relaciones que enviaban los embajadores españoles y los nuncios papales, gracias a las cuales es posible averiguar las actitudes que ambas potencias católicas tomaban con respecto a los acontecimientos que sucedían en la Europa Central durante el primer tercio del siglo XVII, e identificar los grupos de personas que les ayudaban a realizar sus fines políticos en el periodo convulso del comienzo de la Guerra de los Treinta Años.ABSTRACT: The present study undertakes the revision of the court factions and power elites at the time of the emperor Ferndinand the II of Hapsburg, describing the influence of Spain and the Holy See in the creation of different faction and political groups in Vienna and Praghe Courts. The study uses like main source the relations that the Spanish ambassadors and the papal nuncios sent, thanks to which it is possible to find out the attitudes that both catholic powers took with respect to the events who happened in Central Europe during the first third of century XVII, and to identify the groups of people who helped them to make their political aims in the beginning of the Thirty Years War.

  9. Changes in tau phosphorylation levels in the hippocampus and frontal cortex following chronic stress

    Energy Technology Data Exchange (ETDEWEB)

    Yang, C.; Guo, X. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wang, G.H. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wuhan University, Institute of Neuropsychiatry, Wuhan, China, Institute of Neuropsychiatry, Wuhan University, Wuhan (China); Wang, H.L.; Liu, Z.C.; Liu, H.; Zhu, Z.X.; Li, Y. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China)

    2014-03-03

    Studies have indicated that early-life or early-onset depression is associated with a 2- to 4-fold increased risk of developing Alzheimers disease (AD). In AD, aggregation of an abnormally phosphorylated form of the tau protein may be a key pathological event. Tau is known to play a major role in promoting microtubule assembly and stabilization, and in maintaining the normal morphology of neurons. Several studies have reported that stress may induce tau phosphorylation. The main aim of the present study was to investigate possible alterations in the tau protein in the hippocampus and frontal cortex of 32 male Sprague-Dawley rats exposed to chronic unpredictable mild stress (CUMS) and then re-exposed to CUMS to mimic depression and the recurrence of depression, respectively, in humans. We evaluated the effects of CUMS, fluoxetine, and CUMS re-exposure on tau and phospho-tau. Our results showed that a single exposure to CUMS caused a significant reduction in sucrose preference, indicating a state of anhedonia. The change in behavior was accompanied by specific alterations in phospho-tau protein levels, but fluoxetine treatment reversed the CUMS-induced impairments. Moreover, changes in sucrose preference and phospho-tau were more pronounced in rats re-exposed to CUMS than in those subjected to a single exposure. Our results suggest that changes in tau phosphorylation may contribute to the link between depression and AD.

  10. The antidepressant-like effect of Ocimum basilicum in an animal model of depression.

    Science.gov (United States)

    Ali, S S; Abd El Wahab, M G; Ayuob, N N; Suliaman, M

    2017-01-01

    We investigated the efficacy of Ocimum basilicum (OB) essential oils for treating depression related behavioral, biochemical and histopathological changes caused by exposure to chronic unpredictable mild stress (CUMS) in mice and to explore the mechanism underlying the pathology. Male albino mice were divided into four groups: controls; CUMS; CUMS plus fluoxetine, the antidepressant administered for pharmacological validation of OB; and CUMS plus OB. Behavioral tests included the forced swim test (FST), elevated plus-maze (EPM) and the open field test (OFT); these tests were performed at the end of the experiment. We assessed serum corticosterone level, protein, gene and immunoexpression of brain-derived neurotropic factor (BDNF) and glucocorticoid receptors (GRs) as well as immunoexpression of glial fibrillary acidic protein (GFAP), Ki67, caspase-3 in the hippocampus. CUMS caused depression in the mice as evidenced by prolonged immobility in the FST, prolonged time spent in the open arms during the EPM test and reduction of open field activity in the OFT. OB ameliorated the CUMS induced depressive status. OB significantly reduced the corticosterone level and up-regulated protein and gene expressions of BDNF and GR. OB reduced CUMS induced hippocampal neuron atrophy and apoptosis, and increased the number of the astrocytes and new nerve cells. OB significantly increased GFAP-positive cells as well as BDNF and GR immunoexpression in the hippocampus.

  11. Relationship between Chlamydia – Mycoplasma – Ureaplasma genital detection and semen concentration and motility among Greek men.

    Directory of Open Access Journals (Sweden)

    Ageliki Gerovassili

    2017-03-01

    Full Text Available One hundred and seventy two men at the State of Thessaly, Greece, inquiring semen analysis were enrolled in the study in order to investigate the incidence of Chlamydia, Ureaplasma and Mycoplasma (C-U-M genera in respect to total sperm number (TSN, progressive motility (grades a and b and total motility (grades a, b and c. Putative relation of C-U-M acquirement with sexual behavior was also investigated. Incidence of C-U-M among non-oligozoospermic and oligozoospermic men was similar. Νο correlation of C-U-M carriage to either oligozoospermia or asthenozoospermia was found. The tested semen parameters were negatively correlated to the age of sexual intercourse initiation and positively correlated to the number of sex partners. Early age of sexual intercourse initiation or high number of sexual partners was not statistical significantly correlated to C-U-M acquirement. Overall, TSN and motility (either progressive or total were not influenced by the presence of C-U-M genera in a sample of Greek population undergoing semen evaluation. To distinguish the role of C-U-M in male infertility and clarify the so far controversial scarce literature, large control case studies are needed using nucleic acid amplification techniques to detect these pathogens.

  12. Relationship between Chlamydia – Mycoplasma – Ureaplasma genital detection and semen concentration and motility among Greek men.

    OpenAIRE

    Ageliki Gerovassili; Ourania Marcandona; Byron Asimakopoulos; Vasilis Karavasilis; Maria Panopoulou; Alexandros Ikonomidis

    2017-01-01

    One hundred and seventy two men at the State of Thessaly, Greece, inquiring semen analysis were enrolled in the study in order to investigate the incidence of Chlamydia, Ureaplasma and Mycoplasma (C-U-M) genera in respect to total sperm number (TSN), progressive motility (grades a and b) and total motility (grades a, b and c). Putative relation of C-U-M acquirement with sexual behavior was also investigated. Incidence of C-U-M among non-oligozoospermic and oligozoospermic men was similar. ?? ...

  13. LA CONDUITE D’EXPOSÉS EN ANGLAIS OU LE MOYEN DE FAVORISER LA PRISE DE PAROLE EN LV2 / ORAL PRESENTATIONS IN UNIVERSITY CLASSES AS A MEANS TO FOSTER PERSONAL EXPRESSION IN A FOREIGN LANGUAGE SUCH AS ENGLISH / PREZENTĂRILE ORALE DIN CADRUL CURSURILOR UNIVERSITARE CA MODALITATE DE A ÎNCURAJA EXPRIMAREA PERSONALĂ ÎNTR-O LIMBĂ STRĂINĂ CUM AR FI ENGLEZA

    Directory of Open Access Journals (Sweden)

    Sophie Dufossé

    2014-11-01

    Full Text Available Quelles sont les activités facilement utilisables en TD d’anglais propices à l’expression orale en continu à l’université aujourd’hui ? Dans cette fiche pédagogique, nous nous proposons d’expliquer comment la mise en place et l’exploitation d’un exercice de type « exposé » peut, malgré un côté parfois « daté », encourager les étudiants de Licence inscrits en première année de Lettres Modernes à l’université de Dunkerque à prendre la parole en continu et, par là même, se préparer à la certification en langues exigée pour valider leur diplôme

  14. Mapping Change Management: A Co-citation Analysis

    Science.gov (United States)

    2007-03-01

    of change (Beer and Nohria, 2000) Creating futures: leading change through information systems (Kakabadse and Kakabadse, 2000) Intelligent ...Ivancevich (University of Houston) jivance@uh.edu Alan Glassman (Cal State Northridge) aglassman@csun.edu Tom Cumming (USC) tcummings

  15. Status and prospects of fish farming in Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.; Verlecar, X.N.

    -cum-prawn culture. Relevant information on the indigenous methods of cultivating common species, their annual yield and economics of aquaculture are discussed in the paper with reference to future prospects of fish farming in Goa...

  16. Ramon Rask võitleb põhimõtte pärast / Marian Männi

    Index Scriptorium Estoniae

    Männi, Marian

    2007-01-01

    Portreelugu Tartu Ülikooli õigusteaduskonna cum laude lõpetanud Ramon Raskist, tema kohtuvõitlusest ülikooliga; professionaalse tasuta õigusabi võimalustest tudengitele Paul Varuli advokaadibüroo poolt Eesti Üliõpilasliidu juures

  17. Sámuel Gyarmathi "Affinitas" 200-aastane : Vinnugor Világ, 1999, nr 4 / Gábor Zaicz ; refereerinud Kadi Raudalainen

    Index Scriptorium Estoniae

    Zaicz, Gábor

    2000-01-01

    Ungari arstiteadlase Sámuel Gyamathi ladinakeelsest uurimusest "Affinitas linguae Hungaricae cum linguis Fennicae originis grammaticae demonstrata" ("Grammatiline tõestus ungari keele ja soome päritolu keelte suguluse kohta")

  18. Critical Thinking, Community Elders and Africa's Development

    National Research Council Canada - National Science Library

    Ukhun, C E

    2009-01-01

    ... clichés and traditional modes of analysis of the challenge of Africa's development, we highlight an unarticulated factor of development - 'critical- cum- creative thinking', which has been vitiated by elders (male-elders...

  19. Extension of the excitation functions of deuteron induced reactions on {sup nat}Sn up to 50 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Laboratory, Vrije Universiteit Brussel, B1050 Brussels (Belgium); Tárkányi, F.; Ditrói, F.; Takács, S. [Institute of Nuclear Research of the Hungarian Academy of Sciences, H4026 Debrecen (Hungary)

    2017-01-15

    Using the stacked-foil activation technique, cross-sections of deuteron induced reactions on natural Sn targets were determined up to 50 MeV. Excitation functions are reported for the product nuclides {sup 116m}Sb, {sup 117}Sb, {sup 118m}Sb, {sup 120m}Sb {sup 122m+g}Sb, {sup 124m+g}Sb, {sup 110}Sn(cum), {sup 113m+g}Sn(cum), {sup 117m}Sn, {sup 110m}In(cum), {sup 110g}In, {sup 111m+g}In(cum), {sup 113m}In, {sup 114m}In {sup 115m}In. Comparison with earlier published data at lower energy is discussed. For all excitation functions a theoretical calculation using the TALYS 1.6 (on-line TENDL-2015 library) code is shown.

  20. 76 FR 2837 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2011-01-18

    ..., Suite 210, Cumming, GA 30040. Georgia: Lamar City of Barnesville August 24, 2010, The Honorable Peter... October 8, 2010, Mr. Steve White, Chairman, Feb. 14, 2011........ 495517 of Utah County (10- October 15...

  1. Can the Dutch way of birth teach us to do health care reform better?

    NARCIS (Netherlands)

    DeVries, R.

    2003-01-01

    The frustration we americans feel with our health care system has boiled over into a Holywood film cum exposé of the injustice, the maldistribution, and the inefficiencies that attend medical care in the United States. (aut. ref.)

  2. 75 FR 29208 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2010-05-25

    ... Cherokee Street, Marietta, GA 30090. Forsyth City of Cumming (09- December 30, 2009, The Honorable Henry Ford May 6, 2010 130236 04-5443P). January 6, 2010, Gravitt, Mayor, City of Forsyth County News...

  3. Synopsis Hymenophyllacearum, Monographiae Hujus Ordinjs Prodromus, auctore R. B. van den Bosch M. D. mit zahlreichen Zusätzen und Abbildungen aus dem Nachlass des Verfassers neu herausgegeben

    NARCIS (Netherlands)

    Goddijn, W.A.

    1913-01-01

    Frons simplex e cellularum consimilium stratis quatuor contexta, costa nulla, venae e basi radiantes furcatae, steriles ante marginem apice incrassato desinentes, fertiles cum vena secundaria marginali confluentes, sori terminales trichomanei, receptaculum crassum aequale teres parumper exsertum. 1.

  4. Acoustic Neuroma Educational Video

    Medline Plus

    Full Text Available ... Suite 108 Cumming, GA 30041 770-205-8211 info@ANAUSA.org The world's #1 acoustic neuroma resource ... List Member Portal Webinar Library Newsletter Library Patient Info Booklets Member Login Research ANA Survey/Registry AN ...

  5. Marine information technology - Indian Ocean scenario

    Digital Repository Service at National Institute of Oceanography (India)

    Nayak, M.R.; Gouveia, A.D.; Navelkar, G.S.; Singh, K.

    the state of art and the need for the establishment of compatible means of high quality data collection, and exchange of marine information related to the Indian Ocean area. Oceanographic data visualisation-cum-analysis based sustainable decision making...

  6. De Papyro Oxyrhynchita 1380

    NARCIS (Netherlands)

    Groningen, Bernhardus Abrahamus van

    1921-01-01

    2. Optimo iure [griekse letters] urbem Memphim esse putant editores, cum Aegyptiace vocetur Ht-K'-Pth, i. e. domus animae dei Ptah, etiam in textibus qui non in ipsa illa urbe conscripta sunt. Zie: Pars Prior

  7. Extension of the excitation functions of deuteron induced reactions on natSn up to 50 MeV

    Science.gov (United States)

    Hermanne, A.; Tárkányi, F.; Ditrói, F.; Takács, S.

    2017-01-01

    Using the stacked-foil activation technique, cross-sections of deuteron induced reactions on natural Sn targets were determined up to 50 MeV. Excitation functions are reported for the product nuclides 116mSb, 117Sb, 118mSb, 120mSb 122m+gSb, 124m+gSb, 110Sn(cum), 113m+gSn(cum), 117mSn, 110mIn(cum), 110gIn, 111m+gIn(cum), 113mIn, 114mIn 115mIn. Comparison with earlier published data at lower energy is discussed. For all excitation functions a theoretical calculation using the TALYS 1.6 (on-line TENDL-2015 library) code is shown.

  8. Plaadid / Mirjam Tally

    Index Scriptorium Estoniae

    Tally, Mirjam, 1976-

    2003-01-01

    Uutest plaatidest "Mirjam Tally", Jennifer Love Hewitt "Barenaked", Sam "Being Under The Influence", Slade "Cum On Let's Party", The Dandy Warhols "Welcome To The Monkey House", Audio Bullys "Ego War"

  9. A Review of the Dodo and its Ecosystem: Interdisciplinary Research of a Vertebrate Concentration-Lagerstätte in Mauritius

    NARCIS (Netherlands)

    Rijsdijk, K.F.; Hume, J.P.; de Louw, P.G.B.; Meijer, H.J.M.; Janoo, A.; de Boer, E.J.; Steel, L.; de Vos, J.; van der Sluis, L.G.; Hooghiemstra, H.; Florens, F.B.V.; Baider, C.; Vernimmen, T.J.J.; Baas, P.; van Heteren, A.H.; Rupear, V.; Beebeejaun, G.; Grihault, A.; van der Plicht, J.; Besselink, M.; Lubeek, J.K.; Jansen, M.; Kluiving, S.J.; Hollund, H.; Shapiro, B.; Collins, M.; Buckley, M.; Jayasena, R.M.; Porch, N.; Floore, R.; Bunnik, F.; Biedlingmaier, A.; Leavitt, J.; Monfette, G.; Kimelblatt, A.; Floore, P.; Claessens, L.P.A.M.

    2016-01-01

    The dodo Raphus cucullatus Linnaeus, 1758 Linnaeus, C. 1758. Systema Naturae per Tegna Tria Naturae, Secundum Classes, Ordines, Genera, Species, cum Characteribus, Differentiis, Synonymis, Locis. Tenth Edition. Laurentii Salvii, Stockholm, 824 pp., an extinct and flightless, giant pigeon endemic to

  10. Monitoring effects of simulated disturbance at INDEX site: Current status and future activities

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, R.; Nath, B.N.; Valsangkar, A.B.; Khadge, N.H.; Parthiban, G.; Sankar, S.J.; Ansari, Z.A.; Ingole, B.S.; Raghukumar, C.; LokaBharathi, P.A.; Matondkar, S.G.P.; RameshBabu, V.; Murty, V.S.N.; Babu, M.T.; Sardar, A.

    During the Indian Deep-Sea Environment Experiment (INDEX), greater than 6000 cu.m of sediment was resuspended 5 m above seafloor. Data collected from deep-towed photography, sediment traps, sediment coring and CTD operations before and after...

  11. La Mystagogie de Saint Maxime le Confesseur

    Directory of Open Access Journals (Sweden)

    Florin Crismareanu

    2011-12-01

    Full Text Available Review of: Maximi Confessoris, Mystagogia: una cum Latina interpretatione Anastasii Bibliothecarii, edita a Christian Boudignon, Turnhout: Brepols, Corpus Christianorum. Series Graeca, nr. 69, 2011, 187 + 99 p.

  12. Microglial NLRP3 inflammasome activation mediates IL-1β-related inflammation in prefrontal cortex of depressive rats.

    Science.gov (United States)

    Pan, Ying; Chen, Xu-Yang; Zhang, Qing-Yu; Kong, Ling-Dong

    2014-10-01

    Depression is an inflammatory disorder. Pro-inflammatory cytokine interleukin-1 beta (IL-1β) may play a pivotal role in the central nervous system (CNS) inflammation of depression. Here, we investigated IL-1β alteration in serum, cerebrospinal fluid (CSF) and prefrontal cortex (PFC) of chronic unpredictable mild stress (CUMS)-exposed rats, a well-documented model of depression, and further explored the molecular mechanism by which CUMS procedure induced IL-1β-related CNS inflammation. We showed that 12-week CUMS procedure remarkably increased PFC IL-1β mRNA and protein levels in depressive-like behavior of rats, without significant alteration of serum and CSF IL-1β levels. We found that CUMS procedure significantly caused PFC nuclear factor kappa B (NF-κB) inflammatory pathway activation in rats. The intriguing finding in this study was the induced activation of nucleotide binding and oligomerization domain-like receptor family pyrin domain-containing 3 (NLRP3) inflammasome with the increased IL-1β maturation in PFC of CUMS rats, suggesting a new grade of regulatory mechanism for IL-1β-related CNS inflammation. Moreover, microglial activation and astrocytic function impairment were observed in PFC of CUMS rats. The increased co-location of NLRP3 and ionized calcium binding adaptor molecule 1 (Iba1) protein expression supported that microglia in glial cells was the primary contributor for CUMS-induced PFC NLRP3 inflammasome activation in rats. These alterations in CUMS rats were restored by chronic treatment of the antidepressant fluoxetine, indicating that fluoxetine-mediated rat PFC IL-1β reduction involves both transcriptional and post-transcriptional regulatory mechanisms. These findings provide in vivo evidence that microglial NLRP3 inflammasome activation is a mediator of IL-1β-related CNS inflammation during chronic stress, and suggest a new therapeutic target for the prevention and treatment of depression. Copyright © 2014 Elsevier Inc. All rights

  13. Predictive Value of Cumulative Blood Pressure for All-Cause Mortality and Cardiovascular Events

    Science.gov (United States)

    Wang, Yan Xiu; Song, Lu; Xing, Ai Jun; Gao, Ming; Zhao, Hai Yan; Li, Chun Hui; Zhao, Hua Ling; Chen, Shuo Hua; Lu, Cheng Zhi; Wu, Shou Ling

    2017-02-01

    The predictive value of cumulative blood pressure (BP) on all-cause mortality and cardiovascular and cerebrovascular events (CCE) has hardly been studied. In this prospective cohort study including 52,385 participants from the Kailuan Group who attended three medical examinations and without CCE, the impact of cumulative systolic BP (cumSBP) and cumulative diastolic BP (cumDBP) on all-cause mortality and CCEs was investigated. For the study population, the mean (standard deviation) age was 48.82 (11.77) years of which 40,141 (76.6%) were male. The follow-up for all-cause mortality and CCEs was 3.96 (0.48) and 2.98 (0.41) years, respectively. Multivariate Cox proportional hazards regression analysis showed that for every 10 mm Hg·year increase in cumSBP and 5 mm Hg·year increase in cumDBP, the hazard ratio for all-cause mortality were 1.013 (1.006, 1.021) and 1.012 (1.006, 1.018); for CCEs, 1.018 (1.010, 1.027) and 1.017 (1.010, 1.024); for stroke, 1.021 (1.011, 1.031) and 1.018 (1.010, 1.026); and for MI, 1.013 (0.996, 1.030) and 1.015 (1.000, 1.029). Using natural spline function analysis, cumSBP and cumDBP showed a J-curve relationship with CCEs; and a U-curve relationship with stroke (ischemic stroke and hemorrhagic stroke). Therefore, increases in cumSBP and cumDBP were predictive for all-cause mortality, CCEs, and stroke.

  14. Modeling Synergies in Large Human-Machine Networked Systems

    Science.gov (United States)

    2013-09-25

    or experimentation, and assist in the real-world implementation of multi-vehicle unmanned systems. A.S. Clare, J.C. Macbeth , and M.L. Cummings...between DES Model and Experiment for Pool Teams with No Search Guidance. Selected publications: Fei Gao, Andrew S. Clare, Jamie C. Macbeth , M. L...47-50, San Antonio, Texas, February, 2013. 55. Fei Gao, Andrew S. Clare, Jamie C. Macbeth , M. L. Cummings, “Modeling the Impact of Operator Trust on

  15. Organizations and Information Processing: A Field Study of Research and Development Units within the United States Air Force Systems Command.

    Science.gov (United States)

    1984-08-01

    uncertainty (Downey, Hellriegel and Slocum, 1975). DowTney and Slocum (1975) conceptualize uncertainty as a psychological state in which the sources of...Child, 1912; Osborn and Hunt, 1914; Downey, Hellriegel , and Slocum, 1975; Huber, O’Connel and Cummings, 1975; Schmidt and Cummings, 1975; Leifer and...uncertainty and the need for external information processing, including: Duncan, 1972; Child, 1972; Osborn and Hunt, 1914; Hellriegel and Solcum, 1915; Huber

  16. Thymol produces an antidepressant-like effect in a chronic unpredictable mild stress model of depression in mice.

    Science.gov (United States)

    Deng, Xue-Yang; Li, Hong-Yan; Chen, Jun-Jun; Li, Rui-Peng; Qu, Rong; Fu, Qiang; Ma, Shi-Ping

    2015-09-15

    Thymol, a bioactive monoterpene isolated from Thymus vulgaris, has displayed inspiring neuroprotective properties. The present study was designed to evaluate the antidepressant-like effects of thymol on a chronic unpredictable mild stress (CUMS) model of depression in mice and explore the underlying mechanisms. It was observed that thymol treatment (15 mg/kg and 30 mg/kg) significantly reversed the decrease of sucrose consumption, the loss of body weight, the reduction of immobile time in the tail suspension tests (TST) and forced swimming tests (FST) induced by CUMS paradigm. The levels of norepinephrine (NE) and serotonin (5-HT) in the hippocampus decreased in the CUMS-treated mice. Chronic treatments with thymol significantly restored the CUMS-induced alterations of monoamine neurotransmitters in the hippocampus. Our results further demonstrated that thymol administration negatively regulated the induction of proinflammatory cytokines including interleukin (IL)-1β, IL-6, and tumor necrosis factor-α in CUMS mice. Furthermore, thymol inhibited the activation of nod-like receptor protein 3 (NLRP3) inflammasome and its adaptor, and subsequently decreased the expression of caspase-1. In sum, our findings suggested that thymol played a potential antidepressant role in CUMS mice model through up-regulating the levels of central neurotransmitters and inhibiting the expressions of proinflammatory cytokines, which might provide potential for thymol in the light of opening up new therapeutic avenues for depression. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Brain-derived neurotrophic factor signalling mediates the antidepressant-like effect of piperine in chronically stressed mice.

    Science.gov (United States)

    Mao, Qing-Qiu; Huang, Zhen; Zhong, Xiao-Ming; Xian, Yan-Fang; Ip, Siu-Po

    2014-03-15

    Previous studies in our laboratory have demonstrated that piperine produced antidepressant-like action in various mouse models of behavioral despair. This study aimed to investigate the role of brain-derived neurotrophic factor (BDNF) signalling in the antidepressant-like effect of piperine in mice exposed to chronic unpredictable mild stress (CUMS). The results showed that CUMS caused depression-like behavior in mice, as indicated by the significant decrease in sucrose consumption and increase in immobility time in the forced swim test. It was also found that BDNF protein expression in the hippocampus and frontal cortex were significantly decreased in CUMS-treated mice. Chronic treatment of piperine at the dose of 10mg/kg significantly ameliorated behavioural deficits of CUMS-treated mice in the sucrose preference test and forced swim test. Piperine treatment also significantly decreased immobility time in the forced swim test in naive mice. In parallel, chronic piperine treatment significantly increased BDNF protein expression in the hippocampus and frontal cortex of both naive and CUMS-treated mice. In addition, inhibition of BDNF signalling by injection of K252a, an inhibitor of the BDNF receptor TrkB, significantly blocked the antidepressant-like effect of piperine in the sucrose preference test and forced swim test of CUMS-treated mice. Taken together, this study suggests that BDNF signalling is an essential mediator for the antidepressant-like effect of piperine. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Effects of curcumin on chronic, unpredictable, mild, stress-induced depressive-like behaviour and structural plasticity in the lateral amygdala of rats.

    Science.gov (United States)

    Zhang, Lin; Luo, Junxia; Zhang, Minghua; Yao, Wei; Ma, Xuelian; Yu, Shu Yan

    2014-05-01

    Depression is a neuropsychiatric disease associated with wide ranging disruptions in neuronal plasticity throughout the brain. Curcumin, a natural polyphenolic compound of curcuma loga, has been demonstrated to be effective in the treatment of depressive-like disorders. The present study aimed to investigate the mechanisms underlying the antidepressant-like effects of curcumin in a rat model of chronic, unpredictable, mild, stress (CUMS) -induced depression. The results showed that CUMS produced depressive-like behaviours in rats, which were associated with ultra-structural changes in neurons within the lateral amygdala (LA). In addition, the expression of synapse-associated proteins such as brain-derived neurotrophic factor (BDNF), PSD-95 and synaptophysin were significantly decreased in the LA of CUMS-treated rats. Chronic administration of curcumin (40 mg/kg, i.p. 6 wk) before stress exposure significantly prevented these neuronal and biochemical alterations induced by CUMS, and suppressed depressive-like behaviours, suggesting that this neuronal dysregulation may be related to the depressive-like behaviours caused by CUMS. Together with our previous results, the current findings demonstrate that curcumin exhibits neuroprotection and antidepressant-like effects in the CUMS-induced depression model. Furthermore, this antidepressant-like action of curcumin appears to be mediated by modulating synapse-associated proteins within the LA. These findings provide new insights into the underlying mechanisms leading to neural dysfunction in depression and reveal the therapeutic potential for curcumin use in clinical trials.

  19. Pocket Semiquinonate Complexes of Cobalt(II), Copper(II), and Zinc(II) Prepared with the Hydrotris(cumenylmethylpyrazolyl)borate Ligand.

    Science.gov (United States)

    Ruf, Michael; Noll, Bruce C.; Groner, Markus D.; Yee, Gordon T.; Pierpont, Cortlandt G.

    1997-10-08

    3,5-Di-tert-butyl-1,2-semiquinonate (3,5-DBSQ) complexes of Co(II), Cu(II), and Zn(II) have been prepared that contain the hydrotris(cumenylmethyl-pyrazolyl)borate (Tp(Cum,Me)) coligand. Tp(Cum,Me)Zn(3,5-DBSQ) and Tp(Cum,Me)Cu(3,5-DBSQ) were prepared by treating the parent hydroxide, Tp(Cum,Me)M(OH), M = Cu and Zn, with 3,5-di-tert-butylcatechol. Tp(Cum,Me)Co(3,5-DBSQ) was prepared by a reaction between (Tp(Cum,Me))(2)Co and 3,5-DBCat. The identity of (Tp(Cum,Me))(2)Co in this reaction was confirmed by a structure determination [(Tp(Cum,Me))(2)Co: orthorhombic, Pbcn, a = 17.7189(4) Å, b = 17.4806(3) Å, c = 25.7123(6) Å, V = 7964.1(3) Å(3), Z = 4, R(F) = 0.054]. Intersecting cumenyl substituents of the pyrazolylborate ligand encapsulate the Co(II) ion. Structural characterization on all three members of the Tp(Cum,Me)M(3,5-DBSQ) series has been carried out. The complexes of Co(II) and Zn(II) are isomorphous and isostructural [Tp(Cum,Me)Co(3,5-DBSQ): triclinic, P&onemacr;, a = 14.4631(2) Å, b = 18.5438(3) Å, c = 21.6142(2) Å, alpha = 79.8430(10) degrees, beta = 90.0900(10) degrees, gamma = 84.9900(10) degrees, V = 5683.45(13) Å(3), Z = 4, R(F) = 0.072; Tp(Cum,Me)Zn(3,5-DBSQ), triclinic, P&onemacr;, a = 14.261(3) Å, b = 18.760(7) Å, c = 21.710(4) Å, alpha = 80.049(12) degrees, beta = 89.853(8) degrees, gamma = 85.542(12) degrees, V = 5703(3) Å(3), Z = 4, R(F) = 0.064]. Tp(Cum,Me)Cu(3,5-DBSQ) [monoclinic, P2(1)/c, a = 19.3081(3) Å, b = 13.0291(2) Å, c = 21.4783(4) Å, beta = 102.8420(10) degrees, V = 5268.1(2) Å(3), Z = 4, R(F) = 0.071] has a distorted square pyramidal structure, the complexes of Zn and Co have structures that are closer to a trigonal bipyramid. Parent catecholate complexes of all three metals are unusually stable in air but undergo slow oxidation in solution to give the semiquinonate products characterized structurally. Copper(II) and SQ spins of Tp(Cum,Me)Cu(3,5-DBSQ) are located in orthogonal orbitals, and the complex has a S = 1 spin

  20. «En favor de las víctimas de la guerra»

    Directory of Open Access Journals (Sweden)

    Robles Muñoz, Cristóbal

    2009-12-01

    Full Text Available Informal representation given to Cardinal Gomá in December 1936, sending Ildebrando Antoniutti as apostolic delegate in humanitarian mission in July, remained at its lowest level relations between the Holy See with the government of Franco. The situation changed in 1937. The nuncio Gaetano Cicognani did not arrive until June 1938. Discrete steps of a secret diplomacy advised in September 1937 to formalize the relationship, at its lowest. Antoniutti and Pablo de Churruca were named Responsible of Affairs, in Burgos, and to the Holy See, in a respective way. The collective letter of the bishops helped to improve the image of «national» Spain before the Catholics in other countries. The doctrinal position in which these facts were inserted was fixed at three encyclicals published in March 1937. They condemned the religious persecution of communism, nazism and the fear of a desire to runaway of the persecution forgiving people and fighting for justice for the working classesLa representación oficiosa dada al cardenal Gomá en diciembre de 1936, el envío Ildebrando Antoniutti como delegado apostólico en julio en misión humanitaria, mantuvieron bajo mínimos las relaciones de la Santa Sede con el Gobierno de Franco. La situación no cambió en 1937. El nuncio Gaetano Cicognani no llegó hasta junio de 1938. Los pasos discretos de una diplomacia secreta aconsejaron en septiembre de 1937 formalizar las relaciones, en su nivel más bajo. Antoniutti y Pablo de Churruca fueron nombrados encargados de negocios, en Burgos y ante la Santa Sede. La carta colectiva de los obispos ayudó a mejorar la imagen los nacionales ante los católicos de otros países. La posición doctrinal en que se insertan estos hechos quedó fijada en las tres encíclicas publicadas en marzo de 1937. En ella se denuncia la persecución religiosa del comunismo, el temor al nazismo y el deseo de salir de la persecución personando y luchando por la justicia a favor de las clases

  1. Effect of fluoxetine and resveratrol on testicular functions and oxidative stress in a rat model of chronic mild stress-induced depression.

    Science.gov (United States)

    Sakr, H F; Abbas, A M; Elsamanoudy, A Z; Ghoneim, F M

    2015-08-01

    Our objective was to investigate the effects of chronic unpredictable mild stress (CUMS) with or without selective serotonin reuptake inhibitor (fluoxetine) and anti-oxidant (resveratrol) on testicular functions and oxidative stress in rats. Fifty male rats were divided into 2 groups; control and CUMS. CUMS group was further subdivided into 4 subgroups administered water, fluoxetine, resveratrol and both. Sucrose intake, body weight gain, serum corticosterone, serotonin and testosterone levels, sperm count and motility, testicular malondialdehyde, superoxide dismutase (SOD), catalase, glutathione (GSH), and gene expression of steroidogenic acute-regulatory (StAR) protein and cytochrome P450 side chain cleavage (P450scc) enzyme were evaluated. CUMS decreased sucrose intake, weight gain, anti-oxidants (SOD, catalase, GSH), testosterone, serotonin, StAR and cytochrome P450scc gene expression, sperm count and motility and increased malondialdehyde and corticosterone. Fluoxetine increased malondialdehyde, sucrose intake, weight gain, serotonin and decreased anti-oxidants, StAR and cytochrome P450scc gene expression, sperm count and motility, testosterone, corticosterone in stressed rats. Administration of resveratrol increased anti-oxidants, sucrose intake, weight gain, serotonin, StAR and cytochrome P450scc gene expression, testosterone, sperm count and motility, and decreased malondialdehyde and corticosterone in stressed rats with or without fluoxetine. In conclusion, CUMS induces testicular dysfunctions and oxidative stress. While treatment of CUMS rats with fluoxetine decreases the depressive behavior, it causes further worsening of testicular dysfunctions and oxidative stress. Administration of resveratrol improves testicular dysfunctions and oxidative stress that are caused by CUMS and further worsened by fluoxetine treatment.

  2. TLR4/NF-κB signaling contributes to chronic unpredictable mild stress-induced atherosclerosis in ApoE-/- mice.

    Directory of Open Access Journals (Sweden)

    Ya Ling Tang

    Full Text Available Chronic stress is an important risk factor for atherosclerotic diseases. Our previous studies have shown that chronic unpredictable mild stress (CUMS accelerates atherosclerosis and up-regulates TLR4/NF-κB expression in apoE-/- mice. However, TLR4/NF-κB signaling whether directly contributes to the development of atherosclerosis in CUMS mice is unclear. We hypothesized that the interference of TLR4/NF-κB can ameliorate CUMS-induced inflammation and atherosclerosis in apoE-/- mice.ApoE-/- mice were exposed to 12 weeks CUMS. Ad-siRNA TLR4 was given by tail vein injection (10 μl/mouse, every 5 days, and PDTC (an inhibitor of NF-κB was given by intraperitoneal injection (60 mg/kg, once a day. Plasma corticosterone concentrations were determined by solid-phase 125I radioimmunoassay. Atherosclerosis lesions in aortic sinuses were evaluated and quantified by IMAGEPRO PLUS. Western blotting was used to detect the expression of TLR4, NF-κB, and IL-1β in aortas of the mice. Plasma lipid profiles, IL-1β, TNF-α, and MCP-1 were measured by ELISA.Our results indicated that CUMS apoE-/- mice treatment with siRNA TLR4 significantly decreased atherosclerosis and down-regulated TLR4, NF-κB, and inflammatory cytokines. PDTC also remarkably reduced atherosclerosis and the levels of IL-1β, TNF-α and MCP-1 in plasma. However, Treatment with siRNA TLR4 or PDTC had no effect on plasma corticosterone levels, and lipid profiles.TLR4/NF-κB pathway may participate in CUMS-induced atherosclerosis through activation of proinflammatory cytokines in apoE-/- mice. Our data may provide a new potential therapeutic target for prevention of CUMS -induced atherosclerosis.

  3. Internuncio Antonio Francesco Cirioli's correspondence with the Secretary of State on the eve of the General Sejm held in Warsaw in 1623 (part II

    Directory of Open Access Journals (Sweden)

    Tadeusz Fitych

    2000-12-01

    Full Text Available From the mid-16th century onwards, the Apostolic Nunciature in Poland was pro-parliamentary, anti-Turkish and counter-reformative. It should not come as a surprise that the preliminary instruction issued to nuncio Giovanni Battista Lacellotti to stay especially alert and secure the interest of the Catholic Church in Poland as well as care for Christian affairs during parliamentary sessions acquired particular significance. In early November 1622, by the appointment of cardinal Cosimo de Torres, under Gregory's XV papal brief of 3 December 1622, Antonio Francesco Cirioli became internuncio. A Bolognese by origin, Cirioli was and a Doctor of Laws and from 1621 an auditor of Cosimo de Torres's nunciature (to date completely absent from the literature of the subject. The office of the internuncio in Warsaw, to which he was appointed following his 13-month service as an auditor, was held by Cirioli for as many as twenty-three weeks, i.e. from 19 November 1622 to 29 April 1623.

  4. Ikonoklastinė polemika LDK. Vieno veikalo istorijos pinklės | Iconoclastic Controversy in the Grand Duchy of Lithuania. The Tangled Story of One Work

    Directory of Open Access Journals (Sweden)

    Ūla Ambrasaitė

    2012-01-01

    Full Text Available The article presents some introductory notes on research into the iconoclastic controversy in the Grand Duchy of Lithuania, and suggests reasons for their relevance. Writings from the early and mid-16th century which show traces of iconoclastic thought are presented. In his poem De vita et gestis Divi Hyacinthi carmen (1525, Mykolas Husovianas introduces the reader to the growing ‘Lutheran heresy’ in Western Europe, which also had an iconoclastic aspect. In the treatise by Mykolas Lietuvis De moribus Tartarorum, Lituanorum et Moscorum fragmina X, multipli historia referta (written in 1550, and printed in 1615, we can perceive not a conscious iconoclastic stance but rather a humanist criticism.A more conscious attempt to criticise the visuality of faith was made by Mikalojus Radvila Juodasis. His long letter to the papal nuncio Aloisio Lippomano (Duae epistolae, 1556 explains his intentions to form a separate Vilnius church, which would also have iconoclastic traits.The article also reviews the historiographically, but only separately, described facts about the most important work of iconoclastic polemics of the Grand Duchy of Lithuania, Andrius Volanas’ Idololatriae Loiolitarum Vilnensium oppugnatio, which was printed in 1583. The author highlights a lot of questions posed by the work, the solutions to which might allow us to judge the extent of iconoclastic thought and the importance of religious imagery in the Grand Duchy of Lithuania. By connecting the facts to a coherent narrative, the article identifies ‘blank spots’ in history, and suggests areas for further research.

  5. The mechanism of 5-lipoxygenase in the impairment of learning and memory in rats subjected to chronic unpredictable mild stress.

    Science.gov (United States)

    Luo, Ying; Kuang, Shengnan; Xue, Lai; Yang, Junqing

    2016-12-01

    To examine the mechanism of 5-lipoxygenase (5-LO) in the learning and memory dysfunction in rats subjected to chronic unpredictable mild stress (CUMS). Eighty rats were divided into eight groups: the 0.5% sodium carboxymethyl cellulose solution (NaCMC)-treated group, empty vector (LV-Mock)-treated group, CUMS+NaCMC-treated group, CUMS+sertraline-treated group, CUMS+caffeic acid (10mg/kg)-treated group, CUMS+caffeic acid (30mg/kg)-treated group, CUMS+LV-Mock-treated group, and CUMS+5-LO-silencers lentiviral vectors (LV-si-5-LO)-treated group, n=10. Sucrose preference tests were performed to assess depression-like behavior. The Morris water maze and step-down tests were used to evaluate learning and memory performance. The levels of inflammatory cytokines, malondialdehyde, and the activity of superoxide dismutase (SOD) were detected to estimate inflammation and oxidative stress. Changes in 5-LO mRNA and protein were detected using reverse transcription polymerase chain reaction and Western blotting. The expression of synaptophysin, postsynaptic density-95 (PSD-95), and brain-derived neurotrophic factor (BDNF) in the hippocampus were measured using immunohistochemical staining. Treatment with caffeic acid or LV-si-5-LO increased sucrose consumption, decreased escape latency and increased the number of platform crosses in the Morris water maze test, and decreased the number of errors and prolonged the latency in the step-down test. We observed a decreased expression of 5-LO, and levels of malondialdehyde, leukotriene-B4, tumor necrosis factor-α, and interleukin-6, while the protein levels of synaptophysin, PSD-95, BDNF, and the activity of SOD were increased in the hippocampus of the CUMS-treated rats. CUMS-induced impairment in learning and memory could be triggered by an inflammatory response in the rat hippocampus, which results in oxidative stress injury and impacts the synaptic plasticity of hippocampal neurons. Inhibition of the activity or expression of 5-LO

  6. Antidepressant-like effects of Marasmius androsaceus metabolic exopolysaccharides on chronic unpredictable mild stress-induced rat model.

    Science.gov (United States)

    Song, Jia; Wang, Xue; Huang, Yu; Qu, Yidi; Teng, Lesheng; Wang, Di; Meng, Zhaoli

    2017-10-01

    Marasmius androsaceus (M. androsaceus), a medicinal fungus, has various pharmacological activities including antidepression. The present study investigated the effects of exopolysaccharides obtained during M. androsaceus submerged fermentation in a chronic unpredictable mild stress (CUMS)‑induced depression rat model. Similar to fluoxetine (positive drug), 4‑week administration of M. androsaceus exopolysaccharides (MEPS) at doses of 6, 30 and 150 mg/kg strongly enhanced bodyweight gain and sucrose consumption, and reduced the immobility time in forced swimming test and tail suspension test in CUMS rats. MEPS resulted in significant enhancement on the levels of noradrenalin, dopamine, 5‑hydroxytryptamine (5‑HT), and 5‑hydroxyindoleacetic acid in the serum and hypothalamus of CUMS rats, as detected by ELISA. Western blotting results revealed that MEPS upregulated the protein expression levels of tyrosine hydroxylase in the hypothalamus of CUMS rats. In conclusion, these results confirmed the antidepressant‑like effects of MEPS, and suggested that the monoamine neurotransmitter system is involved in its antidepressive effects in a CUMS rat model. The present study provided evidence for the clinical application of MEPS as an effective agent against depression.

  7. Involvement of Normalized Glial Fibrillary Acidic Protein Expression in the Hippocampi in Antidepressant-Like Effects of Xiaoyaosan on Chronically Stressed Mice

    Directory of Open Access Journals (Sweden)

    Xiu-Fang Ding

    2017-01-01

    Full Text Available The research has only yielded a partial comprehension of MDD and the mechanisms underlying the antidepressant-like effects of XYS. Therefore, in this study, we aimed to explore the effects of XYS on chronic unpredictable mild stress- (CUMS- induced changes in the neuronal and the astrocytic markers in the mouse hippocampus. The physical states and depressive-like behaviors in mice with CUMS were recorded. The serum contents of brain-derived neurotrophic factor (BDNF and glial cell line-derived neurotrophic factor (GDNF were measured. The protein and mRNA expressions and the immunoreactivities of glial fibrillary acidic protein (GFAP and neuronal nuclei (NeuN in mouse hippocampus were detected using a Western blot, qRT-PCR, and immunohistochemical staining, respectively. XYS treatment markedly improved the physical state and depressive-like behaviors in mice subjected to CUMS compared with the model group, and the serum contents of BDNF and GDNF were significantly upregulated. XYS treatment also elevated the protein and mRNA levels, as well as the immunoreactivity of GFAP in the hippocampus. However, CUMS did not influence NeuN expression. In conclusion, these results reveal that chronic administration of XYS elicits antidepressant-like effects in a mouse model of depression and may normalize glial fibrillary acidic protein expression in the hippocampi of mice with CUMS.

  8. Quantum Harmonic Oscillator State Control in a Squeezed Fock Basis.

    Science.gov (United States)

    Kienzler, D; Lo, H-Y; Negnevitsky, V; Flühmann, C; Marinelli, M; Home, J P

    2017-07-21

    We demonstrate control of a trapped-ion quantum harmonic oscillator in a squeezed Fock state basis, using engineered Hamiltonians analogous to the Jaynes-Cummings and anti-Jaynes-Cummings forms. We demonstrate that for squeezed Fock states with low n the engineered Hamiltonians reproduce the sqrt[n] scaling of the matrix elements which is typical of Jaynes-Cummings physics, and also examine deviations due to the finite wavelength of our control fields. Starting from a squeezed vacuum state, we apply sequences of alternating transfer pulses which allow us to climb the squeezed Fock state ladder, creating states up to excitations of n=6 with up to 8.7 dB of squeezing, as well as demonstrating superpositions of these states. These techniques offer access to new sets of states of the harmonic oscillator which may be applicable for precision metrology or quantum information science.

  9. Cavity quantum electrodynamics with a Rydberg-blocked atomic ensemble

    DEFF Research Database (Denmark)

    Guerlin, Christine; Brion, Etienne; Esslinger, Tilman

    2010-01-01

    The realization of a Jaynes-Cummings model in the optical domain is proposed for an atomic ensemble. The scheme exploits the collective coupling of the atoms to a quantized cavity mode and the nonlinearity introduced by coupling to high-lying Rydberg states. A two-photon transition resonantly...... effective Jaynes-Cummings model. We use numerical simulations to show that the cavity transmission can be used to reveal detailed properties of the Jaynes-Cummings ladder of excited states and that the atomic nonlinearity gives rise to highly nontrivial photon emission from the cavity. Finally, we suggest...... couples the single-atom ground state |g> to a Rydberg state |e>via a nonresonant intermediate state |i>, but due to the interaction between Rydberg atoms only a single atom can be resonantly excited in the ensemble. This restricts the state space of the ensemble to the collective ground state |G...

  10. Antidepressant-Like Effects of Cordycepin in a Mice Model of Chronic Unpredictable Mild Stress

    Directory of Open Access Journals (Sweden)

    Zhang Tianzhu

    2014-01-01

    Full Text Available Cordycepin (3′-deoxyadenosine, a major bioactive component isolated from Cordyceps militaris, has multiple pharmacological activities. This study is attempted to investigate whether cordycepin (COR possesses beneficial effects on chronic unpredictable mild stress- (CUMS- induced behavioral deficits (depression-like behaviors and explore the possible mechanisms. ICR mice were subjected to chronic unpredictable mild stress for 42 consecutive days. Then, COR and fluoxetine (FLU, positive control drug were administered for 21 consecutive days at the last three weeks of CUMS procedure. The classical behavioral tests, open field test (OFT, sucrose preference test (SPT, tail suspension test (TST, and forced swimming test (FST, were applied to evaluate the antidepressant effects of COR. Then the serotonin (5-HT and noradrenaline (NE concentrations in hippocampal were evaluated by HPLC; tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6 in hippocampal were evaluated, and the proteins of TNF-α, IL-6, NF-κBP65 5-HT receptor (5-HTR, and brain-derived neurotrophic factor (BDNF in hippocampal were evaluated by Western blot. Our results indicated that 6 weeks of CUMS exposure induced significant depression-like behavior, with low 5-HT and NE levels, high TNF-α and IL-6 in brain and high hippocampal TNF-α, IL-6, P-NF-κBP65, and 5-HTR levels, and low BDNF expression levels. Whereas, chronic COR (20, 40 mg/kg treatments reversed the behavioral deficiency induced by CUMS exposure, treatment with COR normalized the change of TNF-α, IL-6, 5-HT, and NE levels, which demonstrated that COR could partially restore CUMS-induced 5-HT receptor impairments and inflammation. Besides, hippocampal BDNF expressions were also upregulated after COR treatments. In conclusion, COR remarkably improved depression-like behavior in CUMS mice and its antidepressant activity is mediated, at least in part, by the upregulating BDNF and downregulating 5-HTR levels and

  11. Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice?

    Science.gov (United States)

    Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad

    2017-10-01

    Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.

  12. Aquatic ecosystems in hot water : effects of climate on the functioning of shallow lakes

    NARCIS (Netherlands)

    Kosten, S.

    2010-01-01

    cum laude graduation (with distinction) There is concern that a warmer climate may boost carbon emissions from lakes and promote the chance that they lose their vegetation and become dominated by phytoplankton or cyanobacteria. However, these hypotheses have been difficult to evaluate due to the

  13. Annual Report Fiscal Year 2003 of the Secretary of the Army on Civil Works Activities (1 October 2004 - 30 September 2005)

    Science.gov (United States)

    2006-08-25

    84,544 169,089 Cove Island, Stamford, CT 1961 47,131 94,262 Cummings Park, Stamford, CT 1963 26,886 53,771 Guilford Point Beach ( Jacobs Beach...Grafton, IL; Bellevue1, Clinton, Davenport, and Keokuk3, IA; St. Paul ( Harriet Island), MN5; and Bay City, Pepin, and Cassville5, WI. Oct

  14. Variability of African Farming Systems from Phenological Analysis of NDVI Time Series

    Science.gov (United States)

    Vrieling, Anton; deBeurs, K. M.; Brown, Molly E.

    2011-01-01

    Food security exists when people have access to sufficient, safe and nutritious food at all times to meet their dietary needs. The natural resource base is one of the many factors affecting food security. Its variability and decline creates problems for local food production. In this study we characterize for sub-Saharan Africa vegetation phenology and assess variability and trends of phenological indicators based on NDVI time series from 1982 to 2006. We focus on cumulated NDVI over the season (cumNDVI) which is a proxy for net primary productivity. Results are aggregated at the level of major farming systems, while determining also spatial variability within farming systems. High temporal variability of cumNDVI occurs in semiarid and subhumid regions. The results show a large area of positive cumNDVI trends between Senegal and South Sudan. These correspond to positive CRU rainfall trends found and relate to recovery after the 1980's droughts. We find significant negative cumNDVI trends near the south-coast of West Africa (Guinea coast) and in Tanzania. For each farming system, causes of change and variability are discussed based on available literature (Appendix A). Although food security comprises more than the local natural resource base, our results can perform an input for food security analysis by identifying zones of high variability or downward trends. Farming systems are found to be a useful level of analysis. Diversity and trends found within farming system boundaries underline that farming systems are dynamic.

  15. Twenty-first century relevance of Soyinka's A dance of the forests : a ...

    African Journals Online (AJOL)

    This article embarks on a re-reading of Wole Soyinka's A Dance of the Forests in order to determine the relevance of the play to the twenty-first century Nigerian cum African society. The re-reading is cast in a postmodern conceptualization because it attempts a deconstructive reading procedure, which reassesses and ...

  16. A 1H-NMR-Based Metabonomic Study on the Anti-Depressive Effect of the Total Alkaloid of Corydalis Rhizoma

    Directory of Open Access Journals (Sweden)

    Hongwei Wu

    2015-05-01

    Full Text Available Corydalis Rhizoma, named YuanHu in China, is the dried tuber of Corydalis yanhusuo W.T. Wang which is used in Traditional Chinese Medicine for pain relief and blood activation. Previous pharmacological studies showed that apart from analgesics, the alkaloids from YuanHu may be useful in the therapy of depression by acting on the GABA, dopamine and benzodiazepine receptors. In this study, the antidepressive effect of the total alkaloid of YuanHu (YHTA was investigated in a chronic unpredictable mild stress (CUMS rat model using 1H-NMR-based metabonomics. Plasma metabolic profiles were analyzed and multivariate data analysis was applied to discover the metabolic biomarkers in CUMS rats. Thirteen biomarkers of CUMS-introduced depression were identified, which are myo-inositol, glycerol, glycine, creatine, glutamine, glutamate, β-glucose, α-glucose, acetoacetate, 3-hydroxybutyrate, leucine and unsaturated lipids (L7, L9. Moreover, a metabolic network of the potential biomarkers in plasma perturbed by CUMS was detected. After YHTA treatment, clear separation between the model group and YHTA-treated group was achieved. The levels of all the abnormal metabolites mentioned above showed a tendency of restoration to normal levels. The results demonstrated the therapeutic efficacy of YHTA against depression and suggested that NMR-based metabolomics can provide a simple and easy tool for the evaluation of herbal therapeutics.

  17. Encounters of newly qualified teachers with micro-politics in primary ...

    African Journals Online (AJOL)

    The findings revealed that the beginners' micro-political experiences mainly revolved around themes such as exploitation and marginalisation, lack of respect and recognition, lack of access to information about the scheme-cum-plan and dealing with the micro-political realities. Furthermore, the findings suggest that ...

  18. Review of the book by Diego Silva Forné: Drogas y Derecho Penal en el Uruguay: tolerancia, prohibición, regulación. Evolución del derecho uruguayo, su doctrina y jurisprudencia. Análisis de la Ley de Regulación y Control del Mercado de la Marihuana

    Directory of Open Access Journals (Sweden)

    Mariana Malet Vázquez

    2017-04-01

    Full Text Available This study is the doctoral thesis under the direction of Prof. Dr. Maria Acale, Diego Silva defended earlier this year at the University of Cadiz in front of Spanish professors of the stature of Juan Terradillos, Juan Muñoz Sánchez and Juan Carlos Ferré Olivé, obtaining the qualification Summa cum laude, unanimously.

  19. Books Received

    Indian Academy of Sciences (India)

    the students. There are tennis, badminton, volleyball, and basketball courts on campus, a cricket-cum-football ground nearby, plus indoor table-tennis for those interested in sports. Nearby sal forests, a small patch of scrub vegetation on campus, are the regular haunt of the campus ornithologists and naturalists. Besides this ...

  20. research note the oestrous response and changes in plasma ...

    African Journals Online (AJOL)

    Refercnces. FAURE, A.S., 1975. Vroeii embrionale verlies weens wanvoeding by Meino skape. M. Sc. (Landbou) Tesis. Universiteit van Stellenbosch. FINDLAY, J.K. & CUMMING, J.A., 1976. lncrease in ovulation rate in sheep following administration of an LHRH analogue. Biol. Repr. 15, I15. HARESIGN, W., FOSTER, J.P., ...

  1. Download this PDF file

    African Journals Online (AJOL)

    Ph. D (Landbou) tesis, Universiteit Stellenbosch .voorge1l!. FAIRNIE, IJ., CUMMING, I.A. & MARTIN, E.R., 1976. Use of prostaglandin analogue ICI 80996, to synchronise ovulation in sheep in an artificial insemination programme. Proc. AUSI. Soc. Anim. Prod. 11, 133. GREYLING, JP.c., 1978. Control of ovulation in cycling ...

  2. Water Management and Water Governance in a Changing Climate. Experiences and insights on climate change adaptation in Europe, Africa, Asia and Australia

    NARCIS (Netherlands)

    Huntjens, P.

    2011-01-01

    This book is based on his PhD research (magna cum laude, 2010) in Complex System Sciences from the University of Osnabrück, Germany. Modern societies are confronted with persistent problems of great complexity and unpredictability. These problems lead to critical situations, such as water and

  3. CDMRP: Fostering Innovation Through Peer Review

    Science.gov (United States)

    2010-01-01

    based and paperless reviewSince its inception, CDMRP has relied on more procedures (e.g., online proposal access and cri-than 6,800 scientists and...Vanderbilt University, graduating in 3 years with magna cum laude honors. She earned her M.D. from St. Louis University School of Medicine, and then com

  4. Die Problematik des Begriffes hebraica veritas

    African Journals Online (AJOL)

    p1243322

    persecutus est, ut non eum putes de futuro vaticinari, sed de praeteritis historiam texere. Unde conicio [12] noluisse tunc temporis Septuaginta interpretes fidei suae sacramenta perspicue ethnicis prodere, ne sanctum canibus et margaritas porcis darent, quae, cum hanc editionem legeritis, ab illis animadvertetis abscondita.

  5. Calvyn: Institusie, konfessie en kategismus

    Directory of Open Access Journals (Sweden)

    H. W. Simpson

    1981-06-01

    Full Text Available Det Dominus nobis in caelestis suae sapientiae mysteriis cum vero pietatis profectu versari in gloriam suam et aedificatioTiem nostram. Amen. (Mag die Here ons dit gun om ons met waaragtige vordering in godsvrug met die geheimenisse van sy hemelse wysheid besig te hou tot sy heerlikheid en tot ons opbou. Amen

  6. Pleiotropic phenotypes of the salt-tolerant and cytosine ...

    Indian Academy of Sciences (India)

    Abstract. In Catharanthus roseus, three morphological cum salt-tolerant chemically induced mutants of Mendelian inheritance and their wild-type parent cv Nirmal were characterized for overall cytosine methylation at DNA repeats, expression of 119 protein- coding and seven miRNA-coding genes and 50 quantitative traits.

  7. SAFE DISPOSAL OF MUNICIPAL WASTES IN NIGERIA ...

    African Journals Online (AJOL)

    of modern scientific methods of waste management, treatment and disposal, the non-enforcement cum .... 13 Damilola Olawuyi, The Principles of Nigerian Environmental Law (Business Perspectives. 2013) 195. ... 17 B. Abila and J. Kantola 'Municipal Solid Waste Management Problems in Nigeria: Evolving. Knowledge ...

  8. Building Infrastructure for Peace in Nigerian Schools | Irene | African ...

    African Journals Online (AJOL)

    Dealing with violent menace however requires a cutting–edge approach which infrastructure for peace represents. This is important in view of the failure of the existing approaches in dealing with violence and promoting attitudinal cum social change in school. This paper therefore focuses on building infrastructures for ...

  9. Recovery of barotrauma injuries in Chinook salmon, Oncorhynchus tshawytscha from exposure to pile driving sound.

    Directory of Open Access Journals (Sweden)

    Brandon M Casper

    Full Text Available Juvenile Chinook salmon, Oncorhynchus tshawytscha, were exposed to simulated high intensity pile driving signals to evaluate their ability to recover from barotrauma injuries. Fish were exposed to one of two cumulative sound exposure levels for 960 pile strikes (217 or 210 dB re 1 µPa(2·s SEL(cum; single strike sound exposure levels of 187 or 180 dB re 1 µPa(2⋅s SEL(ss respectively. This was followed by an immediate assessment of injuries, or assessment 2, 5, or 10 days post-exposure. There were no observed mortalities from the pile driving sound exposure. Fish exposed to 217 dB re 1 µPa(2·s SEL(cum displayed evidence of healing from injuries as post-exposure time increased. Fish exposed to 210 dB re 1 µPa(2·s SEL(cum sustained minimal injuries that were not significantly different from control fish at days 0, 2, and 10. The exposure to 210 dB re 1 µPa(2·s SEL(cum replicated the findings in a previous study that defined this level as the threshold for onset of injury. Furthermore, these data support the hypothesis that one or two Mild injuries resulting from pile driving exposure are unlikely to affect the survival of the exposed animals, at least in a laboratory environment.

  10. The alternative sigma factor sigmaB and the stress response of Bacillus cereus

    NARCIS (Netherlands)

    Schaik, van W.

    2005-01-01

    cum laude graduation (with distinction) The bacterium Bacillus cereus is responsible for a large number of cases of foodborne illness across the world. It is also an important cause of spoilage of food, in particular of milk and dairy-products. The growth and survival of B. cereus in food or during

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 1236 ... Vol 8, No 1 (2002), Mathematic, Physics and Computer Sciences Quantization in type 1 multiple quantum well (MQW) and superlattice (SL) systems, Details. J.S.A. Adelabu, A.M. Salau. Vol 6, No 3 (2000), Mathematics, Physics and Computer Sciences An almost unbiased ratio-cum-product method of ...

  12. An Analytical Study on Evaluating the Performance of Developed ...

    African Journals Online (AJOL)

    Prototype cultivator-cum-seed drill was designed, fabricated and tested for sowing of paddy. The machine consisted of cultivator frame, tines, seed box, seed tubes, metering mechanism, power transmission unit, furrow opener and hitching attachments. The selection of materials and fabrication was done following the ...

  13. Further tests of entreaties to avoid hypothetical bias in referendum contingent valuation

    Science.gov (United States)

    Thomas C. Brown; Icek Ajzen; Daniel Hrubes

    2003-01-01

    Over-estimation of willingness to pay in contingent markets has been attributed largely to hypothetical bias. One promising approach for avoiding hypothetical bias is to tell respondents enough about such bias that they self-correct for it. A script designed for this purpose by Cummings and Taylor was used in hypothetical referenda that differed in payment amount. In...

  14. "Neem het dier serieus als individu"

    NARCIS (Netherlands)

    Kleis, R.; Driessen, C.P.G.

    2014-01-01

    Ethiek op de boerderij komt het beste uit de verf door samen met dieren nieuwe technologie te ontwikkelen. Filosoof Clemens Driessen, de man van het varkensspel Pig Chase, promoveerde afgelopen week cum laude op Animal deliberation, the co-evolution of technology and ethics on the farm. Resource

  15. NJP Vol 39 no 3

    African Journals Online (AJOL)

    Prof Ezechukwu

    2012-02-03

    Feb 3, 2012 ... nus oral baclofen. Introduction. Tetanus results from intoxication by Clostridium tetani. It is characterized by increased muscle tone and spasms caused by the neurotoxin, tetanospasmin. The clinical forms of the disease include generalized, ... The relationship between poor wound management cum.

  16. Journal of Language, Technology & Entrepreneurship in Africa Vol ...

    African Journals Online (AJOL)

    Academy Publisher

    organizations communicate and interact instantly with each other, and securely exchange sensitive information ..... areas. Some of the best-known and successfully activities that were performed through collaboration of member SMEs are the Industrial Estates, Technology Development Centers, Training cum Production.

  17. Adolescent Substance Abuse.

    Science.gov (United States)

    Thorne, Craig R.; DeBlassie, Richard R.

    1985-01-01

    Cummings (1979), citing evidence from the National Institute of Drug Abuse, reports that one of every eleven adult Americans suffers from a severe addictive problem. Drug addiction is epidemic among teenagers; one of every six teenagers suffers from a severe addictive problem. This paper focuses on adolescent drug/substance abuse. (Author)

  18. ISSN 2073-9990 East Cent. Afr. J. 0 East Cent. Afr. J. 0 East Cent ...

    African Journals Online (AJOL)

    dell

    2014-04-01

    Apr 1, 2014 ... Cummings C W, Fredrickson JM et al, Otolaryngology Head and Neck Surgery, 3rd ed; 1998,. Vol 2 Chapter 48, Published by Mosby Inc. 3. Agency for Healthcare Research and Quality, Management of Allergic and Non allergic. Rhinitis, Evidence report/ Technology Assessment, New England Medical ...

  19. The good in nature and humanity: connecting science, religion, and spirituality with the natural world

    National Research Council Canada - National Science Library

    Kellert, Stephen R; Farnham, Timothy J

    2002-01-01

    ... reflects our commitment to bringing the best of an expanding body of literature to the environmental community throughout North America and the world. Support for Island Press is provided by The Bullitt Foundation, The Mary Flagler Cary Charitable Trust,The Nathan Cummings Foundation, Geraldine R. Dodge Foundation, Doris Duke Charitable Foundati...

  20. Higher Education Financing and Income Redistribution

    OpenAIRE

    Wigger, Berthold U.

    2001-01-01

    This paper considers an optimal income tax cum higher educationpolicy.It shows that in the presence of an optimal income tax systemhigher education should be taxed rather than subsidized.Furthermore, income taxes should become less progressive whenan optimal higher education policy is introduced.

  1. Correspondence Courses: A Guide for Authors of Course Units. A Report of Some Experiences and Practices at the Open University.

    Science.gov (United States)

    Sachsenmeier, Peter

    A guide for authors of correspondence course units is presented to aid staff and consultants who will develop a correspondence cum residential course in curriculum development at the Kenya Institute of Education. The guide is based on observations at the Open University at Milton Keynes. The following areas are considered: the contribution of…

  2. The imperative of a new social contract through the technology of mind

    African Journals Online (AJOL)

    The progress of neuro/computer science makes it clear that sometime during the 21st century, man as a technology-driven being will master the technologies of mind and of life. Man will build machines more intelligent than man and modify human brains and bodies to increase intelligence. This scientific cum ...

  3. Photon and spin dependence of the resonance line shape in the strong coupling regime

    NARCIS (Netherlands)

    Miyashita, Seiji; Shirai, Tatsuhiko; Mori, Takashi; De Raedt, Hans; Bertaina, Sylvain; Chiorescu, Irinel

    2012-01-01

    We study the quantum dynamics of a spin ensemble coupled to cavity photons. Recently, related experimental results have been reported, showing the existence of the strong coupling regime in such systems. We study the eigenenergy distribution of the multi-spin system (following the Tavis-Cummings

  4. Computer aided cooling curve analysis for Al-5Si and Al-11Si alloys

    African Journals Online (AJOL)

    user

    The effect of grain refiner, modifier, and combination of grain refiner cum modifier was studied on Al-5Si and Al-11Si alloys using computer aided cooling curve analysis. For combined grain refinement and modification effect, Al-Ti-B-Sr single master alloy was developed that acted as both grain refiner and modifier.

  5. Lyfstraf en martelaarskap in Augustinus se Confessiones 1.9.14-15

    African Journals Online (AJOL)

    p1243322

    1 Sep 2015 ... invocationem rumpebam nodos linguae meae, et rogabam te parvus non parvo affectu, ne in schola vapularem. et cum me non exaudiebas, quod non erat ad insipientiam mihi, ridebantur a maioribus hominibus usque ab ipsis parentibus, qui mihi accidere mali nihil volebant plagae meae, magnum tunc et ...

  6. ILO/KRIVET National Tripartite Workshop: Workplace Learning in a Globalizing World [Proceedings] (Seoul, South Korea, November 29-30, 2001).

    Science.gov (United States)

    Korea Research Inst. for Vocational Education and Training, Seoul.

    This document contains the following five papers, all in both English and Korean, from a workshop on on-the-job training held in Korea in 2001: "Issues in Knowledge and Skills Development: Globalization and the Effective Use of New Technologies" (S. Ian Cummings); "The Knowledge Economy and Vocational Training Policy in Korea"…

  7. Managing Maritime Environment Surveillance And Information ...

    African Journals Online (AJOL)

    ... and supervising operational activities cum events within the confines of any given maritime environment. It is one aspect of search and rescue strategy that requires commissioning of group of persons to monitor and supervise operational activities that happens in the port area and beyond the accepted 200 nautical miles ...

  8. Physico-chemical parameters and heavy metal contents of Ibuya ...

    African Journals Online (AJOL)

    The physico-chemical parameters and heavy metal contents of Ibuya River were investigated between September 2012 and August 2013 from four stations using standard methods to etermine acceptable water quality standards and evaluate possible sustainability of a thriving fisheries cum tourist sport fishing venture.

  9. Beauty, a road to the truth

    NARCIS (Netherlands)

    Kuipers, T.A.F.

    In this article I give a naturalistic-cum-formal analysis of the relation between beauty, empirical success, and truth. The analysis is based on the one hand on a hypothetical variant of the so-called 'mere-exposure effect' which has been more or less established in experimental psychology regarding

  10. Positions Available | About IASc | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2017-04-30

    Positions Available. Current positions. Archives. Secretarial Trainee (contract basis) - Last date to apply : April 30, 2017. (Details, ); Copy Editor cum Proof Reader (contract basis) - Last date to apply : August 13, 2016. (Details, Application format); Copy Editor (contract basis) - Last date to apply : May 31, 2016. (Details ...

  11. Synchronization of oestrus in the Boer goat doe: Dose effect of ...

    African Journals Online (AJOL)

    FAIRNIE, 1.1., CUMMING, LA. & MARTIN, E.R., 1976. Use of prostaglandin analogue, I.e.I. 80996, to synchronise ovulation in sheep in an artificial insemination programme. Proc. Aust. Soc. Anim. Prod. 11, 133. FUKUI, Y. & ROBERTS, E.M., 1981. Relationship between doses of prostaglandin Fzu and stages of the breeding ...

  12. Page 1 THE RESPIRATORY SYSTEM AND THE MODE OF ...

    Indian Academy of Sciences (India)

    1935-08-19

    RESPIRATION OF THE WATER-EUG, SPA/AFA'O/DA, MA. A US 7/CUM FABR., WITH REMARKS ON THOSE OF. AVAEPA, ZA CCO 7 RAEP//AS AND AºA AWA TA'A. BY M. J. PRESSWALLA. AN ID. C. J. GEORGE. (From the Department of Biology, Wilson College, Bombay.) Received August 19, 1935. (Communicated by ...

  13. Cavity quantum electrodynamics of a quantum dot in a micropillar cavity: comparison between experiment and theory

    DEFF Research Database (Denmark)

    Madsen, Kristian Høeg; Ates, Serkan; Reitzenstein, S.

    2010-01-01

    The coupling between a quantum dot (QD) and a micropillar cavity is experimentally investigated by performing time-resolved, correlation, and two-photon interference measurements. The Jaynes-Cummings model including dissipative Lindblad terms and dephasing is analyzed, and all the parameters...

  14. A Comparative Study of Academic Staff Teaching Activities between Japan and China: Based on National Surveys in 2011-2012. RIHE International Seminar Reports. No. 23

    Science.gov (United States)

    Huang, Futao

    2015-01-01

    A review of recent literature suggests that, although academics in several countries (such as Japan, Korea and Germany) now allocate more of their time to research, service activities and administration than they had in the early 1990s (Teichler, Arimoto, and Cummings, 2013), the majority of university professors still spend the largest proportion…

  15. Protecting public health & the environment: implementing the precautionary principle

    National Research Council Canada - National Science Library

    Tickner, Joel; Raffensperger, Carolyn

    1999-01-01

    ... of an expanding body of literature to the environmental community throughout North America and the world. Support for Island Press is provided by The Jenifer Altman Foundation, The Bullitt Foundation, The Mary Flagler Cary Charitable Trust, The Nathan Cummings Foundation, The Geraldine R. Dodge Foundation, The Charles Engelhard Foundatio...

  16. LINGUISTIC REALITIES IN KENYA: A PRELIMINARY SURVEY

    African Journals Online (AJOL)

    Amitabh@1234

    language policies, and linguistic attitudes of the people from the elite backgrounds. The earliest missionaries-cum-educationalists, e.g. Rev. Krapf, Bishop Steere, and. Father Sacleux in United Missionary Conference in 1909 recommended biased bilingual education policies in the nation where English was adopted from.

  17. Apigenin ameliorates chronic mild stress-induced depressive behavior by inhibiting interleukin-1β production and NLRP3 inflammasome activation in the rat brain.

    Science.gov (United States)

    Li, Ruipeng; Wang, Xiangxiang; Qin, Tingting; Qu, Rong; Ma, Shiping

    2016-01-01

    Increasing evidence suggests that inflammation and oxidative stress may contribute to the development of major depressive disorder (MDD). Apigenin, a type of bioflavonoid widely found in citrus fruits, has a number of biological actions including anti-inflammatory and antioxidant effects. Although apigenin has potential antidepressant activity, the mechanisms of this effect remain unclear. The present study aims to investigate the effects of apigenin on behavioral changes and inflammatory responses induced by chronic unpredictable mild stress (CUMS) in rats. GW9662, a selective peroxisome proliferator-activated receptor gamma (PPARγ) inhibitor, was administered 30 min before apigenin. We found that treatment with apigenin (20mg/kg, intragastrically) for three weeks remarkably ameliorated CUMS-induced behavioral abnormalities, such as decreased locomotor activity and reduced sucrose consumption. In response to oxidative stress, the NLRP3 inflammasome was activated and IL-1β secretion increased in the prefrontal cortex (PFC) of CUMS rats. However, apigenin treatment upregulated PPARγ expression and downregulated the expression of NLRP3, which subsequently downregulated the production of IL-1β. In addition, GW9662 diminished the inhibitory effects of apigenin on the NLRP3 inflammasome. In conclusion, our results demonstrate that apigenin exhibits antidepressant-like effects in CUMS rats, possibly by inhibiting IL-1β production and NLRP3 inflammasome expression via the up-regulation of PPARγ expression. Copyright © 2015. Published by Elsevier B.V.

  18. Bacterial microflora of the african catfish ( Clarias gariepinus ...

    African Journals Online (AJOL)

    The bacterial microflora of a fish cum pig integrated farming system was examined during the dry season months of November to March. Clarias gariepinus fingerlings of 9.2g mean weight were stocked at a density of 5 fingerling m-2 in three freshwater earthen ponds of 200m2 surface area each that were fed 175gm-1 fresh ...

  19. Greige cotton comber noils for sustainable nonwovens

    Science.gov (United States)

    To increase utilization of cotton in value-added nonwoven products, a study was conducted to examine the feasibility of utilizing cotton textile processing/combing bye-product known as griege cotton comber noils. The study was conducted on a commercial-grade, textile-cum-nonwovens pilot plant and ha...

  20. Effect of field quantization on Rabi oscillation of equidistant cascade ...

    Indian Academy of Sciences (India)

    We have exactly solved a model of equidistant cascade four-level system interacting with a single-mode radiation field both semiclassically and quantum mechanically by exploiting its similarity with Jaynes-Cummings model. For the classical field, it is shown that the Rabi oscillation of the system initially in the first level ...

  1. Effect of field quantization on Rabi oscillation of equidistant cascade ...

    Indian Academy of Sciences (India)

    Abstract. We have exactly solved a model of equidistant cascade four-level system inter- acting with a single-mode radiation field both semiclassically and quantum mechanically by exploiting its similarity with Jaynes–Cummings model. For the classical field, it is shown that the Rabi oscillation of the system initially in the first ...

  2. Study of a Wind Energy Conversion System in New Hampshire.

    Science.gov (United States)

    1981-08-01

    distant in time or place as long as they are "reasonably foreseeable." 129 Effects which are ecological , cultural, economic, aesthetic, health related, or...1276 (West Cum. Supp. 1979). 242 16 U.S.C.A. § 1281(a) (1974). 243 See the Water Bank Act 16 U.S.C. § 1202 et. seq . (1970). The Costal Zone

  3. Critical thinking, community elders and Africa's development | Ukhun ...

    African Journals Online (AJOL)

    Critical thinking, community elders and Africa's development. ... Journal of Social Development in Africa ... In departing from other clichés and traditional modes of analysis of the challenge of Africa's development, we highlight an unarticulated factor of development – 'critical- cum- creative thinking', which has been vitiated ...

  4. A comparative study of the plasma level of arginase and rhodanese ...

    African Journals Online (AJOL)

    Chigo Okwuosa

    cancer cell lines.Nw-hydroxy-L-arginine selectively inhibit cell proliferation and induces apoptosis in MDA-. MB-468 cells.Cancer Res. 60: 3305-3312. Taylor, R., Cumming, R., Woodward, A. and Black, M. (2001). Passive smoking and lung cancer: a cumulative meta-analysis. Austr.N Z J. Pub.Health. 25: 203-211. Westley,.

  5. Information and Communications Technology (ICT) and the Seduction of Knowledge, Teaching, and Learning: What Lies Ahead for Education

    Science.gov (United States)

    Kompf, Michael

    2005-01-01

    This review essay cum discussion paper outlines areas of concern with the underlying terms and conditions of the use of information and communications technology (ICT) in education. The books that instigated this foray ( Barrell, 2001; Cuban, 2001; Maeroff, 2003) are representative of the field and represent inquiry and opinion that reflect…

  6. Hydrogen production through biocatalyzed electrolysis

    NARCIS (Netherlands)

    Rozendal, R.A.

    2007-01-01

    cum laude graduation (with distinction) To replace fossil fuels, society is currently considering alternative clean fuels for transportation. Hydrogen could be such a fuel. In theory, large amounts of renewable hydrogen can be produced from organic contaminants in wastewater. During his PhD research

  7. Leadership Aspects of Hidden Curriculum Students Practice in Nigerian Universities: A Preview of Students' Union Government Contributions in University Governance

    Science.gov (United States)

    Emesini, Nnenna Orieoma

    2016-01-01

    The paper examined the leadership aspect of Hidden Curriculum that students practice in Nigerian Universities and their contributions to university governance. Four research questions guided the study and Ex-Post-Facto Method was adopted as the design. Unstructured interviews with staff/students officials cum critical analysis of Students' Union…

  8. The Iconography of Universities as Institutional Narratives

    Science.gov (United States)

    Drori, Gili S.; Delmestri, Giuseppe; Oberg, Achim

    2016-01-01

    The coming of "brand society" and the onset of mediatization spur universities to strategize their visual identity and pay particular attention to their icon. Resulting from branding initiatives, university icons are visual self-representations and material-cum-symbolic forms of organizational identity. In this work we ask: What identity…

  9. NCBI nr-aa BLAST: CBRC-BTAU-01-0778 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0778 ref|NP_066364.2| NADH dehydrogenase subunit 6 [Schistosoma japoni...cum] gb|AAG16772.2| NADH dehydrogenase subunit 6 [Schistosoma japonicum] NP_066364.2 0.004 28% ...

  10. NCBI nr-aa BLAST: CBRC-DNOV-01-2610 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2610 ref|NP_066364.2| NADH dehydrogenase subunit 6 [Schistosoma japoni...cum] gb|AAG16772.2| NADH dehydrogenase subunit 6 [Schistosoma japonicum] NP_066364.2 9.9 26% ...

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-2064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2064 ref|NP_066200.2| NADH dehydrogenase subunit 2 [Schistosoma japoni...cum] gb|AAG13140.2| NADH dehydrogenase subunit 2 [Schistosoma japonicum] NP_066200.2 0.001 27% ...

  12. EPA's SHEDS-multimedia model: children's cumulative pyrethroid exposure estimates and evaluation against NHANES biomarker data

    Science.gov (United States)

    The U.S. EPA's SHEDS-Multimedia model was applied to enhance the understanding of children's exposures and doses to multiple pyrethroid pesticides, including major contributing chemicals and pathways. This paper presents combined dietary and residential exposure estimates and cum...

  13. Synthesis, photophysical and preliminary investigation of the dye ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 125; Issue 1. Synthesis, photophysical and preliminary investigation of the dye-sensitized solar cells properties of functionalized anthracenyl-based bipyridyl and phenanthrolyl Ru(II) complexes. Adewale O Adeloye Peter A Ajibade Frances R Cummings Lukas J Le ...

  14. Toward a Historical Archaeology of West African Borderlands ...

    African Journals Online (AJOL)

    The duo-field of historical archaeology is increasingly being recognized around the world for its contributions. However, most of the existing surveys have concentrated on the coastal and hinterland locations in West Africa. Whereas, the ethnographic cum archival study of West African borderlands abounds in the literature, ...

  15. Epigallocatechin-3-Gallate Attenuates Impairment of Learning and Memory in Chronic Unpredictable Mild Stress-Treated Rats by Restoring Hippocampal Autophagic Flux

    Science.gov (United States)

    Tang, Ya-Ling; Zeng, Yang; Jing, Kai-Quan; Zheng, Xi-Long; Liao, Duan-Fang

    2014-01-01

    Epigallocatechin gallate (EGCG) is a major polyphenol in green tea with beneficial effects on the impairment in learning and memory. Autophagy is a cellular process that protects neurons from stressful conditions. The present study was designed to investigate whether EGCG can rescue chronic unpredictable mild stress (CUMS)-induced cognitive impairment in rats and whether its protective effect involves improvement of autophagic flux. As expected, our results showed that CUMS significantly impaired memory performance and inhibited autophagic flux as indicated by elevated LC3-II and p62 protein levels. At the same time, we observed an increased neuronal loss and activated mammalian target of rapamycin (mTOR)/p70 ribosomal protein S6 kinase (p70S6k) signaling in the CA1 regions. Interestingly, chronic treatment with EGCG (25 mg/kg, i.p.) significantly improved those behavioral alterations, attenuated histopathological abnormalities in hippocampal CA1 regions, reduced amyloid beta1–42 (Aβ1−42) levels, and restored autophagic flux. However, blocking autophagic flux with chloroquine, an inhibitor of autophagic flux, reversed these effects of EGCG. Taken together, these findings suggest that the impaired autophagy in CA1 regions of CUMS rats may contribute to learning and memory impairment. Therefore, we conclude that EGCG attenuation of CUMS-induced learning and memory impairment may be through rescuing autophagic flux. PMID:25393306

  16. Challenges of Local Government Administration in Edo State of ...

    African Journals Online (AJOL)

    This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.

  17. 17 - 19_Abdussalam

    African Journals Online (AJOL)

    DR. AMINU

    Cummings publishing corporation, Reading. Acton, F. S. (1990), Numerical method that work ; corrected edition , Washington: Mathematical. Association of America. Devaney, R. L. (1987), An introduction to chaotic dynamical system, Redwood city, CA;. Addison Wesley. Henon, M (1982) physica 5D. Henon, M and Charles, ...

  18. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... the cascade Jaynes–Cummings model (JCM). Possible modification of such an effect on the collapse and revival phenomenon is also discussed by taking the quantized field in a coherent state. pp 1101-1107 Research Articles. A DC excited waveguide multibeam CO2 laser using high frequency pre-ionization technique.

  19. Atoms, Molecules and Radiation

    Indian Academy of Sciences (India)

    IAS Admin

    2015-11-10

    Nov 10, 2015 ... Module 3: Interaction of electromagnetic radiation with matter: Quantum theory of radiation, spontaneous, stimulated emission and absorption probabilities, electric dipole selection rules, Einstein A and B coefficients, Rabi coefficients, Thomson Scattering, Jaynes-Cummings Model. Module 4: Molecules ...

  20. Regenerative Stem Cell Therapy for Breast Cancer Bone Metastasis

    Science.gov (United States)

    2015-11-01

    Small Animal Bone Phenotyping Core, respectively. The authors thank Enid Keyser for technical assistance in flow cytometry and sorting and the...Receptor. Structure 2012;20:1971–82. 40. Cummings SR, SanMartin J, McClung MR, Siris ES, Eastell R, Reid IR, et al. Denosumab for prevention of fractures in

  1. Page 1 Studies in the Fl ral Morphology of the Marantaceae—II 249 ...

    Indian Academy of Sciences (India)

    Vascular anatomy of the flower of Schumannianthus virgatus Rolfe, with special reference to the labellum,”. Canadian J. Bot., 1966, 44, 1365–70. ABBREVIATIONS USED. D, carpellary dorsal; DOS, carpellary dorsal-cum-outer staminal strand; IS, inner staminal strand; L. labellum; MS, median bundle of a sepal; N, nectary; ...

  2. The South Carolina Collaborative Undergraduate HBCU Student Summer Training Program

    Science.gov (United States)

    2014-03-01

    Biomechanics – BSB 451 Hai Yao, PhD July 11 (C) Smoking & Cancer Michael Cummings, PhD July 11 (D) Periodontal Disease – BSB 451 Keith...Institute and Department of Biomedical Engineering John Hopkins University 3:00-3:50 pm Title: "CANCER - The Close Cousin of Wound Healing " Kapil

  3. Behavioral and molecular responses to electroconvulsive shock differ between genetic and environmental rat models of depression.

    Science.gov (United States)

    Luo, Jie; Min, Su; Wei, Ke; Cao, Jun; Wang, Bin; Li, Ping; Dong, Jun; Liu, Yuanyuan

    2015-04-30

    Depression׳s causes play a role in individuals׳ different responses to antidepressant treatments, which require advancements. We investigated the mechanisms behind and responses to a highly effective antidepressant treatment, electroconvulsive therapy (ECT), in rat models with different (genetic or environmental) depression causes. Wistar Kyoto (WKY) rats and Wistar rats treated with chronic unpredictable mild stresses (CUMS) were used as genetic and environmental rat models of depression, respectively. The rats underwent electroconvulsive shock (ECS, the animal analog of ECT) or sham ECS. We performed a sucrose preference test, open field test, and Morris water maze to assess behavior. Hippocampal neuron numbers were measured with Nissl stain. Hippocampal BDNF, CREB, and p-CREB proteins were assayed with ELISA or western blotting. The main results showed that ECS impaired WKY rats׳ memories but improved CUMS rats׳ memories. It elevated hippocampal BDNF and CREB proteins only in CUMS rats, while it improved depressive behavior and hippocampal p-CREB protein levels in both rats, with more effective regulations in the CUMS rats. ECS did not change the hippocampal neuron number in both rats. These findings suggest that ECS exerted up-regulating effects on hippocampal BDNF and CREB (and its phosphorylation) in depressed rats, and the environmental model responded better. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  4. STUDENTS IN ILE-IFE, OSUN STATE, NIGERIA

    African Journals Online (AJOL)

    need for school eye screening cum intervention among. Nigerian children so as to prevent amblyopia and subsequent blindness. Key words: adolescent, students, eye disorders, school eye health. INTRODUCTION. There have been many reports on the prevalence of eye diseases and visual impairment in school children ...

  5. The Impacts of Swimming Exercise on Hippocampal Expression of Neurotrophic Factors in Rats Exposed to Chronic Unpredictable Mild Stress

    Directory of Open Access Journals (Sweden)

    Pei Jiang

    2014-01-01

    Full Text Available Depression is associated with stress-induced neural atrophy in limbic brain regions, whereas exercise has antidepressant effects as well as increasing hippocampal synaptic plasticity by strengthening neurogenesis, metabolism, and vascular function. A key mechanism mediating these broad benefits of exercise on the brain is induction of neurotrophic factors, which instruct downstream structural and functional changes. To systematically evaluate the potential neurotrophic factors that were involved in the antidepressive effects of exercise, in this study, we assessed the effects of swimming exercise on hippocampal mRNA expression of several classes of the growth factors (BDNF, GDNF, NGF, NT-3, FGF2, VEGF, and IGF-1 and peptides (VGF and NPY in rats exposed to chronic unpredictable mild stress (CUMS. Our study demonstrated that the swimming training paradigm significantly induced the expression of BDNF and BDNF-regulated peptides (VGF and NPY and restored their stress-induced downregulation. Additionally, the exercise protocol also increased the antiapoptotic Bcl-xl expression and normalized the CUMS mediated induction of proapoptotic Bax mRNA level. Overall, our data suggest that swimming exercise has antidepressant effects, increasing the resistance to the neural damage caused by CUMS, and both BDNF and its downstream neurotrophic peptides may exert a major function in the exercise related adaptive processes to CUMS.

  6. Die invloed van liggaamsparameters op die reproduksieprestasie ...

    African Journals Online (AJOL)

    SMITH, J.F., RATTRAY, P.V., JAGUSCH, K.T., COX,. N.R & TERVIT, J.R, 1979. Ovulation-liveweight relationships in ewes. Proc. N. Z. Soc. Anim. Prod. 39,50. SPIEGEL, M.R., 1961. Statistics. Schaum's outline series. Theory and problems. Schaum Publishing Co., New York. WILLIAMS, AH. & CUMMING, LA., 1982. Inverse.

  7. Performance Assessment of Two- Wheel Tractor on a Loamy Sand ...

    African Journals Online (AJOL)

    Field performance evaluation of a 9kW two-wheel tractor has been carried out. Field operations carried out include: disc ploughing, mould board ploughing, cultivation, cultivation cum planting and harvesting; following the types of accompanying implements available. The parameters measured and determined for each ...

  8. What I Think I May Have Learned--Reflections on 50 Years of Teaching: An Interview with Michael Wertheimer

    Science.gov (United States)

    Michael, Kurt D.

    2006-01-01

    Kurt Michael is an associate professor in the Department of Psychology at Appalachian State University (ASU) where he teaches history and systems of psychology, abnormal psychology, child psychopathology, and interventions for children and adolescents. He received his BA (cum laude) from the University of Colorado at Boulder and his MS and PhD in…

  9. Flax fiber reinforced PLA composites: studies on types of PLA and different methods of fabrication

    CSIR Research Space (South Africa)

    Kumar, R

    2011-05-01

    Full Text Available in the last decade. It is well known that natural fiber reinforced PLA composites can be prepared by solution casting cum compression molding and injection molding methods. The authors have prepared flax fiber reinforced PLA (procured from Cereplast Ltd...

  10. Improving waterfowl population estimates using hierarchical models: A new approach

    OpenAIRE

    Barker, Nicole; Cumming, Steve; Darveau, Marcel

    2013-01-01

    Recommended citation: Barker, N. K. S., S. G. Cumming, and M. Darveau. 2013. Improving waterfowl population estimates using hierarchical models: A new approach. Poster, Ecology and Conservation of North American Waterfowl. Memphis, TN, USA. Retrieved from figshare: http://dx.doi.org/10.6084/m9.figshare.658776.

  11. Touraine Solente Gole syndrome: the disease and associated tongue fissuring.

    Science.gov (United States)

    Athappan, Ganesh; Unnikrishnan, Athira; Chengat, Vipindas; Chandraprakasam, Satish; Arthanareeswaran, Vinodhkumaradithya; Muthukrishnan, Srinivasan; Ponniyah, Thirumalaikolundusubramanian

    2009-07-01

    Touraine Solente Gole syndrome, a relatively rare inherited disorder is epitomized by finger clubbing, skeletal changes and pachyderma. We report a typical case of complete pachydermoperiostosis in addition to a thick fissured tongue, a yet unrecognized association and discuss the social cum clinical relevance of identifying this relatively uncommon disorder.

  12. Organic waste reclamation, recycling and re-use in integrated fish ...

    African Journals Online (AJOL)

    The purpose of this paper is to create awareness on the significance of integrated fish farming in organic waste reclamation, recycling and re-use. Example of integrated fish farming practiced at a micro-level in the Niger Delta of Nigeria is crop-snailry-poultry (Chicken) – livestock (pig) – cum-fish production. In this system ...

  13. Design and Study of a Low-Cost Laboratory Model Digital Wind Power Meter

    Science.gov (United States)

    Radhakrishnan, Rugmini; Karthika, S.

    2010-01-01

    A vane-type low-cost laboratory model anemometer cum power meter is designed and constructed for measuring low wind energy created from accelerating fluids. The constructed anemometer is a device which records the electrical power obtained by the conversion of wind power using a wind sensor coupled to a DC motor. It is designed for its…

  14. Computer aided cooling curve analysis for Al-5Si and Al-11Si alloys ...

    African Journals Online (AJOL)

    The effect of grain refiner, modifier, and combination of grain refiner cum modifier was studied on Al-5Si and Al-11Si alloys using computer aided cooling curve analysis. For combined grain refinement and modification effect, Al-Ti-B-Sr single master alloy was developed that acted as both grain refiner and modifier.

  15. Description de deux Hydrocoptus (Dytiscidae) nouveaux

    NARCIS (Netherlands)

    Régimbart, M.

    1892-01-01

    Long. 2 1/3 mill. — Oblongo-ovalis, minime attenuatus, convexus, rufus; supra subtilissime reticulatus, subopacus; capite et pronoto rufo-ferrugineis, in medio vage adumbratis, hoc ad latera antice arcuato et postice cum elytris continuo; elytris nigro-fuscis, fortiter reticulatis, subopacis,

  16. Author Details

    African Journals Online (AJOL)

    Cumming, G.S.. Vol 35, No 1 (2000) - Articles Host use does not clarify the evolutionary history of African ticks (Acari: Ixodoidea) Abstract. ISSN: 2224-073X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions ...

  17. Low-cost transparent solar cells: Potential of TiO2 nanotubes in the improvement of these next generation solar cells

    CSIR Research Space (South Africa)

    Cummings, F

    2010-09-01

    Full Text Available , PO Box 395, Pretoria, 0001 2Department of Physics, University of the Western Cape, Modderdam Road, Private Bag x17, Bellville, Cape Town 7535, South Africa *Corresponding author: Franscious Cummings: fcummings@csir.co.za Reference: EN15-PA-F...

  18. ISLAM IN THE NON-MUSLIM AREAS OF NORTHERN NIGERIA, c

    African Journals Online (AJOL)

    QUADRI Y A

    This paper reviews the phenomenon of pornography in postcolonial. Nigeria. It seeks to evaluate the 'porn tradition' of the modern world order vis-à-vis the traditional perception of sex and sexual morals in. Owan (Edo) society. The expository cum evaluative approach was adopted. The paper came up with the findings that; ...

  19. Encounters with Europe

    NARCIS (Netherlands)

    Bagchi, B.|info:eu-repo/dai/nl/303132396

    2014-01-01

    A Voyage to Modernism: Syed Ahmed Khan Syed Ahmed Khan travelled from Benares in India to London in England in 1869, spent seventeen months in England, and returned to India in 1871. He wrote an Urdu travelogue, in letter-cum-journal form, about his voyage, and this appeared in different issues of

  20. Assessing urban forest structure: summary and conclusions

    Science.gov (United States)

    David J. Nowak

    2008-01-01

    This special issue has presented data on several topics related to assessing urban forest structure. These topics include means to measure urban forest cover from aerial-based platforms (Walton et al. 2008), national and local ground-based assessments of urban forest structure and functions (Cumming et al. 2008; Nowak et al. 2008a), measurement of street tree...

  1. The conservation and use of crop genetic resources for food security

    NARCIS (Netherlands)

    Khoury, C.K.

    2015-01-01

    Cum laude graduation
    Among the factors hindering the conservation of crop genetic resources is a lack of essential information regarding this diversity. Questions include: (a) what is the status of diversity in our food systems, and where are the greatest vulnerabilities?, (b) where can genetic

  2. SOUTH AFRICA AND THE WAR AGAINST JAPAN 1941-1945

    African Journals Online (AJOL)

    Second World War contain few details of South . Africans who served in the Far East. Commander. H.R. Gordon-Cumming's unpublished Official His- tory of the SA Naval Forces in the Second World. War 1939-1945 includes narratives of the two South. African ships which served in the Far East, HMSAS. BARBRAKE.

  3. A Spatial Display for Ground Penetrating Radar

    Science.gov (United States)

    2015-04-14

    applications such as construction, humanitarian demining, archeology , and environmental science. In each of these applications, special sig- nal... archeology , and mining Paul W. Quimby: pquimby@mit.edu Dr. Mary Cummings is affiliated with Duke University Dr. Matthew Cornick is affiliated with MIT

  4. Particle separation and fractionation by microfiltration

    NARCIS (Netherlands)

    Kromkamp, J.

    2005-01-01

    cum laude graduation (with distinction) For the production of present-day dairy products, raw milk is often considered an entity. However, a large quality improvement could be reached if selected constituents were available. In order to achieve this, milk will have to be fractionated prior to use in

  5. Writing in the L2 Classroom: Issues in Research and Pedagogy.

    Science.gov (United States)

    Manchon, Rosa M., Ed.

    2001-01-01

    Articles in this special issue include the following: "Learning to Write in a Second Language: Two Decades of Research" (Alister Cumming); "Some Steps Towards a Socio-Cognitive Interpretation of Second Language Composition Processes" (Julio Delarios Roca, Liz Murphy Liz); "Trends in the Conceptualizations of Second Language Composing Strategies: A…

  6. ' ' ~Case Report '

    African Journals Online (AJOL)

    2001-08-03

    Aug 3, 2001 ... bear weight. The dog was placed on piroxicam® capsules (anti-inflammatory cum analgesic) 20mg orally for two days and radiograph'0f the affected limb was recommended. The radiograph (Fig. 1) showed a complete oblique mid-shaft femoral fracture, and the. 45. Fig. £3H-;»Cornplete oblique mid-shaft ...

  7. Process development for gelatinisation and enzymatic hydrolysis of starch at high concentrations

    NARCIS (Netherlands)

    Baks, T.

    2007-01-01

    cum laude graduation (with distinction) Enzymatic hydrolysis of starch is encountered in day-to-day life for instance in the dishwasher during removal of stains with detergents or in our mouth during chewing of starch-based foods in the presence of saliva. The reaction is also important for the

  8. Department of Homeland Security Semiannual Regulatory Agenda

    Science.gov (United States)

    2010-04-26

    ... before these foreign workers and investors are required to convert into U.S. immigrant or nonimmigrant.... Cummings, Chief of Business and Foreign Workers Division, Department of Homeland Security, U.S. Citizenship... filed on behalf of alien workers subject to annual numerical limitations. This rule proposes an...

  9. 75 FR 21805 - Unified Agenda of Federal Regulatory and Deregulatory Actions

    Science.gov (United States)

    2010-04-26

    ... necessary to reduce the potential harm to the CNMI economy before these foreign workers and investors are... Flexibility Analysis Required: Yes Agency Contact: Kevin J. Cummings, Chief of Business and Foreign Workers... proposing to amend its regulations governing petitions filed on behalf of alien workers subject to annual...

  10. Formation of nanoscale tungsten oxide structures and colouration ...

    Indian Academy of Sciences (India)

    In this work, pH dependent evolution of tungsten oxide (WO3) nanostructures is being reported along with physical characteristics. The synthesis was carried out via an inexpensive solvothermal cum chemical reduction route, with sodium tungstate (Na2WO4) and cetyl trimethyl ammonium bromide (C19H42NBr) as main ...

  11. 12 Layout ppp2

    African Journals Online (AJOL)

    Nubidga

    traditional, centrally-managed, supply-driven and expert-controlled emphasis towards more demand-driven, beneficiary-focused participatory approaches that put local stakeholders cum beneficiaries par .... Community and economic development chain. (Source: Philips & Pittman, 2009). Capacity Building. Comm. Dev.

  12. Seventeen-lump model for the simulation of an industrial fluid ...

    Indian Academy of Sciences (India)

    A 17-lump kinetic model has been developed for the riser–reactor cum regenerator of a fluid catalytic cracking unit (FCCU). This accounts for cracking, hydrogen transfer, aromatization, isomerization, alkylation and dimerization, as well as catalyst deactivation due to the coke deposition in its pores. A model forthe industrial ...

  13. 78 FR 63275 - Senior Executive Service Performance Review Boards Membership

    Science.gov (United States)

    2013-10-23

    ... Secretary Abraham, Julie; Brown, Gregory A.; Fields, George C.; Forsgren, Janet R; Geier, Paul M.; Gretch..., William A. III; Smith, Steven K.; Van Steenburg, John W. Federal Railroad Administration Cummings, Stacy A..., Brenda J.; Nissenbaum, Paul; Pennington, Rebecca A.; Porter, Melissa L.; Tunna, John M. Federal Transit...

  14. Download this PDF file

    African Journals Online (AJOL)

    disorders among secondary school students. There is a need for school eye screening cum intervention among .... All data were entered into a computer spread sheet using descriptive analysis on the commercially available software ... Assessment of referral criteria for error of refractions. Nig JOpthl 1977(5)1:34-40. Maul E ...

  15. Implementation Issues in Rural Development in Sub-Saharan ...

    African Journals Online (AJOL)

    It is a credo amongst scholars cum academics all over the globe that well coordinated and elaborate programmes and policies of rural development mounted by the third world countries in sub-Saharan Africa will lift her entire citizenry from manacle of gross underdevelopment to a region of development in all facets of their ...

  16. PHILOSOPHY IN CONTEMPORARY TIME: RELEVANCE VS ...

    African Journals Online (AJOL)

    JONATHAN

    educational sector. This proper training of the human mind with the tool of philosophy translates to human cum societal enhancement. Keywords: Philosophy, Contemporary, Reason, Public Perception, Societal Development. Introduction. Philosophy, as an area of study is nowadays attracting a lot of lack of patronage for ...

  17. A POINT OF TRANSFORMATION? (A REFLECTION)

    African Journals Online (AJOL)

    the rationalist cum empiricist controversy, thanks to Kant for his mediation. My attention is drawn to the arch empiricist David Hume who denied the self of course on account of his disregard for metaphysics, he did say that all works on metaphysics should be thrown to the flames as they are meaningless. He denied the self ...

  18. Description d’un genre nouveau de la famille des Clérides

    NARCIS (Netherlands)

    Fairmaire, L.

    1887-01-01

    Tarsi quadriarticulati. Prothorax haud marginatus, lateribus cum pleuris confusis. Oculi antice emarginati, subtiliter granulati. Antennæ breves, ab articulo 5° late serratae, articulo 4° brevissimo, ultimo emarginato, apice sat acuto. Palpi omnes articulo ultimo elongato, acuto. Elytra apice

  19. Concentration reduction of selected pollutants in fish culture ...

    African Journals Online (AJOL)

    Culture effluents collected from the fish rearing tanks in African catfish monoculture and African catfish cum Tilapia polyculture systems were run through the biological filters with PKS and PDS as media. Water quality parameters in influent and effluent from each of the biofilter were assessed using standard methods.

  20. Height-Diameter Predictive Equations for Rubber ( Hevea ...

    African Journals Online (AJOL)

    Many of the resulting models and curves agreed with silvicultural expectation of sigmoidal growth functions; and can provide dependable cum flexible options of predicting heights, given dbh for many plantation species in Nigeria. Keywords: height-diameter equations, allometric models, predictive equations, sigmoidal ...

  1. Comparing the Nordic and South Korean Models: Labour-Market Regulation and Social Welfare in Times of Crisis

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk

    2012-01-01

    The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models of contemporary capitalism – the discredited Anglo-Saxon finance-driven model versus the export...

  2. Labor, Welfare and Coping with the Crisis

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk

    the analysis is based on a critical political economy perspective which utilizes a comparative and eclectic methodology. The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models...

  3. Dicty_cDB: Contig-U05795-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.085 1 ( AC146115 ) Pan troglodytes BAC clone RP43-38M17 from chromos... 50 0.085 1 ( L43277 ) Echium russi...cum clone russ.ab.s gene, trnT(UGU)-trn... 50 0.085 1 ( L33355 ) Echium russicum Gmel. chloroplast trnT(UGU)

  4. · ORIGINAL ARTICLES

    African Journals Online (AJOL)

    Maccato M, Estrada R. Hammill H. Faro S. Prevalence of arute ChlamydiD tradwmatis infection at the lime of exploratory laparotomy for ectopic pregnanc)'. Obstet GYlleroI1992;. 79: 211-213. 32. Cu.mming DC, Honore LH, Scott J2, Williams KE. Microscopic e\\'idence of silent inflammation in grossly normal faUopian tubes ...

  5. Download this PDF file

    African Journals Online (AJOL)

    previouslyr isolated from the leaves of Pithecellobium cubense Bisse and P. arbor-cum i... lLeguminosae) (5). Recently, Adewunmi et. cl. (6,?) reported on the effects of aridanin on Biomphalario globratc Say and Lymnaea columello. Say. In our preliminary investigation the stem bark of T. tetroptero showed a stronger ...

  6. Alpha particle induced reactions on {sup nat}Cr up to 39 MeV: Experimental cross-sections, comparison with theoretical calculations and thick target yields for medically relevant {sup 52g}Fe production

    Energy Technology Data Exchange (ETDEWEB)

    Hermanne, A.; Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel, Brussel 1090 (Belgium); Tárkányi, F.; Takács, S. [Institute of Nuclear Research, Hungarian Academy of Science, 4026 Debrecen (Hungary)

    2015-08-01

    Thin {sup nat}Cr targets were obtained by electroplating, using 23.75 μm Cu foils as backings. In five stacked foil irradiations, followed by high resolution gamma spectroscopy, the cross sections for production of {sup 52g}Fe, {sup 49,51cum}Cr, {sup 52cum,54,56cum}Mn and {sup 48cum}V in Cr and {sup 61}Cu,{sup 68}Ga in Cu were measured up to 39 MeV incident α-particle energy. Reduced uncertainty is obtained by simultaneous remeasurement of the {sup nat}Cu(α,x){sup 67,66}Ga monitor reactions over the whole energy range. Comparisons with the scarce literature values and results from the TENDL-2013 on-line library, based on the theoretical code family TALYS-1.6, were made. A discussion of the production routes for {sup 52g}Fe with achievable yields and contamination rates was made.

  7. Drug: D03374 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03374 Crude, Drug Capsicum (JP16/USP); Powdered capsicum (JP16); Capsicum (TN) Cap...cum (JP16/USP); Powdered capsicum (JP16) Crude drugs [BR:br08305] Dicot plants: asterids Solanaceae (nightshade family) D03374 Capsicum PubChem: 47205831 ...

  8. Ergonomic Based Design and Survey of Elementary School Furniture

    Science.gov (United States)

    Maheshwar; Jawalkar, Chandrashekhar S.

    2014-01-01

    This paper presents the ergonomic aspects in designing and prototyping of desks cum chairs used in elementary schools. The procedures adopted for the assessment included: the study of existing school furniture, design analysis and development of prototypes. The design approach proposed a series of adjustable desks and chairs developed in terms of…

  9. Cognitive Adaptability: The Role of Metacognition and Feedback in Entrepreneural Decision Policies

    Science.gov (United States)

    2005-01-01

    decision might be" (Downey, Hellriegel & Slocum, 1975; Duncan, 1972; Schmidt & Cummings, 1976) 7 The idea of uncertainty is fundamental to...hospital industry: evaluating strategic competencies. Strategic Management Journal, 24: 333-348. Downey, H.., Hellriegel , D. & Slocum, W. 1975

  10. An Investigation of the Pragmatic Deviance of Metaphor in ...

    African Journals Online (AJOL)

    The theory of implicature propounded by Grice brings to linguistic enquiry the concept that speakers often say more than is semantically coded. This phenomenon, being pervasively employed in metaphoric language, engenders a semantic cum pragmatic symbiotic approach to the interpretation of tropes – a model that ...

  11. Human-Automation Collaboration in Complex Multivariate Resource Allocation Decision Support Systems

    Science.gov (United States)

    2010-01-01

    the Office of Naval Research (Code 34). We would like to thank Cláudia Ferraz, Andrew Hsiao, Javier Garcia , Andrew Clare, Albert Leung, Anunaya...ASNE Human Systems Integration Symposium, Annapolis, MD, USA, 2007. [6] S. Bruni, J. Marquez , A. Brzezinski, and M.L. Cummings, Visualizing

  12. 360 Principals' Perception of Educational Inputs and Students ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... educational inputs affect the academic performance of students. Review of related literature ... classroom tends to improve student's academic and behavioural outcomes. (Cummings, 2000; Quinn et al., 2000; ... behaviour, character, taste, attitude, conduct and outlook on life. The Library also enables the ...

  13. Ruminant nutrition research in South Africa during the decade ...

    African Journals Online (AJOL)

    (NOj-N) levels in ryegrass herbage (De Villiers & Van Rys- sen, 1991), whereas the level of non-structural carbohydrate and DM content of the herbage decreased. Similarly, in Pani- cum maximum cv Gatton, Van Niekerk et al. (1993) found that an increase in N application from 0 to 150 kg N/ha increased the N content by ...

  14. Temperature dependent grain-size and microstrain of CdO thin films ...

    Indian Academy of Sciences (India)

    Administrator

    droplet reaching the hot substrate surface undergoes pyrolytic decomposition and forms the desired product. The other volatile by-products ... from an air compressor via an air filter-cum regulator was used as the carrier gas and spray rate of the solution was maintained at 3 ml/min. To avoid excessive cooling of substrates ...

  15. the relevance of libraries and information communicaton technology ...

    African Journals Online (AJOL)

    GRACE

    century unable to read a book and write their names. Unfortunately, most of these illiterate people are found in sub-Saharan Africa, with Nigeria having the greatest number (UNO Report 2003). The illiteracy level of Nigeria today has no doubt resulted to ethnic, religious, political cum economic crisis, which are the most.

  16. The Defense Civilian Workforce - Transformational Changes

    Science.gov (United States)

    2003-04-07

    Bell, Jr. and Robert A. Zawacki (Burr Ridge, Illinois: Irwin, Inc, 1994), 82. 8 Thomas G. Cummings and Edgar R. Huse, Organization Development and Change...and Transformation, Managing Effective Change, ed. Wendell L. French, Cecil H. Bell, Jr. and Robert A. Zawacki , 82-103. Burr Ridge, Illinois: Irwin

  17. Download this PDF file

    African Journals Online (AJOL)

    systems will be the most appropriate weapon to fight hunger and poverty in sub-. Saharan Africa. The development of such systems .... adaptive research pond. Figure 2: Some physico-chemical parameters of the fish, rice cum piggery integration ..... held in Rome, Italy, 10 – 14 December 1990. FAO Animal Production and.

  18. Noncombatants and liability to be attacked in wars

    DEFF Research Database (Denmark)

    Lippert-Rasmussen, Kasper

    2013-01-01

    attack," I mean that S has forfeited his or her right not to be attacked by armed forces. Here, "liable" is used in a normative-cum-legal sense, not descriptively as it is when one says "some colors are liable to darken in perpetual shade," and "attack" is used passively, as an equivalent of be attacked...

  19. An interesting new Bulbophyllum

    NARCIS (Netherlands)

    Smith, J.J.

    1935-01-01

    Bulbophyllum (sect. Cirrhopetalum) Jacobsonii J. J. S. n. sp. — Rhizoma repens, teres. Pseudobulbi remoti, oblique ovoidei, manifesto quadranguli cum lateribus concavis, 1.8 cm longi, 0.75 et 0.95 cm diam., 1-folii. Folium lanceolatum, apice recurvulum, basi brevissime

  20. Globalisation and the state: implications for the state of human rights ...

    African Journals Online (AJOL)

    Globalisation and the state: implications for the state of human rights in Africa. ... Inkanyiso: Journal of Humanities and Social Sciences ... This article interrogates, in theoretical cum descriptive fashion, the linkage(s) between neo-liberal globalisation, the state, and the state of human rights, using sub-Sahara Africa as a ...

  1. Effects of Pig Manure on the Growth Rate of Oreochromis niloticus ...

    African Journals Online (AJOL)

    The growth response of Oreochromis niloticus (mean weight = 7.54 ± 0.91g) was determined under integrated fish cum piggery system at the African Regional Aquaculture Centre (ARAC), Port Harcourt, Nigeria. The experiment was conducted for 10 weeks between October and December 1999 in order to determine fish ...

  2. A 1 V supercapacitor device with nanostructured graphene oxide ...

    Indian Academy of Sciences (India)

    Polyaniline and graphene oxide composite on activated carbon cum reduced graphene oxide-supported supercapacitor electrodes are fabricated and electrochemically characterized in a three-electrode cell assembly. Attractive supercapacitor performance, namely high-power capability and cycling stability for graphene ...

  3. Exact and useful optimization methods for microeconomics

    NARCIS (Netherlands)

    Balder, E.J.|info:eu-repo/dai/nl/21623896X

    2011-01-01

    This paper points out that the treatment of utility maximization in current textbooks on microeconomic theory is deficient in at least three respects: breadth of coverage, completeness-cum-coherence of solution methods and mathematical correctness. Improvements are suggested in the form of a

  4. Poetry corner.

    Science.gov (United States)

    Fox Lee, Shayna

    2017-05-01

    This section briefly presents poetry with a psychology theme. This submission was made by The Cummings Center for the History of Psychology's reference archivist Lizette Royer. Two transcribed poems by Knight Dunlap are presented. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  5. The Festering Sore of Corruption in Africa and its Implications for ...

    African Journals Online (AJOL)

    This article interrogates, in theoretical cum descriptive fashion, the nexus between corruption and democracy, using sub- Saharan Africa as a research backdrop. Drawing mainly from secondary data and leaning towards a modernisation theoretical framework, it argues that the festering sore of corruption has produced ...

  6. Nigerian Journal of Fisheries - Vol 4, No 2 (2007)

    African Journals Online (AJOL)

    Bacterial microflora of the african catfish (Clarias gariepinus) juveniles raised under fish cum pig integrated farming system in freshwater earthen ponds during the dry season. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M-M A Akinwale, RI Keke, E Chidiebere, 91-104.

  7. Complete preservation of ophiolite suite from south Andaman, India ...

    Indian Academy of Sciences (India)

    from Sumatra towards Java (Vohra et al 1989). Further, the Andaman islands, the central part of. Burma–Java subduction complex is also believed to expose tectonostratigraphic units of accretionary prism in an outer-arc setting (Pal et al 2003). From east to west there are four such structural cum topographic zones which ...

  8. Kristi Salve kaitses doktoriväitekirja / Mall Hiiemäe

    Index Scriptorium Estoniae

    Hiiemäe, Mall, 1937-

    2000-01-01

    Kristi Salve kaitses 20. dets.̀1999 Tartu Ülikooli kirjanduse ja rahvaluule osakonnanõukogu ees väitekirja : Läänemeresoomlaste traditsiooniline vaimne kultuur : pärimusliikide vahelised seosed ja etnilised suhted / Kristi Salve. Tartu, 1999. 287 lk. Talle omistati doktorikraad folkloristika alal hinnanguga summa cum laude

  9. The First Treatise in Comparative Education Rediscovered

    Science.gov (United States)

    Lenhart, Volker

    2016-01-01

    The Latin essay "De re Scholastica Anglica cum Germanica Comparata" (English and German school education compared) published in 1795-1798 by the Freiberg/Saxony grammar school principal Friedrich August Hecht is the first treatise in comparative education. The rediscovery of the text, its earlier mentioning in the history of comparative…

  10. Gondwanamyia, a new empidoid (Diptera genus of uncertain placement

    Directory of Open Access Journals (Sweden)

    Bradley J. Sinclair

    2016-10-01

    Full Text Available A new minute-size empidoid fly genus, Gondwanamyia gen. n. and two new species (G. chilensis Cumming & Saigusa, sp. n., G. zealandica Sinclair & Brooks, sp. n. are described, illustrated, and their distributions mapped. The family and subfamily assignments remain uncertain, but features of the female terminalia potentially suggest Trichopezinae (Brachystomatidae.

  11. High-Yield Preparation and Electrochemical Properties of Few-Layer MoS2 Nanosheets by Exfoliating Natural Molybdenite Powders Directly via a Coupled Ultrasonication-Milling Process.

    Science.gov (United States)

    Dong, Huina; Chen, Deliang; Wang, Kai; Zhang, Rui

    2016-12-01

    Cost-effective and scalable preparation of two-dimensional (2D) molybdenum disulfide (MoS2) has been the bottleneck that limits their applications. This paper reports a novel coupled ultrasonication-milling (CUM) process to exfoliate natural molybdenite powders to achieve few-layer MoS2 (FL-MoS2) nanosheets in the solvent of N-methyl-2-pyrrolidone (NMP) with polyvinylpyrrolidone (PVP) molecules. The synergistic effect of ultrasonication and sand milling highly enhanced the exfoliation efficiency, and the precursor of natural molybdenite powders minimizes the synthetic cost of FL-MoS2 nanosheets. The exfoliation of natural molybdenite powders was conducted in a home-made CUM system, mainly consisting of an ultrasonic cell disruptor and a ceramic sand mill. The samples were characterized by X-ray diffraction, UV-vis spectra, Raman spectra, FT-IR, SEM, TEM, AFM, and N2 adsorption-desorption. The factors that influence the exfoliation in the CUM process, including the initial concentration of natural molybdenite powders (C in, 15-55 g L(-1)), ultrasonic power (P u, 200-350 W), rotation speed of sand mill (ω s, 1500-2250 r.p.m), exfoliation time (t ex, 0.5-6 h), and the molar ratio of PVP unit to MoS2 (R pm, 0-1), were systematically investigated. Under the optimal CUM conditions (i.e., C in = 45 g L(-1), P u = 280 W, ω s = 2250 r.p.m and R pm = 0.5), the yield at t ex = 6 h reaches 21.6 %, and the corresponding exfoliation rate is as high as 1.42 g L(-1) h(-1). The exfoliation efficiency of the CUM mode is much higher than that of either the ultrasonication (U) mode or the milling (M) mode. The synergistic mechanism and influencing rules of the CUM process in exfoliating natural molybdenite powders were elaborated. The as-obtained FL-MoS2 nanosheets have a high specific surface area of 924 m(2) g(-1) and show highly enhanced electrocatalytic performance in hydrogen evolution reaction and good electrochemical sensing property in

  12. The Functional Study of a Chinese Herbal Compounded Antidepressant Medicine--Jie Yu Chu Fan Capsule on Chronic Unpredictable Mild Stress Mouse Model.

    Directory of Open Access Journals (Sweden)

    Lingling Ding

    Full Text Available Jie Yu Chu Fan capsule (JYCF is a new compounded Chinese herbal medicine for the treatment of depression. The present study was designed to explore the antidepressant effects and the possible mechanisms of JYCF by using chronic unpredictable mild stress (CUMS mouse model and comparing results to that of fluoxetine. Behavioral tests including an open field test, sucrose preference test and forced swim test were performed to evaluate the antidepressant effects of JYCF. The concentrations of monoamine neurotransmitters and metabolic products including norepinephrine (NE, 5-hydroxytryptamine (5-HT, dopamine (DA, 5-hydroxyindoleacetic acid (5-HIAA, homovanillic acid (HVA and 3,4-dihydroxyphenylacetic acid (DOPAC in the cerebral cortex and hippocampus of mice were determined by means of high performance liquid chromatography with electrochemical detection (HPLC-EC. The results show that a successful mouse CUMS model was established through 5 weeks of continuous unpredictable stimulation, as indicated by the significant decrease in sucrose preference and locomotor activity and increase in immobility time in the forced swim test. Chronic treatment of JYCF (1.25, 2.5 and 5 g/kg and fluoxetine (20 mg/kg significantly reversed the CUMS-induced behavioral abnormalities. JYCF (1.25, 2.5 and 5 g/kg significantly increased NE in CUMS mouse prefrontal cortex (P < 0.01, P < 0.01, P < 0.05 respectively and 5-HT in hippocampus (P < 0.05. In summary, our findings suggest that JYCF exerts comparable antidepressant-like effects to that of fluoxetine in CUMS mice. Besides, the antidepressant-like effect of JYCF is mediated by the increase of monoaminergic transmitters including 5-HT and NE.

  13. Reactions of the cumyloxyl and benzyloxyl radicals with strong hydrogen bond acceptors. Large enhancements in hydrogen abstraction reactivity determined by substrate/radical hydrogen bonding.

    Science.gov (United States)

    Salamone, Michela; DiLabio, Gino A; Bietti, Massimo

    2012-12-07

    A kinetic study on hydrogen abstraction from strong hydrogen bond acceptors such as DMSO, HMPA, and tributylphosphine oxide (TBPO) by the cumyloxyl (CumO(•)) and benzyloxyl (BnO(•)) radicals was carried out in acetonitrile. The reactions with CumO(•) were described in terms of a direct hydrogen abstraction mechanism, in line with the kinetic deuterium isotope effects, k(H)/k(D), of 2.0 and 3.1 measured for reaction of this radical with DMSO/DMSO-d(6) and HMPA/HMPA-d(18). Very large increases in reactivity were observed on going from CumO(•) to BnO(•), as evidenced by k(H)(BnO(•))/k(H)(CumO(•)) ratios of 86, 4.8 × 10(3), and 1.6 × 10(4) for the reactions with HMPA, TBPO, and DMSO, respectively. The k(H)/k(D) of 0.91 and 1.0 measured for the reactions of BnO(•) with DMSO/DMSO-d(6) and HMPA/HMPA-d(18), together with the k(H)(BnO(•))/k(H)(CumO(•)) ratios, were explained on the basis of the formation of a hydrogen-bonded prereaction complex between the benzyloxyl α-C-H and the oxygen atom of the substrates followed by hydrogen abstraction. This is supported by theoretical calculations that show the formation of relatively strong prereaction complexes. These observations confirm that in alkoxyl radical reactions specific hydrogen bond interactions can dramatically influence the hydrogen abstraction reactivity, pointing toward the important role played by structural and electronic effects.

  14. Antidepressant-like effects of curcumin on serotonergic receptor-coupled AC-cAMP pathway in chronic unpredictable mild stress of rats.

    Science.gov (United States)

    Li, Yu-Cheng; Wang, Fu-Meng; Pan, Ying; Qiang, Li-Qin; Cheng, Guang; Zhang, Wei-Yun; Kong, Ling-Dong

    2009-04-30

    Serotonergic receptors take their physiologic effects by affecting adenylyl cyclase (AC) catalytic activity and cyclic adenosine monophosphate (cAMP) concentration. AC-cAMP second messenger pathway has been recently suggested to play an important role in depression. Therefore, the compound that regulates the signal pathway may have potential as antidepressant. Curcumin is the main component of Curcuma longa L, a well-known indigenous herb with comprehensive bioactivities. In the present study, we investigated the effects of chronic unpredictable mild stress (CUMS) and curcumin on behaviours and serotonergic receptor-coupled AC-cAMP signal pathway in rats. Curcumin produced beneficial effects on the stressed rats by effectively improving CUMS-induced low sucrose consumption and reducing serum corticosterone levels in rats. Moreover, curcumin enhanced AC activity and cAMP levels in platelet and various brain regions, and up-regulated mRNA expressions of AC subtypes AC 2, AC 8 and cAMP response element binding protein (CREB) in the hippocampus, cortex and hypothalamus of the CUMS rats. Curcumin also attenuated CUMS-induced reductions of 5-hydroxytryptamine (5-HT) levels and high expressions of central 5-HT(1A/1B/7) receptors in rats. These results suggested that the potent antidepressant property of curcumin might be attributed to its improvement of AC-cAMP pathway as well as CREB via suppressing central 5-HT(1A/1B/7) receptors in the CUMS rats. Our findings provided a basis for examining the interaction of serotonergic receptors and AC-cAMP pathway in depression and curcumin treatment.

  15. Investigation of activation cross-sections of proton induced nuclear reactions on {sup nat}Mo up to 40 MeV: New data and evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Tarkanyi, F. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), 4026 Debrecen (Hungary); Ditroi, F., E-mail: ditroi@atomki.hu [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), 4026 Debrecen (Hungary); Hermanne, A. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Laarbeeklaan 103, 1090 Brussels (Belgium); Takacs, S. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), 4026 Debrecen (Hungary); Ignatyuk, A.V. [Institute of Physics and Power Engineering (IPPE), Obninsk 249020 (Russian Federation)

    2012-06-01

    Highlights: Black-Right-Pointing-Pointer Excitation function measurement of proton induced reactions on molybdenum up to 40 MeV. Black-Right-Pointing-Pointer Model code calculations with EMPIRE, ALICE and TALYS. Black-Right-Pointing-Pointer Integral production yield calculation. Black-Right-Pointing-Pointer Medical radioisotope production; {sup 99m}Tc and {sup 99}Mo. Black-Right-Pointing-Pointer Monitor reactions. - Abstract: Cross-sections of proton induced nuclear reactions on natural molybdenum have been studied in the frame of a systematic investigation of charged particle induced nuclear reactions on metals for different applications. The excitation functions of {sup 93m}Tc, {sup 93g}Tc{sup (m+)}, {sup 94m}Tc, {sup 94g}Tc, {sup 95m}Tc, {sup 95g}Tc, {sup 96g}Tc{sup (m+)}, {sup 99m}Tc, {sup 90}Mo{sup (cum)}, {sup 93m}Mo, {sup 99}Mo{sup (cum)}, {sup 90}Nb{sup (cum)}, {sup 92m}Nb, {sup 95m}Nb, {sup 95g}Nb, {sup 96}Nb and {sup 88}Zr{sup (cum)}, {sup 89}Zr{sup (cum)} were measured up to 40 MeV proton energy by a using stacked foil technique and activation method. The main goals of this work were to study the production possibility of the medically important {sup 99m}Tc and its {sup 99}Mo parent nucleus, to get experimental data for accelerator technology, for monitoring of proton beam, for thin layer activation technique and for testing nuclear reaction theories. The experimental data were compared with critically analysed published data and with the results of model calculations, obtained by using the ALICE-IPPE, EMPIRE-II and TALYS codes.

  16. The Impacts of Heating Strategy on Soil Moisture Estimation Using Actively Heated Fiber Optics.

    Science.gov (United States)

    Dong, Jianzhi; Agliata, Rosa; Steele-Dunne, Susan; Hoes, Olivier; Bogaard, Thom; Greco, Roberto; van de Giesen, Nick

    2017-09-13

    Several recent studies have highlighted the potential of Actively Heated Fiber Optics (AHFO) for high resolution soil moisture mapping. In AHFO, the soil moisture can be calculated from the cumulative temperature ( T cum ), the maximum temperature ( T max ), or the soil thermal conductivity determined from the cooling phase after heating ( λ ). This study investigates the performance of the T cum , T max and λ methods for different heating strategies, i.e., differences in the duration and input power of the applied heat pulse. The aim is to compare the three approaches and to determine which is best suited to field applications where the power supply is limited. Results show that increasing the input power of the heat pulses makes it easier to differentiate between dry and wet soil conditions, which leads to an improved accuracy. Results suggest that if the power supply is limited, the heating strength is insufficient for the λ method to yield accurate estimates. Generally, the T cum and T max methods have similar accuracy. If the input power is limited, increasing the heat pulse duration can improve the accuracy of the AHFO method for both of these techniques. In particular, extending the heating duration can significantly increase the sensitivity of T cum to soil moisture. Hence, the T cum method is recommended when the input power is limited. Finally, results also show that up to 50% of the cable temperature change during the heat pulse can be attributed to soil background temperature, i.e., soil temperature changed by the net solar radiation. A method is proposed to correct this background temperature change. Without correction, soil moisture information can be completely masked by the background temperature error.

  17. Severe atrioventricular decoupling, uncoupling, and ventriculoatrial coupling during enhanced atrial pacing: incidence, mechanisms, and implications for minimizing right ventricular pacing in ICD patients.

    Science.gov (United States)

    Sweeney, Michael O; Ellenbogen, Kenneth A; Tang, Anthony S L; Johnson, James; Belk, Paul; Sheldon, Todd

    2008-11-01

    AV Decoupling During Enhanced AAIR Pacing. Enhanced AAI/R pacing minimizes right ventricular pacing but may permit or induce AV decoupling (AV-DC) due to unrestricted AV intervals (AVIs). The purpose of this study was to characterize and quantify AVI behavior in a randomized trial of enhanced AAI/R pacing in ICD patients. One hundred twenty-one patients in the Marquis ICD MVPtrade mark Study, a randomized 1-month crossover comparison of cumulative% ventricular pacing (Cum%VP) in enhanced AAIR (MVP) vs DDD/R, were analyzed. AV-DC was defined as >or=40% AVIs >300 ms; VA coupling (VA-C) was defined as%V-atrial pace (AP) intervals 60 beats/min, rate response, and Cum%AP were associated with longer AVIs. Logistic regression identified baseline PR (odds ratio [OR]= 1.024, 95% confidence interval [CI] 1.007-1.042; P = 0.005), and Cum%AP (OR = 1.089, 95% CI 1.027-1.154; P = 0.004) as predictors of AV-DC. AV-DC was associated with approximately 10-fold increases in both Cum%VP (13.6 +/- 28.3% vs 1.2 +/- 3.9%; P = 0.023) due to transient AV-UC) and VA-C (6.0 +/- 17.5% vs 0.5 +/- 1.2%, P = 0.028). AV coupling (300 ms) was preserved in 104 (86%) patients. AV-DC, VA-C, and AV-UC may be worsened or induced by enhanced AAI/R pacing. Conservative programming of lower rate and rate response should reduce the risk of AV-DC by reducing Cum%AP.

  18. Electroacupuncture regulate hypothalamic-pituitary-adrenal axis and enhance hippocampal serotonin system in a rat model of depression.

    Science.gov (United States)

    Le, Jing-jing; Yi, Tao; Qi, Li; Li, Ji; Shao, Lei; Dong, Jing-cheng

    2016-02-26

    Hypothalamic-pituitary-adrenal (HPA) axis has been implicated in the pathogenesis of depression. Dysfunction of the hippocampal serotonin (5-hydroxytryptamine, 5-HT) system has been shown to be a key factor in depression. There is growing evidence that electro-acupuncture (EA) has antidepressant-like effect. However, the effect of EA on HPA axis and hippocampal serotonin system remains unknown. In our study, we investigated the antidepressant-like effect and mechanism of EA for depression rat models. Depression in rats was induced by chronic unpredictable mild stress (CUMS). EA treatment was administered once daily to CUMS rats for 14 days. The acupoints (ST36, bilateral and CV4) were selected. Untreated CUMS rats and normal rats were used as controls. Behavioral tests including forced swim test and open-field test were performed to evaluate the antidepressant effects of EA treatment. Hypothalamic corticotropin-releasing hormone (CRH) mRNA, plasma adrenocorticotropic hormone (ACTH) and corticosterone (CORT) were estimated as indices of HPA axis activity. Enzyme linked immunosorbent assay (ELISA) was performed to determine the concentrations of 5-HT in the hippocampus. Real-time PCR(RT-PCR)and Western blot were respectively used to detect the mRNA and protein levels of 5-hydroxytryptamine 1A receptor (5-HT1AR) in the hippocampus. Our results showed that EA treatment reversed the behavioral deficiency induced by CUMS in rats. EA treatment decreased CRH mRNA expression in the hypothalamic, and ACTH and CORT level in plasma, and markedly increased 5-HT concentration, 5-HT1AR (mRNA and protein) expression in the hippocampus. These results indicated that EA treatment could act on depression by modulating HPA axis and enhancing hippocampal 5-HT/5-HT1AR in CUMS Rats. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  19. Efecto de la fertilización orgánica, la variedad y la época en el perfil polifenólico de Morus alba (L.

    Directory of Open Access Journals (Sweden)

    D. E. García

    2005-01-01

    Full Text Available Con el objetivo de detectar los principales grupos de fenoles en la biomasa de la morera y de-terminar el efecto del abonado (0, 100, 300 y 500 kg N/ha/año, la variedad (Cubana, Indonesia, Tigreada y Acorazonada y la época (periodo lluvioso y poco lluvioso, en el perfil polifenólico, se llevó a cabo una investigación con un diseño de bloques (al azar con arreglo factorial 4 x 4 x 2 y cinco repeticiones. Mediante el tamizaje fitoquímico se evaluó la presencia de siete grupos de compuestos, para posteriormente, determinar sus concentraciones. Únicamente se detectaron fenoles (FT, flavonoides (Flav y cumarinas (Cum, con presencia leve, notable o cuantiosa. Sólo se encontraron interacciones significativas entre los factores fertilización y variedad para los FT y las Cum (P<0,05. Los niveles máximos de FT y Cum encontrados en las hojas fueron de 2,86% MS (Tigreada abonada con 100 kg N/ha/año y 0,65% MS (Cubana e Indonesia fertilizadas con 100 kg N/ha/año, respectivamente. Las mayores concentraciones de FT y Cum en los tallos tiernos se observaron en la variedad Acorazonada con 100 kg N/ha/año (1,55% MS e Indonesia, con la aplicación de 500 kg N/ha/año (0,60% MS. En las hojas de las variedades (los contenidos de FT y Cum tendieron a disminuir con el incremento de los niveles de fertilización, a excepción de las concentraciones de FT, en la variedad Cubana. En el caso de los Flav, no se observó un efecto significativo de los factores fertilización, variedad y época. Solamente en los FT de las hojas, se observó un efecto representativo de la época a favor del PLL. Los resultados permiten concluir que las concentraciones de los FT se ven afectadas por los niveles de fertilización, la variedad y la época. Los contenidos de Cum presentan variaciones significativas entre los niveles de abonado orgánico y las variedades. Los niveles de Flav no muestran fluctuaciones cuantiosas con ninguna de las variables estudiadas.

  20. Classical-driving-assisted entanglement dynamics control

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Ying-Jie, E-mail: yingjiezhang@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Han, Wei [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Xia, Yun-Jie, E-mail: yjxia@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Fan, Heng, E-mail: hfan@iphy.ac.cn [Beijing National Laboratory of Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing, 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing, 100190 (China)

    2017-04-15

    We propose a scheme of controlling entanglement dynamics of a quantum system by applying the external classical driving field for two atoms separately located in a single-mode photon cavity. It is shown that, with a judicious choice of the classical-driving strength and the atom–photon detuning, the effective atom–photon interaction Hamiltonian can be switched from Jaynes–Cummings model to anti-Jaynes–Cummings model. By tuning the controllable atom–photon interaction induced by the classical field, we illustrate that the evolution trajectory of the Bell-like entanglement states can be manipulated from entanglement-sudden-death to no-entanglement-sudden-death, from no-entanglement-invariant to entanglement-invariant. Furthermore, the robustness of the initial Bell-like entanglement can be improved by the classical driving field in the leaky cavities. This classical-driving-assisted architecture can be easily extensible to multi-atom quantum system for scalability.

  1. Predicting the denitrification capacity of sandy aquifers from shorter-term incubation experiments and sediment properties

    Directory of Open Access Journals (Sweden)

    W. Eschenbach

    2013-02-01

    Full Text Available Knowledge about the spatial variability of denitrification rates and the lifetime of denitrification in nitrate-contaminated aquifers is crucial to predict the development of groundwater quality. Therefore, regression models were derived to estimate the measured cumulative denitrification of aquifer sediments after one year of incubation from initial denitrification rates and several sediment parameters, namely total sulphur, total organic carbon, extractable sulphate, extractable dissolved organic carbon, hot water soluble organic carbon and potassium permanganate labile organic carbon.

    For this purpose, we incubated aquifer material from two sandy Pleistocene aquifers in Northern Germany under anaerobic conditions in the laboratory using the 15N tracer technique. The measured amount of denitrification ranged from 0.19 to 56.2 mg N kg−1 yr−1. The laboratory incubations exhibited high differences between non-sulphidic and sulphidic aquifer material in both aquifers with respect to all investigated sediment parameters. Denitrification rates and the estimated lifetime of denitrification were higher in the sulphidic samples. For these samples, the cumulative denitrification measured during one year of incubation (Dcum(365 exhibited distinct linear regressions with the stock of reduced compounds in the investigated aquifer samples. Dcum(365 was predictable from sediment variables within a range of uncertainty of 0.5 to 2 (calculated Dcum(365/measured Dcum(365 for aquifer material with a Dcum(365 > 20 mg N kg−1 yr−1. Predictions were poor for samples with lower Dcum(365, such as samples from the NO3 bearing groundwater zone, which includes the non-sulphidic samples, from the upper part of both aquifers where denitrification is not sufficient to

  2. Manipulating counter-rotating interactions in the quantum Rabi model via modulation of the transition frequency of the two-level system

    Science.gov (United States)

    Huang, Jin-Feng; Liao, Jie-Qiao; Tian, Lin; Kuang, Le-Man

    2017-10-01

    We propose a theoretical approach to manipulate the counter-rotating (CR) interactions in the quantum Rabi model by introducing a sinusoidal modulation to the transition frequency of the quantum two-level system. By choosing appropriate modulation frequency and amplitude, enhancement and suppression of the CR interactions can be achieved in the Jaynes-Cummings regime (including both weak- and strong-coupling cases) as well as the ultrastrong-coupling regime. In particular, we calculate the output excitation emission of the bosonic vacuum state under enhanced CR terms. Our results show that continuous and steady bosonic excitation emission from the bosonic vacuum can be observed in the Jaynes-Cummings regime as a consequence of the enhancement. Our approach is general and system independent, and hence it works for various physical systems described by the quantum Rabi model. As an example, we discuss the implementation of this scheme with superconducting quantum circuits.

  3. Remnant pancreatic parenchymal volume predicts postoperative pancreatic exocrine insufficiency after pancreatectomy.

    Science.gov (United States)

    Okano, Keisuke; Murakami, Yoshiaki; Nakagawa, Naoya; Uemura, Kenichiro; Sudo, Takeshi; Hashimoto, Yasushi; Kondo, Naru; Takahashi, Shinya; Sueda, Taijiro

    2016-03-01

    Pancreatectomy, including pancreatoduodenectomy and distal pancreatectomy, often causes postoperative pancreatic exocrine insufficiency (PEI). Our aim was to clarify a relationship between remnant pancreatic volume and postoperative PEI. A total of 227 patients who underwent pancreatoduodenectomy or distal pancreatectomy were enrolled in this study. All patients underwent a (13)C-labeled mixed triglyceride breath test to assess pancreatic exocrine function and abdominal dynamic computed tomography for assessing remnant pancreatic volume after pancreatectomy at a median of 7 months postoperatively. The percent (13)CO2 cumulative dose at 7 hours (% dose (13)C cum 7 h) pancreatectomy were performed in 174 (76.7%) and 53 (23.3%) patients, respectively. Of the 227 patients, 128 (56.3%) developed postoperative PEI. Postoperative % dose (13)C cum 7 h was strongly correlated with remnant pancreatic volume (r = .509, P pancreatectomy (P pancreatectomy. Remnant pancreatic volume may predict postoperative PEI in patients who undergo pancreatectomy. Copyright © 2016 Elsevier Inc. All rights reserved.

  4. The Orchestra as a Laboratory

    DEFF Research Database (Denmark)

    Paunova, Minna; Velikova, Silviya Svejenova

    2017-01-01

    Orchestras and other performing arts organizations exist to deliver superior performance of artistic and cultural works. While performing arts organizations often serve as analytical templates to understand collective learning, creativity, and innovation, performance is not always concerted...... with learning in these and other organizations. Zooming in on a critical case of a performance arts’ organization–an orchestra-cum-laboratory–our study seeks to advance understanding of generative forms of organizing for individual and organizational learning and creativity. Unlike traditional orchestras...... for which performance is an end and rehearsing a means, for the orchestra-cum-laboratory rehearsing is an end in itself, satisfying musicians’ drives to learn and create. We are interested to advance understanding of why and how a creative collective operates as a learning-driven performance arts...

  5. Emergence of traveling waves in the spreading of dengue fever

    Science.gov (United States)

    Bianco, Simone; Faatz, Andrea; Cummings, Derek; Shaw, Leah

    2010-03-01

    Dengue fever is a multistrain mosquito-borne subtropical disease that exhibits complex oscillatory outbreaks. Epidemiological data from Thailand displays traveling waves of infection originating in Bangkok, the largest population center (Cummings et al., Nature 427: 344, 2004). We present a multistrain metapopulation model in which traveling wave like behavior results from migration coupling between heterogeneous regions. The region with the highest effective person-to-person contact rate leads the dynamics. A stochastic version of the model will also be presented.

  6. Stress and vitamin D: altered vitamin D metabolism in both the hippocampus and myocardium of chronic unpredictable mild stress exposed rats.

    Science.gov (United States)

    Jiang, Pei; Zhang, Wen-Yuan; Li, Huan-De; Cai, Hua-Lin; Liu, Yi-Ping; Chen, Lin-Yao

    2013-10-01

    Exposure to stressful life events is associated with the onset of major depression and increases the risk of cardiac morbidity and mortality. While recent evidence has indicated the existence of an interrelationship between local vitamin D (VD) metabolism and many aspects of human physiology including brain and heart function, much is still unknown concerning the biological link between VD signaling and stress-induced depressive behavior and cardiac dysfunction. In the present study, we observed the VD intracrine system in the hippocampus and myocardium of chronic unpredictable mild stress (CUMS) exposed rats. After 4 weeks of CUMS procedure, rats were induced to a depressive-like state and the cytochromes P450 enzymes involved in VD activating and catabolizing (CYP27B1 and CYP24A1 respectively) and VD receptor (VDR) were assessed by real time RT-PCR and western blot in the hippocampus, myocardium and kidney. In the hippocampus of depressed rats, CYP27B1, CYP24A1 and VDR expression were significantly increased and the local status of 1,25-dihydroxyvitamin D (1,25(OH)2D) was higher compared with controls. Furthermore, hippocampal mRNA levels of VD target genes (calbindin-d28k, neurotrophin-3) and RXRα (heterodimeric partner of VDR) were upregulated in response to chronic stress. Similar to the hippocampus, CUMS also induced CYP27B1/CYP24A1/VDR expression in the myocardium. However, renal metabolism of VD and serum1,25(OH)2D status were unchanged. Meanwhile, sertraline treatment could partly normalize the stress-induced alterations of VD metabolism. In conclusion, this study firstly showed a co-elevated expression of CYP27B1/CYP24A1/VDR in both the hippocampus and myocardium of CUMS rats, which suggests VD signaling may be involved in the compensatory mechanism that protect from stress-induced deteriorating effects on the brain and heart. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. Development of an Airborne MMW FM-CW Radar for Mapping River Ice

    Science.gov (United States)

    1993-01-01

    installed in the33-MHz 80386 DOS- S..1.78 (Cumming 1952). based computer with an 80387 math coprocessor, a conventional 40-megabyte hard-drive and 4 mega...InterfaceI - 33M~836 CPU I x Antennas 1I. M 40 M Bernoull i LKF oppy Drive Hard Di 44 MB Disk Field-hardened Computer System Figure 5. MMWFM-CW radar system

  8. Process development for gelatinisation and enzymatic hydrolysis of starch at high concentrations

    OpenAIRE

    Baks, T.

    2007-01-01

    cum laude graduation (with distinction) Enzymatic hydrolysis of starch is encountered in day-to-day life for instance in the dishwasher during removal of stains with detergents or in our mouth during chewing of starch-based foods in the presence of saliva. The reaction is also important for the (food) industry, for example for the production of beer or bio-ethanol. In industry, it is usually preceded by gelatinisation to make the starch molecules available for the enzymes. Both gelatinisation...

  9. Annual Progress Report - Fiscal Year 1978.

    Science.gov (United States)

    1978-10-01

    man, including interstitial pneu - monia and hematologic, physiologic and immunologic responses. Additional attempts were made to isolate purified...0ATES/EPECTIVE- EXPIRATIONP C N I, CMF .ISCAL 78 1.0 62.8 TIPE NA K AMOUNT TEAR EN KINDOFAWARD (.CUM AMT. 79 1.0 152.7 It e ESPONSINLE DO0 ORANI...increased rates during illness in the septic group. Thus, during pneu - mococcal sepsis in the monkey infused with the amino acid plus lipid, skeletal

  10. Historical cohort study of US man-made vitreous fiber production workers: III. Analysis of exposure-weighted measures of respirable fibers and formaldehyde in the nested case-control study of respiratory system cancer.

    Science.gov (United States)

    Youk, A O; Marsh, G M; Stone, R A; Buchanich, J M; Smith, T J

    2001-09-01

    The most recent findings of our nested case-control study of respiratory system cancer (RSC) among male fiberglass workers showed some evidence of elevated RSC risk associated with non-baseline levels of average intensity of exposure (AIE) to respirable fibers (RFib). When adjusted for smoking, this was not statistically significant, and no trend was apparent with increasing levels of exposure. Similar findings for RSC were noted for both cumulative exposure (Cum) and AIE to formaldehyde (FOR). In this reanalysis of our nested case-control study, we explored a possible exposure-response relationship between RSC and exposure to RFib or FOR using exposure weighting as an alternative characterization of exposure. Because of the uncertainties in selecting an appropriate exposure-weighting scheme, a range of plausible time lags and unlagged/lagged time windows was considered. As in the initial analysis of the nested case-control study, RFib and FOR exposures were categorized at the deciles of the RSC case distribution. For none of the exposure weighting schemes considered did we observe an increasing RSC risk with increasing levels of RFib_Cum or RFib_AIE. The exposure-weighted estimated risk ratios (RR) for both RFib_Cum and RFib_AIE were generally lower than those obtained from an unweighted model. For FOR_Cum, RRs were generally lower for the time-lagged and unlagged time window models than for the unweighted models, although some decile-specific RRs were higher for the lagged time window models. The exposure-weighted RRs for FOR_AIE were generally lower than the unweighted RRs for all of the weighting schemes considered. This reanalysis in terms of categorized exposures reveals no exposure-response relationships that were undetected in the original analysis where unweighted exposure measures were used. In the schemes considered, exposure weighting generally reduced the estimated risk of RSC.

  11. Evaluation of Adhesive and Compressive Strength of Glass Ionomer Cements

    OpenAIRE

    Ramashanker,; Raghuwar D Singh; Chand, Pooran; Jurel, Sunit Km.; Tripathi, Shuchi

    2011-01-01

    The aim of the study was to assess, compare and evaluate the adhesive strength and compressive strength of different brands of glass ionomer cements to a ceramometal alloy. (A) Glass ionomer cements: GC Fuji II (GC Corporation, Tokyo), Chem Flex (Dentsply DeTrey, Germany), Glass ionomer FX (Shofu-11, Japan), MR dental (MR dental suppliers Pvt Ltd, England). (B) Ceramometal alloy (Ni–Cr: Wiron 99; Bego, Bremen, Germany). (C) Cold cure acrylic resin. (E) Temperature cum humidity control chamber...

  12. [Application of the sea-buckhorn ointment for the treatment of the burn wounds and trophic ulcers].

    Science.gov (United States)

    Henyk, S M; Vasyliuk, Ia I; Maskiak, T R; Romanchuk, M V; Khokhriakov, I V

    1999-01-01

    Clinical estimation was performed of the application efficacy of Unguentum cum Olei Hippopheae preparation in treatment of 30 patients with the burn wounds, 7--with the lower extremities ulcer due to postthrombophlebitis syndrome existence, 8--on the diabetic angiopathy background. The epithelisation acceleration by (4.6 +/- 1.4) days, an ulcer square reduction by (2.3 +/- 0.25)% in comparison with a control group were established.

  13. The dynamics of coupled atom and field assisted by continuous external pumping

    Energy Technology Data Exchange (ETDEWEB)

    Burlak, G.; Hernandez, J.A. [Centro de Investigacion en Ingenieria y Ciencias Aplicadas, Universidad Autonoma de Morelos, Cuernavaca, Morelos (Mexico); Starostenko, O. [Departamento de Fisica, Electronica, Sistemas y Mecatronica, Universidad de las Americas, 72820 Puebla (Mexico)

    2006-07-01

    The dynamics of a coupled system comprising a two-level atom and cavity field assisted by a continuous external classical field (driving Jaynes-Cummings model) is studied. When the initial field is prepared in a coherent state, the dynamics strongly depends on the algebraic sum of both fields. If this sum is zero (the compensative case) in the system, only the vacuum Rabi oscillations occur. The results with dissipation and external field detuning from the cavity field are also discussed. (Author)

  14. Utilising technology to monitor and analyse mining operations in real-time

    CSIR Research Space (South Africa)

    Brink, VZ

    2012-10-01

    Full Text Available - 17Mar 12h- 17Mar 00h- 18Mar 12h- 18Mar 00h- 19Mar 12h- 19Mar 00h- 20Mar 12h- 20Mar 00h- 21Mar 12h- 21Mar 00h- 22Mar 12h- 22Mar 00h- 23Mar 12h- 23Mar 00h- 24Mar 12h- 24Mar 00h- 25Mar Ac cum ula ted ev ent co un...

  15. THE SINO-INDIAN ORIGIN OF CHEMEIA AND CHUMEIA AS SYNONYMS IN GREK, SIGNIFYING ALCHEMY

    OpenAIRE

    Mahdihassan, S.

    1984-01-01

    In China the antecedent of alchemy is represented by the god of longevity emerging from the peach. The first synthetic drug, Kim-Yeh, red colloidal gold, signified gold-cum -herbal juice. Kim-Yeh=Kimiya (Arabic) =chemeia (Greek). Translated this gave Chrusozomion=Gold Ferment, specifying the drug. Rasayana was translated as Chumeia, herbal juice-incorporate and signified the art alchemy. Chemeia was Chinese and Chumeia, Indian. Originally each signified both, a drug of longevity and the art, ...

  16. The Alignment of Small States: Singapore and Vietnam

    Science.gov (United States)

    2011-12-01

    governed Singapore since its independence in 1965. Inside that party, Lee Kuan Yew and an elite few have been responsible for formulating...adopted a notably anti-U.S. position in 1965. Lee Kuan Yew publicly revealed details about a 1960 CIA attempt to bribe a member of the security...125 Ganesan, “Singapore: Realist cum Trading State, 599. 66 only two years after his earlier anti-U.S. statements, Lee Kuan Yew travelled to the

  17. Sarcophilia, cremation and Sir Henry Thompson (1820-1904).

    Science.gov (United States)

    Jellinek, E H

    2009-11-01

    Sarcophilia, a neologism for an attachment to human remains, is set in a review of the history of the disposal of the dead. The ancient practice of cremation was relaunched late in the 19th century by the urological surgeon cum social reformer Sir Henry Thompson. He was stimulated by Edwin Chadwick and Charles Dickens, and by Charles Darwin's observations on the earthworm. Sarcophilia is the reason for the controversial Human Tissue Act of 2004.

  18. GALEN'S RECOGNITION OF THREE SOULS AND THEIR ORIGIN

    OpenAIRE

    Mahdihassan, S.

    1986-01-01

    Galen's three souls incorporate previously existing ideas of soul. Soul is matter – cum – energy. As matter it is airlike, the finest by nature and as movement, like sound, the form of energy most subtle of its kind. Creator is depicted with Creation as the Cosmic egg and snake as Cosmic soul and the syllable Om, as the word incorporating creative energy. Om as humming sound is symbolized by Bees which produce such sound.

  19. Swift Boat Veterans for Truth: A Case Study For Frame Building

    Science.gov (United States)

    2006-01-01

    process of framing: Coverage of the Columbine school shootings . Journalism and Mass Communication Quarterly, 81(1), 22-35. Cummings, J. & Flint, J...remains salient to the public over an extended period of time. Chyi and McCombs (2004) examined how the media framed the story of the shootings at... Columbine High School. Specifically, 22 they looked at how the story “gained prominence on the media agenda” (p. 22). Their study determined

  20. pH modulated graphene based tin oxide heterovalent heterojunction nanocomposites with photocatalytic application

    Science.gov (United States)

    Nanakkal, A. R.; Alexander, L. K.

    2017-05-01

    The possibility of introducing pH during synthesis as a modulating variable to develop different combinations of heterovalent cum heterojunction tin oxides on 2D scaffold graphene material is explored. The XRD and Raman spectroscopy characteristic studies confirm successful implementation of the design. The Photocatalytic activity of the graphene based nanocomposites aimed at water purification in visible light also determined as a vindicate application.

  1. Biological Response to the Dynamic Spectral-Polarized Underwater Light Field

    Science.gov (United States)

    2013-09-30

    light in shallow waters environments with seagrass, coral reef and sand bottoms (Florida Keys, January and August 2011) were analyzed together with...reside in the open ocean; Strongylura marina (Atlantic needlefish) are near-surface fish; Ocyurus chrsurus (yellowtail snapper) inhabit reef / coral ...Underwater Light Field PI: Molly E. Cummings Integrative Biology Department University of Texas Austin, TX 78712 phone: (512) 232-6243 fax

  2. An Object-Oriented Military Simulation Baseline for Parallel Simulation Research

    Science.gov (United States)

    1990-12-01

    oriented programming. 2-8 C" Bascd Discrete Evcnt Simulation Support System (27) This paper describes a C based simulation environment for creating and exe...elements in the list) *l /e GLOBAL VARIABLES PASSED: none /e GLOBIL VARIABLES CHANGED: none ./ /e FILES READ: none ’/ /e FILES WRITTEN: none /0 NARDVWIl...Orlando. In 1983 he received an ROTC commission and B.S. degree in environmental engineering technology, graduating summa cum laude. He served as a

  3. Novel Therapeutic Strategy for the Prevention of Bone Fractures

    Science.gov (United States)

    2014-08-01

    Acknowledgments I am grateful to Dr Serge Ferrari and Neil Andrews for the opportunity to prepare this contribution for the BoneKey . Many of the topics...Osteoporosis Intl 2003 ; 14 : 761 – 767 . 3 . Lang T , Cauley JA , Bauer D , Cummings S , Harris TB . Computed tomographic...factor in wound healing . Int Wound J 2010 ; 7 : 107 – 113 . 67 . Lang CH , Silvis C , Nystrom G , Frost AR . Regulation of myostatin by

  4. Optometry/Ophthalmology Assistants, AFSC 4V0X1/A

    Science.gov (United States)

    1994-07-01

    average of 101 tasks. The discriminating tasks of this job include: scrub and gown for major surgery assist ophthalmologist in chalazion surgery assist...during surgery assist ophthalmologist in chalazion surgery Representative TMs for this job include: AVG PCT CUM # OF PCT TIME TIME TM MODULE T=LE TASKS...use during surgery 100 1337 Scrub and gown for major surgery 100 1314 Assist Ophthalmologist in chalazion surgery 100 1318 Assist Ophthalmologist in

  5. Dispersive Response of a Disordered Superconducting Quantum Metamaterial

    OpenAIRE

    Shapiro, Dmitriy S.; Macha, Pascal; Rubtsov, Alexey N.; Ustinov, Alexey V.

    2015-01-01

    We consider a disordered quantum metamaterial formed by an array of superconducting flux qubits coupled to microwave photons in a cavity. We map the system on the Tavis-Cummings model accounting for the disorder in frequencies of the qubits. The complex transmittance is calculated with the parameters taken from state-of-the-art experiments. We demonstrate that photon phase shift measurements allow to distinguish individual resonances in the metamaterial with up to 100 qubits, in spite of the ...

  6. A Description of Psychological Type at the Defense Systems Management College

    Science.gov (United States)

    1992-01-01

    AD-A251 873 A DESCRIPTION OF PSYCHOLOGICAL TYPE AT THE DEFENSE SYSTEMS MANAGEMENT COLLEGE ISTJ ENFP I- Carl Bryant, Ph.D. w_=_ William H. Cummings...DOWNGRADING SCHEDULE unlimited 4. PERFORMING ORGANIZATION REPORT NUMBER(S) 5. MONITORING ORGANIZATION REPORT NUMBER(S) 6a. NAME OF PERFORMING... ORGANIZATION 6b. OFFICE SYMBOL 7a. NAME OF MONITORING ORGANIZATION (If applicable) Defense Systems Mgmt. College FD-MD Defense Systems Management College 6c

  7. Cultural Themes in Messages from Top Air Force Leaders, 2005-2008

    Science.gov (United States)

    2010-01-01

    2 Stuart Albert and David Whetten , “Organizational Identity,” in Research in Organizational Behavior, Vol. 7, Greenwich, Conn.: JAI Press, 1985, p...Ylanda Saranson, and J. L. Stimpert, “A Strategy Conversation on the Topic of Organization Identity,” in David A. Whetten and Paul C. Godfrey, eds...0 Albert, Stuart, and David Whetten , “Organizational Identity” in Larry Cummings and Barry Staw, eds., Research in Organizational Behavior, Vol. 7

  8. Domain Endurants: An Analysis and Description Process Model

    DEFF Research Database (Denmark)

    Bjørner, Dines

    2014-01-01

    We present a summary, Sect. 2, of a structure of domain analysis and description concepts: techniques and tools. And we link, in Sect. 3, these concepts, embodied in domain analysis prompts and domain description prompts, in a model of how a diligent domain analyser cum describer would use them. We...... claim that both sections, Sects. 2–3, contribute to a methodology of software engineering....

  9. Modeling Real-Time Human-Automation Collaborative Scheduling of Unmanned Vehicles

    Science.gov (United States)

    2013-06-01

    human-in-the-loop experiments and has been linked to changes in performance (Clare, Macbeth , & Cummings, 2012; Gao et al., 2013). Trust can be...excessive amount of time replanning or adjusting the schedule (Clare, Macbeth , et al., 2012). Also, “overtrust” in automation has been cited in a number of...been linked to changes in performance (Clare, Macbeth , et al., 2012; Gao, et al., 2013). Both overtrust and undertrust in automation can be

  10. Mixed-Initiative Human-Robot Interaction: Definition, Taxonomy, and Survey

    Science.gov (United States)

    2015-01-01

    response situations (i.e., harmful for human lives) that range from natural disasters (e.g., Fukushima nuclear plant meltdown [1]) to terrorist attacks...the methods that explicitly support an efficient, natural interleaving of contribution by users and automated services aimed at converging on...in space mission operations," AI magazine, vol. 28, p. 75, 2007. [44] A. S. Clare, J. C. Macbeth , and M. L. Cummings, "Mixed-initiative strategies

  11. Evolution and Survival of Quantum Entanglement

    Science.gov (United States)

    2015-05-06

    independently for tasks of  quantum  information. These include  quantum  computing,  quantum   cryptography ,  quantum  teleportation and other forms of entanglement...Evolution and Survival of Quantum Entanglement Theoretical foundations for methods to preserve quantum entanglement are explored and explained...Research Triangle Park, NC 27709-2211 quantum entanglement, decoherence, qubit, revival, survival, Jaynes-Cummings, Rabi, rotating wave approximation

  12. Muscular Strength Gains and Sensory Perception Changes: A Comparison of Electrical and Combined Electrical/Magnetic Stimulation.

    Science.gov (United States)

    1992-04-10

    Electrotherapy 2d ed. Norwalk, CT: Appleton & Lange; 1991:385-399. 18. Cadwell J. Principles of magnetoelectric stimulation. In: Chokroverty S, ed. Magnetic...press). 23. Cummings J. Electrical stimulation of healthy muscle and tissue repair. In: Nelson RM, Currier DP, eds. Clinical Electrotherapy , 2d ed...flow, and and influencing changes. In: Nelson RM, Currier DP, eds. Clinical Electrotherapy , 2d ed. Norwalk, CT: Appleton & Lange;1991:171-199 27

  13. Annals of African Surgery July 2011 07.12.2011.indd

    African Journals Online (AJOL)

    andrew

    2011-07-08

    Jul 8, 2011 ... (Israel), Kinyanjui GM1 MBChB, Al-Ammary AY1 MBChB, MMed, Cert.Urol. (E.A.), FCS(ECSA) and Maganga HM1 MBChB,. MMed. Affiliations: 1- Coast Provincial ... acute testicular torsion from a district hospital in Ireland. (8). Murphy et al (9) reported 71% salvage, while Cum- mings had salvage of 70% in ...

  14. 50 CFR 226.211 - Critical habitat for Seven Evolutionarily Significant Units (ESUs) of Salmon (Oncorhynchus spp...

    Science.gov (United States)

    2010-10-01

    ....9493); Connick Creek (40.0911, -123.8187); Cox Creek (40.0288, -123.8542); Cummings Creek (39.8431....6216); China Creek (40.1035, -123.9493); Connick Creek (40.0912, -123.8154); Cox Creek (40.0310, -123... Flat Creek (40.1444, -124.1636); Blue Slide Creek (40.1562, -123.9283); Box Canyon Creek (40.1078, -123...

  15. Strategic Management for Organizational Effectiveness. The Effect of Human Resource Planning on Retention and Related Issues. Volume 3.

    Science.gov (United States)

    1984-12-01

    34 Human Relations, 1977, 11, 991-1003. 0 Hersey , Paul , and Kenneth H. Blanchard. Management of Organizational Behavior . 3rd Edition. Engelwood Cliffs...Research in Organizational 3 Behavior , Vol. 5, 1983, 141-197. 0 Imundo, Louis V. Jr. "Problems Associated with Management Mobility." Personnel...34 In L.L. Cummings and B.M. Staw (eds.), Research in Organizational Behavior , Vol. 1, 1979, 425- • 478. Katz, Ralph. " Managing Careers: The Influence

  16. Construction Contract Claims

    Science.gov (United States)

    1988-01-01

    owner, contractor, and design professional should be in attendance. Typical - agenda items would include any problems encountered which need the...34Unraveling Construction Claims", Florida Constructor , September/October 19B2. 70. Callahan, Michael T. and H. Murray Hohns, Construction Schedules...Not Lead to Heartburn", Florida Constructor , January/February * 1985. 77. Cummings, Donald J., "Documentation: The Key to Successful Project

  17. LEAD AND MERCURY EACH AS PRIME MATTER IN ALCHEMY

    OpenAIRE

    Mahdihassan, S.

    1988-01-01

    Prime Matter is matter-cum-energy. The first substance identified as such was lead. When gently heated it becomes red and redness means soul or energy so that lead was potentially red or soul-like and as such dual natured. Mercury also becomes red and can return to white metal. It was thus dual natured and was the second substance recognized as Prime Matter. First lead alone and then lead and mercury were considered as the source of all metals.

  18. Lead and mercury each as prime matter in alchemy.

    Science.gov (United States)

    Mahdihassan, S

    1988-01-01

    Prime Matter is matter-cum-energy. The first substance identified as such was lead. When gently heated it becomes red and redness means soul or energy so that lead was potentially red or soul-like and as such dual natured. Mercury also becomes red and can return to white metal. It was thus dual natured and was the second substance recognized as Prime Matter. First lead alone and then lead and mercury were considered as the source of all metals.

  19. Group for High Resolution Sea Surface Temperature (GHRSST) Analysis Fields Inter-Comparisons. Part 1: A GHRSST Multi-Product Ensemble (GMPE)

    Science.gov (United States)

    2012-05-02

    Atmospheres (CIRA), Fort Collins, CO, USA d NOAA/NESDIS, National Climatic Data Center (NCDC), Asheville, NC, USA e CAWCR, Bureau of Meteorology , Melbourne...Cummings (2011) 2005 N/A GAMSSA Bureau of Meteorology , Australia Beggs et al. (2011), Zhong and Beggs (2008) October 2008 N/A MGDSST Japan Meteorological...Global Australian Multi- Sensor Sea Surface Temperature Analysis. Analysis and Prediction Operations Bulletin No. 77. Bureau of Meteorology , Australia

  20. Towards a Secure Federated Information System

    Science.gov (United States)

    2012-08-01

    graduated from Upper Canada College in 1997 and received the Governor General’s Academic Medal. He received a Bachelor of Arts in Mathematics (cum...much of my life, including my passion for computer science. To阿嬤, thank you for being so supportive of my academic pursuits. You were always incredibly...Saikat Guha, Oliver Kennedy, and Alan Shieh. They were invariably a good avenue of procrastination , be it through random discussions, movies, video

  1. Harwell Subroutine Library. A Catalogue of Subroutines (1973),

    Science.gov (United States)

    1973-07-01

    The user must supply upper and lower bounds on the dependent variables for scaling purposes. Versions: OCOlA ; no double precision version. Language...simulation OBOIA4 I time ON02A on line printer OCOlA Forsythe.G.E. VCO1A on teletype OCOlA FORTRAN compilers CUM-I print text OBOlA1𔃻 FORTRAN I/O

  2. Migration and Development: Mixed evidence from western Mali

    OpenAIRE

    Flore Gubert

    2007-01-01

    Flore Gubert examines the investment-oriented initiatives of Malian migrants in their home to illustrate that out migration has a strong impact on poverty reduction in the Kayes area. She proposes that migration-cum-remittances alone do not create the right conditions for genuine development even if the non-productive use of remittances may strongly impact on the mainstays of development such as health, education, culture or the environment. Development (2007) 50, 94–100. doi:10.1057/palgrave...

  3. Download this PDF file

    African Journals Online (AJOL)

    mu irth and 10 at l andS m scores of 7. Ap gar. -frontal ts for age ipito. Her occ' ihwe a in was a macerated s. The second tw. 400grams. i. 1n normal 1 ith ference was however w. 611' cum. , BT was found to be a preterm female ion. lIl I'OOIII a mina. On exa. lSCUSSlOll illary temperature of D ith an ax ial features were normal.

  4. Utilization of tax allowances

    OpenAIRE

    Gunnar Forsling

    1998-01-01

    Swedish tax-paying firms have systematically failed to take full advantage of the allowances granted by the government. The average utilization level varied between 62 and 86 percent in the years 1979-1993. The Swedish tax-cut cum basebroadening tax reform in 1991 meant that the amount eligible for appropriation to untaxed reserves was much reduced. Our results show that the proportion of firms that fully utilize the allowances has increased since the reform. One interpretation of this is tha...

  5. Chronic Stress Contributes to Cognitive Dysfunction and Hippocampal Metabolic Abnormalities in APP/PS1 Mice

    Directory of Open Access Journals (Sweden)

    Bing Han

    2017-03-01

    Full Text Available Background/Aims: Stress response is determined by the brain, and the brain is a sensitive target for stress. Our previous experiments have confirmed that once the stress response is beyond the tolerable limit of the brain, particularly that of the hippocampus, it will have deleterious effects on hippocampal structure and function; however, the metabolic mechanisms for this are not well understood. Methods: Here, we used morris water maze, elisa and gas chromatography-time of flight/mass spectrometry to observe the changes in cognition, neuropathology and metabolomics in the hippocampus of APP/PS1 mice and wild-type (C57 mice caused by chronic unpredictable mild stress (CUMS, we also further explored the correlation between cognition and metabolomics. Results: We found that 4 weeks of CUMS aggravated cognitive impairment and increased amyloid-β deposition in APP/PS1 mice, but did not affect C57 mice. Under non-stress conditions, compared with C57 mice, there were 8 different metabolites in APP/PS1 mice. However, following CUMS, 3 different metabolites were changed compared with untreated C57 mice. Compared to APP/PS1 mice, there were 7 different metabolites in APP/PS1+CUMS mice. Among these alterations, 3-hydroxybutyric acid, valine, serine, beta-alanine and o-phosphorylethanolamine, which are involved in sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism. Conclusion: The results indicate that APP/PS1 mice are more vulnerable to stress than C57 mice, and the metabolic mechanisms of stress-related cognitive impairment in APP/PS1 mice are related to multiple pathways and networks, including sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism.

  6. De la ferme à la fourchette – lutte contre l'obésité chez les enfants ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    CRDI. De la ferme à la fourchette : amélioration de la nutrition dans les Caraïbes. [http://bit.ly/13LDfWK]. • Hospedales, C.J., Samuels, T.A., Cummings, R.,. Gollop, G. et E. Greene (2011). “Raising the priority of chronic non communicable diseases in the. Caribbean”, Revista Panamericana de Salud Pública, vol. 30, no 4, p.

  7. Drug Use and Abuse: Background Information for Security Personnel

    Science.gov (United States)

    1994-05-01

    lovely, peace pill, horse tranquilizer, killer weed, evil weed, and parsley . PCP can act as both a stimulant and a depressant. It can produce...shops and by mail-order catalogue. Common trade names for butyl nitrite and isobutyl nitrite include Aroma of Men, Ban Apple Gas, Bang, Bolt, Bullet...Climax, Crypt Tonight, Cum, Discorama, Hardware, Heart On, Highball, Jac Aroma , Liquid Increase, Locker Room, Mama Poppers, Oz, RUSH, Satan’s Scent

  8. The Importance of Treating Culture as a System: Lessons on Counter-Insurgency Strategy from the British Iraqi Mandate

    Science.gov (United States)

    2005-10-01

    the purpose of influencing their development or changing them. Talcott Parsons is perhaps the best-known proponent of the idea that we should treat... Talcott Parson’s mid-Twentieth century model to a more subtle biological cum psychological conception of cultural processes. 2. Second, I’ll discuss...Britain’s ability to staff the revamped nascent Iraqi administration, as most of those who were educated enough to run the institutions had in fact been

  9. PET Imaging of Estrogen Metabolism in Breast Cancer

    Science.gov (United States)

    2001-06-01

    Acquired Immune Deficiency Syndrome . Funded for $25,000 by the Rudin Foundation Grant. Cummings Foundation Grant $60,000 for expanded Breast Self...Zech LA, Stein LA, Kemeny MM, Brennan MF, Brewer EG Jn Massive omental reticuloendothelial cell lipid uptake in Tangier disease following...Jejunal Perforations Secondary to Cytomegalovirus in a Patient with the Acquired Immune Deficiency Syndrome : Case Report and Review. Digestive Diseases

  10. Validation Test Report for the Improved Synthetic Ocean Profile (ISOP) System, Part I: Synthetic Profile Methods and Algorithm

    Science.gov (United States)

    2013-03-15

    Naval Research for funding the Naval Research Laboratory project The Impact of Spice on Ocean Circulation , program element 61153N. The authors also... Thermohaline Strucure from Fields Mearuable by Satellite." J. Atmos. Ocean. Tech., 1994: 551-566. Cummings, J. A. "Operational multivariate ocean data...34Relationship of TOPEX/Poseidon altimetric height to steric height and circulation in the North Pacific." J. Geophys. Res., 1998: 27,947- 27,965

  11. Exactly solvable models for atom-molecule Hamiltonians.

    Science.gov (United States)

    Dukelsky, J; Dussel, G G; Esebbag, C; Pittel, S

    2004-07-30

    We present a family of exactly solvable generalizations of the Jaynes-Cummings model involving the interaction of an ensemble of SU(2) or SU(1,1) quasispins with a single boson field. They are obtained from the trigonometric Richardson-Gaudin models by replacing one of the SU(2) or SU(1,1) degrees of freedom by an ideal boson. The application to a system of bosonic atoms and molecules is reported.

  12. Community-Assisted Urban Sustainable Organic and Ecological Agriculture in the Philippines: Experiential Learnings and the Ways Forward

    OpenAIRE

    Catedral, Isagani; Villegas, Pablito

    2014-01-01

    The Kasama Ka Organik Koop is a staunch advocate in the promotion of Sustainable Organic and Ecological Agriculture and farming systems. The establishment of urban techno-demo organic gardens cum livelihood and entrepreneurship development center is one of the hands-on strategies adopted. The farm has been envisaged to serve as an eco-tourism venue to promote environmental awareness and knowledge, and livelihood and employment opportunities to the community.

  13. First Steps in the Development of a Method for Evaluating Environmental Restoration Projects

    Science.gov (United States)

    1992-09-01

    Susskind and Cruikshank 1987.) 24 IV. THE INTERMEDIATE RUN Over the intermediate run-for the two or three fiscal years following FY94, let us say-two... Leonard A., & Batie, Sandra S. (1987). Mitigating damages from coastal wetlands development: Policy, economics, and financing. Marine Resource...existence value of wildlife: What do CUM estimates really show?. Land Economics, 67(4), 390-400. Susskind , Lawrence, & Cruikshank, Jeffrey. (1987

  14. HERBAL SOLUTION FOR THE TREATMENT OF DIABETES MELLITUS

    OpenAIRE

    Aruna Devaraj R; Nirmala Anbu Rani R

    2012-01-01

    Diabetes mellitus is a metabolic cum vascular syndrome of multiple etiologies characterized by chronic hyperglycemia with malfunction of carbohydrate, fat and protein metabolism. Medical plants play an important role in the management of diabetes mellitus especially in developing countries. Many ethnobotanical surveys on medicinal plants used by the local population have been performed in different parts of the world. The large numbers of herbals have demonstrated the importance of medicinal ...

  15. Perfectionism, Burnout, and Motivation in Dance: A Replication and Test of the 2×2 Model of Perfectionism.

    Science.gov (United States)

    Nordin-Bates, Sanna M; Raedeke, Thomas D; Madigan, Daniel J

    2017-09-15

    The relationships between multidimensional perfectionism, burnout, and motivation were examined. In so doing, this study aimed to replicate and extend the study by Cumming and Duda (2012). Ninety-one ballet dancers completed questionnaires assessing the target constructs. Using cluster analysis, four profiles emerged that replicated Cumming and Duda's findings and generally supported Gaudrau and Thompson's 2x2 model of perfectionism. As such, these profiles represented pure personal standards perfectionism, mixed perfectionism, pure evaluative concerns perfectionism, and non-perfectionism. Extending previous literature, the four profiles were then compared on a range of burnout symptoms and motivational regulations. It was found that the four clusters differed significantly on these constructs, in a manner partly supportive of the hypotheses associated with the 2x2 model of perfectionism. In particular, our results reflect and extend those of Cumming and Duda, in that mixed perfectionism and pure evaluative concerns perfectionism did not differ on any of the measures. Thus, the higher personal standards of dancers exhibiting mixed perfectionism did not appear to be associated with better functioning than that experienced by dancers with pure evaluative concerns perfectionism. Altogether, the study extends our current understanding of perfectionism in dance and its potential effects, including those on burnout and motivation.

  16. Youngest representative of the extinct genus Microphorites in the Eocene amber of France (Diptera: Dolichopodidae: Microphorinae).

    Science.gov (United States)

    Bramuzzo, Simone; Nel, André

    2017-02-13

    Prior to the present study, seven species of the fossil microphorine (Dolichopodidae s. lat.) genus Microphorites Hennig, 1971 have been described: Microphorites extinctus Hennig, 1971 (type species), M. oculeus Grimaldi & Cumming, 1999, and M. similis Grimaldi & Cumming, 1999 (all from the Early Cretaceous Lebanese amber), M. deploegi Nel et al., 2004 (from the Early Cretaceous of France), M. utrillensis Peñalver, 2008 (from the Early Cretaceous amber of Spain), M. magaliae Perrichot & Engel, 2014 (from the Late Cretaceous amber of France), M. moravicus Tkoč et al., 2016 (possibly from the Paleogene amber of Moravia) (Hennig 1971; Grimaldi & Cumming 1999; Nel et al. 2004; Arillo et al. 2008; Perrichot & Engel 2014; Tkoč et al. 2016). Based on the dating of these amber species, Microphorites could be among the rare insect genera recorded from both the Cretaceous and the Paleogene. Here we describe Microphorites erikai sp. nov., first accurate Eocene Microphorites from the Oise amber (France), on the basis of a complete female specimen.

  17. Structural and medium effects on the reactions of the cumyloxyl radical with intramolecular hydrogen bonded phenols. The interplay between hydrogen-bonding and acid-base interactions on the hydrogen atom transfer reactivity and selectivity.

    Science.gov (United States)

    Salamone, Michela; Amorati, Riccardo; Menichetti, Stefano; Viglianisi, Caterina; Bietti, Massimo

    2014-07-03

    A time-resolved kinetic study on the reactions of the cumyloxyl radical (CumO(•)) with intramolecularly hydrogen bonded 2-(1-piperidinylmethyl)phenol (1) and 4-methoxy-2-(1-piperidinylmethyl)phenol (2) and with 4-methoxy-3-(1-piperidinylmethyl)phenol (3) has been carried out. In acetonitrile, intramolecular hydrogen bonding protects the phenolic O-H of 1 and 2 from attack by CumO(•) and hydrogen atom transfer (HAT) exclusively occurs from the C-H bonds that are α to the piperidine nitrogen (α-C-H bonds). With 3 HAT from both the phenolic O-H and the α-C-H bonds is observed. In the presence of TFA or Mg(ClO4)2, protonation or Mg(2+) complexation of the piperidine nitrogen removes the intramolecular hydrogen bond in 1 and 2 and strongly deactivates the α-C-H bonds of the three substrates. Under these conditions, HAT to CumO(•) exclusively occurs from the phenolic O-H group of 1-3. These results clearly show that in these systems the interplay between intramolecular hydrogen bonding and Brønsted and Lewis acid-base interactions can drastically influence both the HAT reactivity and selectivity. The possible implications of these findings are discussed in the framework of the important role played by tyrosyl radicals in biological systems.

  18. Quantitative Study of Biogas Generation Potential from Different Landfill Sites of Nepal

    Directory of Open Access Journals (Sweden)

    Bikash Adhikari

    2015-01-01

    Full Text Available This research paper was study of waste composition and quantitative analysis of biogas generation potential with its recovery at Sisdole, Pokhara and Karaute Dada landfill sites (LFS of Nepal. The waste management practice in LFS are significant deciding factors for the assessment of environmental impacts caused including the release of green house gases like methane, carbondioxide etc to the atmosphere, that could contribute significantly to global warming and climate change. The total waste disposed to Sisdole LFS, Pokhara LFS and Karaute Dada LFS are 410, 80 and 7.8 tons respectively.  The waste composition was studied onsite with waste reduction method and analyzed for their composition. The organic component of wastes was found high as 61.6%, 52.5% and 65% at Sisdole, Pokhara and Karaute Dada LFS respectively. The biogas potential at these landfill sites were 12157.78 cum, 851.99 cum and 169 cum of biogas per day in Sisdole, Pokhara and Karaute Dada LFS respectively. 4.68, 0.33 and 0.07 MW energy per day can be generated from these amounts of biogas produced in Sisdole, Pokhara and Karaute Dada LFS respectively. Proper gas collection system can be the source of income from these landfill sites and help to mitigate the adverse impact of methane that is being released from these landfill sites

  19. [The establishment of an animal model of gut-brain interaction in irritable bowel syndrome for the evaluation of visceral sensation, motility and psychological behavior.].

    Science.gov (United States)

    Lü, Hong; Qian, Jia-Ming; Jin, Guang-Liang; Zhou, Dong-Feng; Shen, Yu-Cun

    2009-12-01

    To develop a gut-brain interaction animal model of IBS which combines multiple factors including behavior, visceral sensation and motility. Setting up a multifactor interactional animal model (chronic acute combining stress model, CACS) based on a chronic unpredictable mild stress model of depression (CUMS) while combined with wrap restraint stress (WRS), changes of some indexes were recorded including motility (granules of defecating, time of defecating), visceral sensitivity (spontaneous contraction of abdominal striated muscles) and behavior/mind (sucrose consumption, body weight). G protein subunits were measured by Western blot in both hippocampus and prefrontal cortex simultaneously. (1) Compared with the state before stress given, defecating granules increased, defecating time of glassie from rectum shorten, number of abdominal contraction increased, and sucrose consumption decreased in CACS, however, neither significant change was found on defecating behavior in CUMS nor on sucrose consumption in WRS;(2) Compared with the control group, some G protein submits expression decreased in both CACS and CUMS (P animal model was a new, brain-gut interaction model, which can mimic part of human symptoms of IBS very well.

  20. Deciphering the Differential Effective and Toxic Responses of Bupleuri Radix following the Induction of Chronic Unpredictable Mild Stress and in Healthy Rats Based on Serum Metabolic Profiles

    Science.gov (United States)

    Gao, Xiaoxia; Liang, Meili; Fang, Yuan; Zhao, Fang; Tian, Junsheng; Zhang, Xiang; Qin, Xuemei

    2018-01-01

    The petroleum ether fraction of Bupleuri Radix which is contained in the traditional Chinese medicine prescription of Xiaoyaosan (XYS) may have a therapeutic effect in depressed subjects based on the results of our previous study. It has been reported that Bupleuri Radix can cause liver toxicity following overdosing or long-term use. Therefore, this study aimed to decipher the differential effective and toxic responses of Bupleuri Radix in chronic unpredictable mild stress (CUMS) (with depression) and healthy rats based on serum metabolic profiles. Serum metabolic profiles were obtained using the UHPLC- Q Exactive Orbitrap-MS technique. Our results demonstrated that the petroleum ether fraction of Bupleuri Radix (PBR) produces an antidepressant effect through regulating glycometabolism, amino acid metabolism, sphingolipid metabolism, glycerophospholipid metabolism, and fatty acid metabolism. It also induces more severe toxic reactions in the liver or kidney in healthy rats than in CUMS rats, which exhibited a comparatively mild drug-induced toxic reaction. The altered lysine degradation, sphingolipid metabolism, glycerophospholipid metabolism, fatty acid metabolism, and bile acid metabolism could be at least partly responsible for the PBR toxic responses in healthy rats. The differential effective and toxic response of PBR in CUMS rats and healthy rats provide a new standard for the more rational and safer application of clinical drugs in the future. PMID:29379441

  1. Deciphering the Differential Effective and Toxic Responses of Bupleuri Radix following the Induction of Chronic Unpredictable Mild Stress and in Healthy Rats Based on Serum Metabolic Profiles

    Directory of Open Access Journals (Sweden)

    Xiaoxia Gao

    2018-01-01

    Full Text Available The petroleum ether fraction of Bupleuri Radix which is contained in the traditional Chinese medicine prescription of Xiaoyaosan (XYS may have a therapeutic effect in depressed subjects based on the results of our previous study. It has been reported that Bupleuri Radix can cause liver toxicity following overdosing or long-term use. Therefore, this study aimed to decipher the differential effective and toxic responses of Bupleuri Radix in chronic unpredictable mild stress (CUMS (with depression and healthy rats based on serum metabolic profiles. Serum metabolic profiles were obtained using the UHPLC- Q Exactive Orbitrap-MS technique. Our results demonstrated that the petroleum ether fraction of Bupleuri Radix (PBR produces an antidepressant effect through regulating glycometabolism, amino acid metabolism, sphingolipid metabolism, glycerophospholipid metabolism, and fatty acid metabolism. It also induces more severe toxic reactions in the liver or kidney in healthy rats than in CUMS rats, which exhibited a comparatively mild drug-induced toxic reaction. The altered lysine degradation, sphingolipid metabolism, glycerophospholipid metabolism, fatty acid metabolism, and bile acid metabolism could be at least partly responsible for the PBR toxic responses in healthy rats. The differential effective and toxic response of PBR in CUMS rats and healthy rats provide a new standard for the more rational and safer application of clinical drugs in the future.

  2. β-Asarone Reverses Chronic Unpredictable Mild Stress-Induced Depression-Like Behavior and Promotes Hippocampal Neurogenesis in Rats

    Directory of Open Access Journals (Sweden)

    Haiying Dong

    2014-04-01

    Full Text Available In this study, we investigated the influence of β-asarone, the major ingredient of Acorus tatarinowii Schott, on depressive-like behavior induced by the chronic unpredictable mild stresses (CUMS paradigm and to clarify the underlying mechanisms. The results show that β-asarone treatment partially reversed the CUMS-induced depression-like behaviors in both the forced swim and sucrose preference tests. The behavioral effects were associated with increased hippocampal neurogenesis indicated by bromodeoxyuridine (BrdU immunoreactivity. β-Asarone treatment significantly increased the expression of brain-derived neurotrophic factor (BDNF at levels of transcription and translation. Moreover, CUMS caused significant reduction in ERK1/2 and CREB phosphorylation, both of which were partially attenuated by β-asarone administration. It is important to note that β-asarone treatment had no effect on total levels or phosphorylation state of any of the proteins examined in ERK1/2-CREB pathway in no stress rats, suggesting that β-asarone acts in a stress-dependent manner to block ERK1/2-CREB signaling. We did not observe a complete reversal of depression-like behaviors to control levels by β-asarone. To our knowledge, the present study is the first to demonstrate that adult neurogenesis is involved in the antidepressant-like behavioral effects of β-asarone, suggesting that β-asarone is a promising candidate for the treatment of depression.

  3. Effect of (4a) a novel 5-HT3 receptor antagonist on chronic unpredictable mild stress induced depressive-like behavior in mice: an approach using behavioral tests battery.

    Science.gov (United States)

    Kurhe, Yeshwant; Mahesh, Radhakrishnan; Gupta, Deepali; Thangaraj, Devadoss

    2015-01-01

    The inconsistent therapeutic outcome necessitates designing and identifying novel therapeutic interventions for depression. Hence, the present study deals with the investigation of antidepressant-like effects of a novel 5-HT3 receptor antagonist (4-phenylpiperazin-1-yl) (quinoxalin-2-yl) methanone (4a) on chronic unpredictable mild stress (CUMS) induced behavioral and biochemical alterations. Animals were subjected to different stressors for a period of 28 days. On day 15 after the subsequent stress procedure, mice were administered with (4a) (2 and 4 mg/kg p.o.), escitalopram (10 mg/kg p.o.), or vehicle (10 mL/kg p.o.) until day 28 along with the CUMS. Thereafter, behavioral battery tests like locomotor score, sucrose preference test, forced swim test (FST), tail suspension test (TST), and elevated plus maze (EPM) were performed. Biochemical assays like lipid peroxidation, nitrite levels, reduced glutathione (GSH), catalase, and superoxide dismutase (SOD) were estimated in the mice brain homogenate. (4a) Dose dependently attenuated the behavioral alterations by increasing the sucrose consumption, reducing the immobility time in FST and TST, increasing the open arm number of entries and time in EPM. Furthermore, biochemical alterations were reversed by (4a) as examined by reduced lipid peroxidation and nitrite levels and elevated antioxidant enzyme levels like GSH, catalase and SOD. (4a) exhibits antidepressant potential by reversing the CUMS induced behavioral and biochemical changes in mice.

  4. Magnetic moments of $^{68}$Cu$^{g,m}$ and $^{70}$Cu$^{g,m_{1},m_{2}}$ nuclei measured by in-source laser spectroscopy

    CERN Document Server

    Weissman, L; Catherall, R; Franchoo, S; Georg, U; Jonsson, O; Fedosseev, V; Mishin, V I; Seliverstov, D M; Van Roosbroeck, J; Gheysen, S; Huyse, M; Kruglov, K; Neyens, G; Van Duppen, P

    2002-01-01

    We have obtained information on the atomic hyperfine splitting and, hence, on magnetic moments in neutron rich $^{68, 70}$Cu isotopes by scanning the frequency of the narrow-band laser of the first excitation step in the resonance ionization laser ion source. The deduced magnetic moments are $\\mu( ^{68}$Cu$^{g}$, I$^{\\pi}$ = 1$^+$) = +2.48(2)(7)$\\mu_{N}$ ; $\\mu(^{68}$Cu$^{m}$, I$^{\\pi}$=6$^{-}$) = +1.24(4)(6)$\\mu_{N}$ and $\\mu(^{70}$Cu$^{m_{2}}$, I$^{\\pi}$=1$^{+}$) = +1.86(4)(6)$\\mu_{N}$ ; $\\mu(^{70}$Cu$^{g}$, I$^{\\pi}$=6$^{-}$) = +1.50(7)(8)$\\mu_{N}$. The results of the scans analysis point out on existence of a new isomer in $^{70}$Cu$^{m_{1}}$. It's deduced magnetic moment is (-)3.50(7)(11)$\\mu_{N}$ that is in a good agreement with I$^{\\pi}$=3$^{-}$ assignment. The method of in-source atomic spectroscopy, as well as the analysis of the obtained data, is described. The results are discussed in terms of single-particle configurations coupled to the $^{68}$Ni core.

  5. Xiao Yao San Improves Depressive-Like Behavior in Rats through Modulation of β-Arrestin 2-Mediated Pathways in Hippocampus

    Directory of Open Access Journals (Sweden)

    Xiaoxia Zhu

    2014-01-01

    Full Text Available Xiao Yao San (XYS is a classical Chinese medicine formula that has been widely used to treat mood disorders for hundreds of years. To confirm the effect of XYS and better understand its underlying mechanism, high-performance liquid chromatography-mass spectrometry analysis-based quality control of XYS extracts and proteomics-based identification of differential proteins in the hippocampus were adopted in social isolation and chronic unpredictable mild stress- (CUMS- treated rats. The depressive-like behavior of rats induced by CUMS resembled the manifestation of human depression. The upregulated corticosterone (CORT and urocortin 2 (UCN2 levels demonstrated the existence of hypothalamic-pituitary-adrenal (HPA axis hyperactivity. XYS was effective in ameliorating the depressive-like behavior and downregulating UCN2 and CORT. XYS decreased the expression of serine/threonine-protein phosphatase 2A subunit B and increased the expression of β-arrestin 2. The expressions of brain-derived neurotrophic factor (BDNF, tyrosine receptor kinase B (TrkB, and mammalian target of rapamycin (mTOR were also elevated by XYS. In conclusion, XYS improves social isolation and CUMS-induced depressive-like behavior and ameliorates HPA hyperactivation through the downregulation of corticotrophin releasing hormone (CRH receptor 2. The upregulation of BDNF/TrkB and the phosphorylation of mTOR require β-arrestin 2 as a scaffold to regulate stress signaling.

  6. Experimental and theoretical study of the interaction of 3-carboxy-5,6-benzocoumarin with some 1,2,3,4,5,6,7,8-octahydroacridines and the corresponding N-oxides

    Science.gov (United States)

    Marinescu, Maria; Tablet, Cristina; Potmischil, Francisc; Hillebrand, Mihaela

    2011-10-01

    The interaction of 3-carboxy-5,6-benzocoumarin (BzCum) with 1,2,3,4,5,6,7,8-octahydroacridine (OHA), 9-amino-1,2,3,4,5,6,7,8-octahydroacridine (H 2N-OHA) and the corresponding N-oxides (OHA-NO and H 2N-OHA-NO) was studied by fluorescence (steady state, time resolved) and absorption spectroscopy. The analysis of the fluorescence data in terms of Stern-Volmer plots indicated a predominant dynamic quenching for OHA and OHA-NO, and a more complex process for H 2N-OHA and H 2N-OHA-NO. The dynamic process was assigned to a photoinduced electron transfer (PET) from the acridine derivatives to the excited state of BzCum. The application of the Rehm-Weller-Marcus theory leads to a good agreement with literature data and allows for the estimation of the solvent organization energy. The presence of the PET mechanism was also supported by DFT results. The absorption spectra evidence the formation of a ground state complex assigned to a hydrogen bond complex involving the carboxylic hydrogen of BzCum.

  7. Long-term curcumin treatment antagonizes masseter muscle alterations induced by chronic unpredictable mild stress in rats.

    Science.gov (United States)

    Cui, Min; Li, Qiang; Zhang, Min; Zhao, Ya-Juan; Huang, Fei; Chen, Yong-Jin

    2014-03-01

    To investigate the correlation between psychological stress and masseter muscle (MM) alterations, and explore the therapeutic agents for restoring the impaired masticatory muscle. We established a chronic unpredictable mild stress (CUMS) animal model and observed the changes of ultrastructure, redox homeostasis and energy metabolism in MM in rats with and without curcumin treatment. The depressive-like behavior in stressed rats was confirmed by the evidences of altered behaviors in sucrose preference test and open field test; while these phenomena were eased by curcumin. Except for the pathological changes in ultrastructure, decreased SOD, GSH-Px, CAT, Na(+)-K(+)ATPase, and Ca(2+)-Mg(2+)ATPase activities as well as increased MDA and LD content and LDH activity were also observed in MM in stressed rats. However, curcumin was capable of reversing CUMS-induced MM disorder by improving the activities of the examined anti-oxidant enzymes and energy metabolism enzymes. Additionally, the increased MDA content, LD content, and LDH activity in stressed rats were reduced by curcumin. All the findings indicate the adverse effects of CUMS on MM function in rats, and raise the possibility of developing curcumin as a potential therapeutic agent for psychological stress-induced masseter dysfunction. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. Learning and memory alterations are associated with hippocampal N-acetylaspartate in a rat model of depression as measured by 1H-MRS.

    Directory of Open Access Journals (Sweden)

    Guangjun Xi

    Full Text Available It is generally accepted that cognitive processes, such as learning and memory, are affected in depression. The present study used a rat model of depression, chronic unpredictable mild stress (CUMS, to determine whether hippocampal volume and neurochemical changes were involved in learning and memory alterations. A further aim was to determine whether these effects could be ameliorated by escitalopram treatment, as assessed with the non-invasive techniques of structural magnetic resonance imaging (MRI and magnetic resonance spectroscopy (MRS. Our results demonstrated that CUMS had a dramatic influence on spatial cognitive performance in the Morris water maze task, and CUMS reduced the concentration of neuronal marker N-acetylaspartate (NAA in the hippocampus. These effects could be significantly reversed by repeated administration of escitalopram. However, neither chronic stress nor escitalopram treatment influenced hippocampal volume. Of note, the learning and memory alterations of the rats were associated with right hippocampal NAA concentration. Our results indicate that in depression, NAA may be a more sensitive measure of cognitive function than hippocampal volume.

  9. Acupuncture Activates ERK-CREB Pathway in Rats Exposed to Chronic Unpredictable Mild Stress

    Directory of Open Access Journals (Sweden)

    Jun Lu

    2013-01-01

    Full Text Available Extracellular signal-regulated kinase (ERK-cAMP response element binding protein (CREB signal pathway has been implicated in the pathogenesis of depression. There is growing evidence that acupuncture in traditional Chinese medicine has antidepressant-like effect. However, the effect of acupuncture on ERK-CREB pathway remains unknown. In our study, the antidepressant-like effect of acupuncture treatment was measured by sucrose intake test and open field test in rats exposed to chronic unpredictable mild stress (CUMS for 4 weeks. The protein levels of ERK1/2, CREB, phosphorylated ERK1/2 (p-ERK1/2, and phosphorylated CREB (p-CREB in the hippocampus (HP and prefrontal cortex (PFC were examined by Western blot analysis. Our results showed that CUMS rats exhibited the reduction in behavioral activities, whereas acupuncture stimulation at acupoints Baihui (Du20 and Neiguan (PC6 reversed the behavioral deficit. In addition, exposure to CUMS resulted in the decrease of p-ERK1/2 and p-CREB in the HP and PFC. Acupuncture increased the ratio of p-ERK1/2 to ERK1/2 and the ratio of p-CREB to CREB in the HP and PFC. Our study suggested that one potential way, by which acupuncture had antidepressant-like effect, might be mediated by activating the ERK-CREB pathway in the brain.

  10. El impacto de la violencia anticlerical en la primavera de 1936 y la respuesta de las autoridades

    Directory of Open Access Journals (Sweden)

    Álvarez Tardío, Manuel

    2013-12-01

    Full Text Available This paper examines the scope and characteristics of anticlerical violence between February and June 1936. Different primary sources have been used to reach an accurate and complete data as possible of such violence. First, we analyze the context in which this took place. Second, we present the data resulting from quantitative and qualitative research of anticlerical violence. And third, we discuss about the response to this phenomenon of various authorities. The article provides evidence that the anticlerical violence data that have been handled so far were fragmentary and did not provide the magnitude and general character which reached in the months immediately preceding the Civil War. It also shows that the government’s reaction was ambivalent. That attitude did not correspond with the promises the government made to the Nuncio in order to safeguard the legality. In many cases anti-clerical violence was the result of police passivity and it had the complicity of local authorities or groups related to the coalition that supported the government in the Congress.Este artículo analiza el alcance y las características de la violencia anticlerical en los meses de febrero a junio de 1936. Se han rastreado diferentes fuentes primarias para realizar una estadística lo más precisa y completa posible de esa violencia. Primero, se analiza el contexto en el que ésta tuvo lugar. Segundo, se presentan los datos resultantes de la investigación cuantitativa y cualitativa de la violencia anticlerical. Y tercero, se plantea cuál fue la respuesta de las diversas autoridades ante ese fenómeno. El artículo prueba que los datos sobre violencia anticlerical que se han manejado hasta ahora eran fragmentarios y no contemplaban la magnitud ni el carácter general que llegó a alcanzar en los meses inmediatamente anteriores a la Guerra Civil. Además, demuestra que la reacción del gobierno fue, como poco, ambivalente, no correspondiéndose con las promesas

  11. Chronic stress induced cognitive impairment in APP/PS-1 double transgenic mouse model of Alzheimer's disease

    Directory of Open Access Journals (Sweden)

    Bing HAN

    2015-08-01

    Full Text Available Objective  To observe the effect of chronic unpredictable mild stress (CUMS on the cognitive function and brain morphological changes in APP/PS-1 mice, one of the genetic mouse models of Alzheimer's disease (AD, and to investigate the possible role of environmental factors in genetic mouse model of AD. Methods  There were 22-week-old wild-type C57BL/6 male mice (control group, N = 15 and APP/PS-1 double transgenic male mice [N = 27: AD group (N = 13 and AD + CUMS group (N = 14] tested in this study. Morris water maze test was used to evaluate spatial learning and memory of the mice. Amyloid deposition in the hippocampus was determined by Congo red staining. The ultrastructure of neurons in hippocampal CA1 region was observed by transmission electron microscope (TEM.  Results  Compared with control group, AD + CUMS group had significantly longer fifth-day escape latency [(33.14 ± 14.37 s vs (21.22 ± 12.16 s; t = -2.701, P = 0.045], and significantly shortened time spent in platform quadrant [(9.74±1.35 s vs (15.02 ± 1.33 s; t = 2.639, P = 0.012] in Morris water maze test. Compared with AD group, the percentage of amyloid plaque area in hippocampal area was increased in AD + CUMS group [(0.59 ± 0.03% vs (0.04 ± 0.03%; t = -2.900, P = 0.005]. The ultrastructure of hippocampal neurons in AD group was slightly damaged: cellular membrane was intact; cell matrix was uniform; intracelluar lipofuscin could be seen; the structure of nucleus and nuclear membrane had no obvious changes; mild fusion of cristae and membrane was seen in mitochondria; Golgi apparatus was partially indistinct; endoplasmic reticulum was mildly expanded. The ultrastructure of hippocampal neurons in AD + CUMS group was obviously damaged, including blurred cell membrane, reduced low-density and high-density granules in cytoplasm, uneven cell matrix, reduced number of organelles, lipofuscin and autophagosome deposition, obvious condensation of chromatin distributing over

  12. Effects of duloxetine on microRNA expression profile in frontal lobe and hippocampus in a mouse model of depression.

    Science.gov (United States)

    Pan, Bing; Liu, Yamei

    2015-01-01

    Depression is a major mood disorder affecting people worldwide. The posttranscriptional gene regulation mediated by microRNAs (miRNAs) which may have critical roles in the pathogenesis of depression. However, to date, little is known about the effects of the antidepressant drug duloxetine on miRNA expression profile in chronic unpredictable mild stress (CUMS)-induced depression model in mice. Healthy adult male Kunming mice were randomly divided into three groups: control group, model group and duloxetine group. Sucrose preference test and open field test were used to represent the behavioral change. MiRNAs levels in frontal lobe and hippocampus of mice were analyzed using miRNA microarrays assay. We observed that long-term treatment with duloxetine significantly ameliorated the CUMS procedure-induced sucrose preference decreases and mice treated with duloxetine demonstrated a reversal of the number of crossings, and rearings reduced by CUMS. A significant upregulation of miR-132 and miR-18a in hippocampus in the duloxetine treatment group compared with model group, whereas the levels of miR-134 and miR-124a were significantly downregulated. Furthermore, miR-18a showed significant upregulation in frontal lobe in the duloxetine treatment group relative to model group. Our data showed that miRNA expression profile in frontal lobe and hippocampus was affected by duloxetine in mice model of depression. The effect was especially pronounced in the hippocampus, suggesting that hippocampus might be the action site of duloxetine, which presumably worked by regulating the expression of miRNA levels.

  13. Nonequilibrium Quantum Simulation in Circuit QED

    Science.gov (United States)

    Raftery, James John

    Superconducting circuits have become a leading architecture for quantum computing and quantum simulation. In particular, the circuit QED framework leverages high coherence qubits and microwave resonators to construct systems realizing quantum optics models with exquisite precision. For example, the Jaynes-Cummings model has been the focus of significant theoretical interest as a means of generating photon-photon interactions. Lattices of such strongly correlated photons are an exciting new test bed for exploring non-equilibrium condensed matter physics such as dissipative phase transitions of light. This thesis covers a series of experiments which establish circuit QED as a powerful tool for exploring condensed matter physics with photons. The first experiment explores the use of ultra high speed arbitrary waveform generators for the direct digital synthesis of complex microwave waveforms. This new technique dramatically simplifies the classical control chain for quantum experiments and enables high bandwidth driving schemes expected to be essential for generating interesting steady-states and dynamical behavior. The last two experiments explore the rich physics of interacting photons, with an emphasis on small systems where a high degree of control is possible. The first experiment realizes a two-site system called the Jaynes-Cummings dimer, which undergoes a self-trapping transition where the strong photon-photon interactions block photon hopping between sites. The observation of this dynamical phase transition and the related dissipation-induced transition are key results of this thesis. The final experiment augments the Jaynes-Cummings dimer by redesigning the circuit to include in-situ control over photon hopping between sites using a tunable coupler. This enables the study of the dimer's localization transition in the steady-state regime.

  14. Pioglitazone, a PPARγ agonist rescues depression associated with obesity using chronic unpredictable mild stress model in experimental mice

    Directory of Open Access Journals (Sweden)

    Yeshwant Kurhe

    2016-06-01

    Full Text Available Pioglitazone, a peroxisome proliferator activated receptor gamma (PPARγ agonist belonging to thiazolidinedione class, is mainly used in diabetes mellitus. Obese subjects are twice likely to become depressed than non-obese individuals. The biological mechanisms linking depression with obesity still remain poorly understood and there is immense need for better therapeutic intervention against such co-morbid disorders. The present study investigates the effect of pioglitazone on the chronic unpredictable mild stress (CUMS induced depression in obese mice by using behavioral tests and biochemical estimations. Mice were fed with high fat diet (HFD for 14 weeks and were further subjected to different stress procedures for 28 days to induce depressive behavior. Animals were administered orally with pioglitazone (30 mg/kg p.o./escitalopram (10 mg/kg p.o./vehicle (10 ml/kg p.o. daily from day 15–28. Various behavioral paradigms such as sucrose preference test, forced swim test (FST, tail suspension test (TST and elevated plus maze (EPM were performed. Biochemical estimations including plasma glucose, total cholesterol, triglycerides, and total proteins were performed. The data obtained from behavioral assays and biochemical assessments indicated that obese animals exhibited severe depressive-like behavior compared to non-obese animals. Furthermore, obese animals subjected to CUMS worsen the depressive behavior compared to obese control animals. Repetitive treatment with pioglitazone reversed the CUMS induced behavioral and biochemical alterations in HFD fed obese mice which atleast in part may be mediated through improving altered plasma glucose. The study suggests that pioglitazone needs further attention with respect to molecular mechanisms that could provide a better therapeutic strategy against depression associated with obesity.

  15. Role of Bai-Shao towards the antidepressant effect of Chaihu-Shu-Gan-San using metabonomics integrated with chemical fingerprinting.

    Science.gov (United States)

    Chang, Xing; Jia, Hongmei; Zhou, Chao; Zhang, Hongwu; Yu, Meng; Yang, Junshan; Zou, Zhongmei

    2015-12-01

    Chaihu-Shu-Gan-San (CSGS) is a classical traditional Chinese medicine formula for the treatment of depression. As one of the single herbs in CSGS, Bai-Shao displayed antidepressant effect. In order to explore the role of Bai-Shao towards the antidepressant effect of CSGS, the metabolic regulation and chemical profiles of CSGS with and without Bai-Shao (QBS) were investigated using metabonomics integrated with chemical fingerprinting. At first, partial least squares regression (PLSR) analysis was applied to characterize the potential biomarkers associated with chronic unpredictable mild stress (CUMS)-induced depression. Among 46 differential metabolites found in the ultra-performance liquid chromatography quadrupole time of flight mass spectrometry (UPLC-Q-TOF/MS) and (1)H NMR-based urinary metabonomics, 20 were significantly correlated with the preferred sucrose consumption observed in behavior experiments and were considered as biomarkers to evaluate the antidepressant effect of CSGS. Based on differential regulation on CUMS-induced metabolic disturbances with CSGS and QBS treatments, we concluded that Bai-Shao made crucial contribution to CSGS in the improvement of the metabolic deviations of six biomarkers (i.e., glutamate, acetoacetic acid, creatinine, xanthurenic acid, kynurenic acid, and N-acetylserotonin) disturbed in CUMS-induced depression. While the chemical constituents of Bai-Shao contributed to CSGS were paeoniflorin, albiflorin, isomaltopaeoniflorin, and benzoylpaeoniflorin based on the multivariate analysis of the UPLC-Q-TOF/MS chemical profiles from CSGS and QBS extracts. These findings suggested that Bai-Shao played an indispensable role in the antidepressant effect of CSGS. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. [Preliminary screening of biomarkers for curcumin's antidepressant effect based on metabonomics method].

    Science.gov (United States)

    Ma, Zhi-Jie; Zhang, Wei; Dong, Jie-Ming; Yu, Xiao-Hong; Zhao, Xiao-Mei; Pu, Shi-Biao

    2017-09-01

    To screen potential biomarkers of curcumin related to treating depression rats by using metabolomics means, so as to explore the antidepressant action mechanism of curcumin. The healthy male SD rats were randomly divided into four groups. Chronic unpredictable mild stress (CUMS) stimulation was conducted for modeling for 2 weeks, and then curcumin (200 mg•kg⁻¹) or venlafaxine (40 mg•kg⁻¹) was given by gavage administration. The blank group and model group rats were given with the same volume of 1% CMCNa normal saline, once per day for two weeks. The rats serum for each group was collected and LC/MS-IT-TOF method was used to characterize the metabolic differences. Also multivariate statistical analysis was used to screen possible potential biomarkers and analyze the possible metabolic pathways. After administration of curcumin and venlafaxine respectively, the depression indexes of CUMS model rats were all improved significantly (Pcurcumin and venlafaxine groups. In PCA and PLS-DA analysis after curcumin or venlafaxine intervention on CUMS model group rats, the small molecule metabolites level reflects a normal trend, and particularly for the curcumin group. Through metabonomics technology, 11 biomarkers associated with curcumin antidepressant effect were screened, and at the same time seven metabolic pathways were involved. The results showed that curcumin had antidepressant effects, which was evident in both macro and micro levels, comparable with positive drug of venlafaxine. The antidepressant effect of curcumin may be associated with the glycerol phospholipid metabolism, linoleic acid metabolism, pentose and glucuronic acid ester and ether lipid metabolism, but still need further exploration in the future. Copyright© by the Chinese Pharmaceutical Association.

  17. Piper sarmentosum Roxb. produces antidepressant-like effects in rodents, associated with activation of the CREB-BDNF-ERK signaling pathway and reversal of HPA axis hyperactivity.

    Science.gov (United States)

    Li, Qing; Qu, Fa-Lin; Gao, Yue; Jiang, Yi-Ping; Rahman, Khalid; Lee, Kuo-Hsiung; Han, Ting; Qin, Lu-Ping

    2017-03-06

    There are many plants of genus Piper which have been reported to induce antidepressant-like effects, Piper sarmentosum (PS) is one of them. PS is a Chinese herbal medicine and a traditional edible vegetable. In the present study, the antidepressant-like effects of PS extracts and the ethyl acetate fraction of PS extracts (PSY) were assessed using the open field test (OFT), forced swimming test (FST), and tail suspension test (TST) in mice. Furthermore, we applied a 4 consecutive weeks of chronic unpredictable mild stress (CUMS) as a model of depression in rats, followed by a sucrose preference test. Then we examined the possible mechanisms of this action. The activity of the hypothalamic-pituitary-adrenal (HPA) axis was evaluated by detecting the serum corticosterone (CORT) concentrations, and the protein expression levels of brain-derived neurotrophic factor (BDNF), the phosphorylated form CREB and ERK1/2 were detected by qRT-PCR or Western blot. The results showed that PS extracts (100, 200mg/kg) and PSY (12.5, 25, 50mg/kg) treatment produced antidepressant-like effects in mice similar to fluoxetine (20mg/kg), indicated by the reduced immobility time in the FST and TST, while both had no influence on the locomotor activity in the OFT. PSY treatment significantly increased sucrose preference and reduced serum CORT levels in CUMS rats. Moreover, PSY up-regulated BDNF protein levels, and increased CREB and ERK phosphorylation levels in the hippocampus on CUMS rats. These findings suggest that the antidepressant-like effects of PS extracts and PSY are mediated, at least in part, by modulating HPA axis, BDNF, CREB and ERK phosphorylation and expression in the hippocampus. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

  18. AfterpValues: The New Statistics for Undergraduate Neuroscience Education.

    Science.gov (United States)

    Calin-Jageman, Robert J

    2017-01-01

    Statistical inference is a methodological cornerstone for neuroscience education. For many years this has meant inculcating neuroscience majors into null hypothesis significance testing with p values. There is increasing concern, however, about the pervasive misuse of p values. It is time to start planning statistics curricula for neuroscience majors that replaces or de-emphasizes p values. One promising alternative approach is what Cumming has dubbed the "New Statistics", an approach that emphasizes effect sizes, confidence intervals, meta-analysis, and open science. I give an example of the New Statistics in action and describe some of the key benefits of adopting this approach in neuroscience education.

  19. VizieR Online Data Catalog: Chemical analysis of CH stars. II. (Karinkuzhi+, 2015)

    Science.gov (United States)

    Karinkuzhi, D.; Goswami, A.

    2017-10-01

    Low-resolution spectra of these objects obtained from 2m Himalayan Chandra Telescope at the Indian Astronomical Observatory, Hanle using HFOSC clearly show strong features due to carbon. HFOSC is an optical imager cum spectrograph for conducting low- and medium-resolution grism spectroscopy (http://www.iiap.res.in/iao/hfosc.html). High-resolution spectra necessary for abundance analyses of the programme stars are taken from the ELODIE archive (Moultaka et al. 2004PASP..116..693M). (7 data files).

  20. Theater Level War Games.

    Science.gov (United States)

    1982-06-02

    Andre, saying to myself ’What are these pe1e talking about? Does it make any difference.’ A recent special study group report, chaired by Mr. David C...Factories," woLlBeg=, p. 11. 4. Donald L. Harnett, Larry L. Cummings and G. David Hughes, nThe Influence of Risk-Taking Propensity on Bargaining Behavior... NOIA Washington: Aug. 1976. U.S. General Accounting Off ice. M1.1a adWaro A Critique of the Fou-dto efense Ana1Mzr PAD-U-21. Washington D. C.: March

  1. Stanley Cavell, Classical Hollywood and the Constitution of the Ordinary (With Notes on Billy Wilder

    Directory of Open Access Journals (Sweden)

    Tatjana Jukić

    2016-04-01

    Full Text Available When in his Tanner lectures Stanley Cavell sets out to define Ordinary Language Philosophy or – rather – to explain how it demarcates philosophy as such, he takes up psychoanalytic literary criticism in order to articulate the terms of this task. Yet the constitution of the ordinary, in Cavell, is never quite accessed from within psychoanalysis-cum-literature alone; instead, it takes another relation, that of psychoanalysis and literature to classical Hollywood, for Cavell to address the ordinary in terms of its constitution. I propose to discuss this complex using two films by Billy Wilder as a passageway to Cavell’s analytic procedure.

  2. Cálculo del flujo ambiental como sustento para la reserva de agua al ambiente del río Piaxtla, Sinaloa, México

    OpenAIRE

    Guadalupe de la Lanza Espino; Sergio Alberto Salinas Rodríguez; José Luis Carbajal Pérez

    2015-01-01

    El cálculo del caudal fluvial necesario para mantener los servicios ambientales de los diferentes tipos de cuenca en los ríos de México, ha sido un elemento a cum - plir en la Norma Mexicana, lo que permite una adecuada administración del recurso hídrico. Para dicho cálculo se han propuesto diferentes metodologías, una de las cuales por su sencillez es la hidrológica, requiriendo para ello una base de datos de escurrimientos que permitan determinar el volumen de agua necesario para las...

  3. Military Review, January 1992. Volume 72, Number 1

    Science.gov (United States)

    1992-01-01

    ftin U- Illodm Aored Drinsio 141asaarshi Armored Omnicel 2 ACAI (cowe) ’" " 1First C.. .t dolmll.q,, .. .... Permn Cum Saudi Arabia held in early...improve, with benefits for both countries. 1990 that "the most likely near-term prospect is However, the economic basis for potential that Iraq will seek...ine may erupt, and medical care may be discon- The latter traditionally receives the benefit of tinued. Thus, when we talk about the most the doubt

  4. Dye solar cell research

    CSIR Research Space (South Africa)

    Cummings, F

    2009-11-01

    Full Text Available Cummings Energy and Processes Materials Science and Manufacturing Council for Scientific and Industrial Research P.O. Box 395 Pretoria 0001, South Africa 27 November 2009 CONTENT head2rightBackground head2rightCSIR Dye Solar Cell Research head2... rightCollaborations and Links © CSIR 2007 www.csir.co.za head2rightAcknowledgements BACKGROUND head2rightSA is dry: Annual rainfall average of 450 mm compared with a world average of 860 mm head2rightOn upside, we have some...

  5. Dye solar cell research: EU delegation presentation

    CSIR Research Space (South Africa)

    Cummings, F

    2009-11-09

    Full Text Available Franscious Cummings Energy and Processes Materials Science and Manufacturing Council for Scientific and Industrial Research P.O. Box 395 Pretoria 0001, South Africa 13 November 2009 © CSIR 2007 www.csir.co.za CONTENT head2right...Background head2rightCSIR Dye Solar Cell Research head2rightCollaborations and Links head2rightAcknowledgements © CSIR 2007 www.csir.co.za BACKGROUND head2rightSA is dry: Annual rainfall average of 450 mm compared with a world average...

  6. Digital behavioral and psychological principles

    CERN Document Server

    Hausman, Angela

    2014-01-01

    The chapters in this e-book lie firmly within Web 2.0 and deal with human aspects of interactions between consumers and between consumers and brands in digital space. The first chapter, Consumer Behavior in the Online Context, by Cummings, Peltier, Schibrowsky and Nill, provides an excellent introduction to this ebook by reviewing literature related to the consumer behavior and social network theory as they apply to the Internet, literature covering the period from 1993-2012, spanning over 900 articles across more than 85 marketing journals. The second chapter, by Kabadayi and Price, investiga

  7. Reflexiones sobre algunas acciones de internacionalización de la educación en la UAM-Xochimilco

    OpenAIRE

    Luis Felipe Bojalil

    2009-01-01

    La educación superior se enfrenta a cambios vertiginosos en las sociedades actuales, aparte de los viejos problemas, como el bajo acceso de los jóvenes a la educación superior, el aumento en la demanda que no está satisfecha y la desigualdad, entre otros. Nos encontramos ahora con la globalización que en el campo educativo nos lleva a la internacionalización, esto aunado al acelerado avance científico y tecnológico, al que si las instituciones no le ponen la debida atención, las llevará a cum...

  8. complexes with thiophene based N -substituted thiosemicarbazones

    Indian Academy of Sciences (India)

    OAc),11 and [Ag2(μ-S-Htsc)(μ-PPh2-CH2-PPh2)2(κ1-. ONO2)](NO3).13 In these complexes, the thio-ligands bind as neutral Lewis bases in κ1-S terminal (A), μ-S bridging (B), μ3-N3,S chelating- cum –sulfur bridging. (C) and N3,S-chelating (D) modes (chart 1). In view of our interest in coordination chemistry of silver(I) with ...

  9. Summary of Synoptic Meteorological Observations (SSMO), Central American Coastal Marine Areas West Coast. Volume 1. Area 1 - Central Baja West, Area 2 - Southwest Baja, Area 3 - Gulf of California, Area 4 - Mazatlan, Area 5 - Puerto Vallarta

    Science.gov (United States)

    1981-02-01

    14.2 31.• 27.1 II.0 5.3 2.1 PPPCfM ftEOUEhC» OF VIVE "CUM IF7I «5 HKVI >[>I00 I5CC040SI 12 13-14 17-1« 20-22 23-25 24-12...D0O2 IOUTHHCSI MJ« OF « HtC PU CCICITAMO** CCIIOM VS 0 ITh «IkflhG :CUR*E>>CE o« MOti-occi’Ricocr or ►CT ICTIL All IfUl

  10. Spin squeezing and Schrödinger cat generation in atomic samples with Rydberg blockade

    DEFF Research Database (Denmark)

    Opatrný, Tomáš; Mølmer, Klaus

    2012-01-01

    to Rydberg states and an effective Jx interaction implemented by a resonant Raman coupling between the atomic ground states. Dynamical evolution both with a constant Hamiltonian and with adiabatic variation of the two interaction terms is studied. We show that by the application of further resonant laser......A scheme is proposed to prepare squeezed states and Schrödinger-cat-like states of the collective spin degrees of freedom associated with a pair of ground states in an atomic ensemble. The scheme uses an effective Jaynes-Cummings interaction which can be provided by excitation of the atoms...

  11. The sino-Indian origin of chemeia and chumeia as synonyms in grek, signifying alchemy.

    Science.gov (United States)

    Mahdihassan, S

    1984-10-01

    In China the antecedent of alchemy is represented by the god of longevity emerging from the peach. The first synthetic drug, Kim-Yeh, red colloidal gold, signified gold-cum -herbal juice. Kim-Yeh=Kimiya (Arabic) =chemeia (Greek). Translated this gave Chrusozomion=Gold Ferment, specifying the drug. Rasayana was translated as Chumeia, herbal juice-incorporate and signified the art alchemy. Chemeia was Chinese and Chumeia, Indian. Originally each signified both, a drug of longevity and the art, alchemy. Finally the art of making red gold was misunderstood as the art of making gold itself.

  12. Methodological Principles of Polycultural Education

    Directory of Open Access Journals (Sweden)

    Andrienko Nadejda Konstantinovna

    2017-09-01

    Full Text Available This article elaborates polycultural education approach. Three main approaches for understanding of polycultural education (acculturation, dialogue and social cum psychological are considered and conceptions evolved within their framework. Attention is also paid to the foreign and domestic (Russian researches in this area. In the end of the article the author handles the idea of “polycultural education”. The article deals with the following: dialogue approach, which is based on the ideas of cultures dialogue, openness, cultural pluralism; activity-oriented conception of polycultural education, conception of multi-perspective education, conception of “cultural differences”, and conception of social education.

  13. FROM ACTION LEARNING TOTHETEACHING ORGANIZATION: An Experiential Approach

    Directory of Open Access Journals (Sweden)

    Teddy Pawitra

    2003-05-01

    Full Text Available This paper expounds action learning for effective change leadership development using the learning-teaching helix as a paradigm for individual’s introspection. Which consists of five phases—Awareness phase (as certain your strengths and weaknesses. Alignment phase (identify your core competence. Action phase (synthesize your work, business and management skills, Adoption phase (becoming a leader and Assurance phase (excel as an educator cum coach. In addition, to succeed, the individual has to plan, strategize, prioritize and integrate. As a holistic manager the individual needs to think, feel and do to evolve from continuous action learning to the cycle of teaching for continuous innovation in organizational performance capabilities.

  14. Major General Malcolm C. Grow, M.D. (1887-1960) Soldier, Surgeon, Airman.

    Science.gov (United States)

    Walker, Tyler R; Cowan, Scott W; Yeo, Charles J; Beekley, Alec C

    2017-11-01

    World War I (WWI) and World War II (WWII) both presented physicians with challenges unseen before in history. New inventions such as the machine gun and poisonous gas in WWI and the massive aircraft battles in WWII required physicians and surgeons to adapt and innovate to provide the best care and preventative measures for service members. One physician, Malcolm Cummings Grow, distinguished himself as an innovator, a researcher, and a leader. His contributions to the field of military medicine, flight surgery, and medical administration led to countless lives being saved during the two World Wars and laid the groundwork for many different combat protective equipment still in use today.

  15. Elementary Thermal Operations

    DEFF Research Database (Denmark)

    Lostaglio, Matteo; Alhambra, Álvaro M.; Perry, Christopher

    2018-01-01

    To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes-Cummings in......To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes...

  16. The Cult of 'Krazy Kat': Memory and Recollection in the Age of Mechanical Reproduction

    Directory of Open Access Journals (Sweden)

    Aaron Humphrey

    2017-06-01

    Full Text Available George Herriman’s comic strip 'Krazy Kat' has been discussed in mythic terms for more than half a century. This article argues that much of this ‘mythology’ has not been founded on the material itself, but rather on memories and recollections of readers and critics. Using Walter Benjamin’s notions of cult value and exhibition value, this article investigates the historical circumstances that shaped the most prominent of these recollections to show how writers like Gilbert Seldes and E. E. Cummings shaped the myth of 'Krazy Kat' to create an ‘aura’ of genius around a work that was largely inaccessible to most readers.

  17. Anglophone Music as Poetry

    OpenAIRE

    Lacmanović, Matea

    2015-01-01

    Literature as a whole is usually divided into poetry, prose and drama (Solar 2006: 154) with fairly clear boundaries between them. When it comes to their subdivision and definition of specific literature and art type, the boundaries become unclear and many questions arise. One of the most difficult questions to answer is what poetry is and which criteria must be met in order for some work to be classified as poetry. It is known that authors such as Shakespeare, Byron, Cummings or Angelou are ...

  18. A liberdade humana e as suas diferentes situações existenciais: a infância, o sono, a demência e a ignorância no pensamento de Luis de Molina (1535-1600 = Human freedom and its different existential situations: infancy, sleep, insanity and ignorance according to Luis de Molina(1535-1600

    Directory of Open Access Journals (Sweden)

    Rebalde, João Carlos Martins

    2014-01-01

    Full Text Available Neste estudo, pretende-se mostrar como o jesuíta Luis de Molina define a liberdade humana e a pensa em diferentes situações existenciais, nomeadamente a infância, o sono, a demência e a ignorância, na obra Concordia liberi arbitrii cum gratiae donis, divina praescientia, providentia, praedestinatione et reprobatione (1588. Discute-se também a importância da educação, da medicina e da religião no desenvolvimento do ser humano, no pensamento de Molina

  19. Effect of Teriparatide, Vibration and the Combination on Bone Mass and Bone Architecture in Chronic Spinal Cord Injury

    Science.gov (United States)

    2015-12-01

    Engl J Med. 2007;356(18):1809–22. 38. Cummings SR, San Martin J, McClung MR, Siris ES, Eastell R, Reid IR, et al. Denosumab for prevention of...Medical evaluation of the effects of computer assisted muscle stimulation in paraplegic patients. Orthopedics. 1984;7:1129–33. 41. Hartkopp A, Murphy RJ... assisted muscle stimulation in paraplegic patients. Orthopedics. 1984;7:1129–33. 43. Hartkopp A, Murphy RJ, Mohr T, Kjaer M, Biering-Sorensen F. Bone

  20. Dispersive Response of a Disordered Superconducting Quantum Metamaterial

    Directory of Open Access Journals (Sweden)

    Dmitriy S. Shapiro

    2015-04-01

    Full Text Available We consider a disordered quantum metamaterial formed by an array of superconducting flux qubits coupled to microwave photons in a cavity. We map the system on the Tavis-Cummings model accounting for the disorder in frequencies of the qubits. The complex transmittance is calculated with the parameters taken from state-of-the-art experiments. We demonstrate that photon phase shift measurements allow to distinguish individual resonances in the metamaterial with up to 100 qubits, in spite of the decoherence spectral width being remarkably larger than the effective coupling constant. Our simulations are in agreement with the results of the recently reported experiment.

  1. Adjustment and long-run economic performance in 18 African countries

    DEFF Research Database (Denmark)

    Gebregziabher, Fiseha

    2015-01-01

    This paper investigates the link between IMF-World Bank stabilisation-cum-structural adjustment programs and long-run economic performance in 18 African countries on a country-specific basis for the period 1960-2009. We employ a structural break approach to study the impact on long-run growth...... trajectories of the introduction of adjustment programs. The analysis reveals that only few countries have shown positive and sustained results. The traditional (first-generation) Fund-Bank adjustment package is linked with sustained increase in Gross Domestic Product, export and investment growth rates only...

  2. Propolis in dentistry and oral cancer management.

    Science.gov (United States)

    S, Vagish Kumar L

    2014-06-01

    Propolis, known as bee glue, is a wax-cum-resin substance, which is created out of a mix of buds from some trees with the substance secreted from the bee's glands. Its diverse chemical content is responsible for many valuable properties. Multiple applications of propolis have been studied and described in detail for centuries. However, currently available information on propolis is scarce. A literature search in the PubMed database was performed for English language articles, using the search terms propolis, oral health, dentistry, and oral cancer; no restrictions were used for publication dates. The aim of the article was to review propolis and its applications in dentistry including oral cancer.

  3. Seismic Analysis of Reinforced Concrete Shaft Support Water Storage Tank

    OpenAIRE

    Bharti Tekwani; Dr. Archana Bohra Gupta

    2016-01-01

    This paper compares the results of Seismic Analysis of Reinforced Concrete Shaft Support Water Storage Tank carried out in accordance with IS: 1893- 1984 and IS: 1893-2002 (Part-2) draft code. The analysis is carried out for shaft supported water tank of 500,750 and 1000 Cu.m capacity, located in four seismic zones (Zone-II, Zone -III, Zone-IV, Zone-V) and on three different soil types (Hard rock, Medium soil, Soft soil). Further, 1000 kl tank for conditions - tank full, tank empt...

  4. Synthesis and Characterization of Boron Nitride and Molybdenum Nitride Multi-Walled Nanotubes Using Liquid Plasma Arc Discharge

    Science.gov (United States)

    Holliday, Roger; Falvo, Mike; Washburn, Sean; Superfine, Rich

    2001-11-01

    We will present results on synthesis of Boron Nitride and Molybdenum Nitride nanotubes using the liquid nitrogen plasma-arc discharge method previously reported for carbon nanotubes synthesis[1]. We created a 60-100A/20-40V arc across electrodes of Hafnium Boride and Molybdenum Sulfide in a liquid nitrogen atmosphere. Nanotube geometry, nano-structure and composition characterization using TEM and EDAX will be presented. Progress in electronic and mechanical characterization as well as our incorporation of these nanotubes in to novel NEMS devices will be discussed. [1] M. Ishigami, J. Cummings, A. Zettl, S. Chen. Chemical Physical Letters 319 (2000) 457-459.

  5. Development and Testing of Rapid Repair Methods for War Damaged Runways

    Science.gov (United States)

    1990-01-01

    volume of paste to air-free volume of 3 mortar CPv) equal to suitable value for interior mass mix in accordance with ACI Code (20). I Pv - 3B.0% Step...2) Select flyash /cement (F/C) and water/Ccement + Flyash ) (W/(C+F)) UOLUME ratios from ACI Code (21). F/C - 0.0% I Uolume W/CC+F) - 15i.0% Step (3) 3...aggregatb (23). 3 Uca - 4S.O0 Step (q) Calculate the volume of air-free mortar per cubic yard Cum) assuming 2% entrapped air (Ua) (24) using equation 1

  6. Fluidized bed coal desulfurization

    Science.gov (United States)

    Ravindram, M.

    1983-01-01

    Laboratory scale experiments were conducted on two high volatile bituminous coals in a bench scale batch fluidized bed reactor. Chemical pretreatment and posttreatment of coals were tried as a means of enhancing desulfurization. Sequential chlorination and dechlorination cum hydrodesulfurization under modest conditions relative to the water slurry process were found to result in substantial sulfur reductions of about 80%. Sulfur forms as well as proximate and ultimate analyses of the processed coals are included. These studies indicate that a fluidized bed reactor process has considerable potential for being developed into a simple and economic process for coal desulfurization.

  7. Allergic asthmatics show divergent lipid mediator profiles from healthy controls both at baseline and following birch pollen provocation.

    Directory of Open Access Journals (Sweden)

    Susanna L Lundström

    Full Text Available Asthma is a respiratory tract disorder characterized by airway hyper-reactivity and chronic inflammation. Allergic asthma is associated with the production of allergen-specific IgE and expansion of allergen-specific T-cell populations. Progression of allergic inflammation is driven by T-helper type 2 (Th2 mediators and is associated with alterations in the levels of lipid mediators.Responses of the respiratory system to birch allergen provocation in allergic asthmatics were investigated. Eicosanoids and other oxylipins were quantified in the bronchoalveolar lumen to provide a measure of shifts in lipid mediators associated with allergen challenge in allergic asthmatics.Eighty-seven lipid mediators representing the cyclooxygenase (COX, lipoxygenase (LOX and cytochrome P450 (CYP metabolic pathways were screened via LC-MS/MS following off-line extraction of bronchoalveolar lavage fluid (BALF. Multivariate statistics using OPLS were employed to interrogate acquired oxylipin data in combination with immunological markers.Thirty-two oxylipins were quantified, with baseline asthmatics possessing a different oxylipin profile relative to healthy individuals that became more distinct following allergen provocation. The most prominent differences included 15-LOX-derived ω-3 and ω-6 oxylipins. Shared-and-Unique-Structures (SUS-plot modeling showed a correlation (R(2 = 0.7 between OPLS models for baseline asthmatics (R(2Y[cum] = 0.87, Q(2[cum] = 0.51 and allergen-provoked asthmatics (R(2Y[cum] = 0.95, Q(2[cum] = 0.73, with the majority of quantified lipid mediators and cytokines contributing equally to both groups. Unique structures for allergen provocation included leukotrienes (LTB(4 and 6-trans-LTB(4, CYP-derivatives of linoleic acid (epoxides/diols, and IL-10.Differences in asthmatic relative to healthy profiles suggest a role for 15-LOX products of both ω-6 and ω-3 origin in allergic inflammation. Prominent differences at baseline levels indicate

  8. Application of TiO2 nanotubes in dye-sensitised solar cells for improved charge transport

    CSIR Research Space (South Africa)

    Cummings, F

    2010-09-01

    Full Text Available their operation • 20 years onwards and big strides have been made, however head2right Efficiency of best manufactured DSCs ~ 11% mark and 7% for DSC panels Dye-sensitised Solar Cells • Relatively inexpensive – Made in non-vacuum setting – Simple... in dye- sensitised solar cells for improved charge transport Franscious Cummings Energy and Processes Materials Science and Manufacturing © CSIR 2010 Slide 1 Rhodes Workshop 7 – 8 September 2010 circle6 Background circle6 Problem Statement...

  9. River Mileages and Drainage Areas for Illinois Streams. Volume 1. Illinois Except Illinois River Basin.

    Science.gov (United States)

    1979-12-01

    NEAR NEOGA 57.0 391959 0882856 MATTOON ?24.3 SHELHY-CUMBERLANO CO LN MATTOON 225.5 RRUkH CREEK L MATTOON 226.2 USGS GAGE 03378616 BLW CLEAR CR NR...03344000 NEAR DIONA 919 392040 0881015 TOLEDO 106.5 CUM8ERLAND-COLES CO LN TOLEDO 107.4 ROAD S23,TIINoRO9E TOLEDO 107.4 USGS GAGE 03343975 BLW FARMINGTON...FARMINGTON 894 392521 0881035 TOLEDO 115.3 USGS GAGE 03343900 BLW CHARLESTON 892 392606 0880956 TOLEDO 115.5 KICKAPO0 CREEK R TOLEDO 118.5 ROAD 525.T12N9R

  10. Solvent-Free Synthesis of Some1-Acetyl Pyrazoles

    Energy Technology Data Exchange (ETDEWEB)

    Thirunarayanan, Ganesamoorthy [Annamalai Univ., Tamil Nadu (India); Sekar, Krishnamoorthy Guna [National College, Tiruchirappalli (India)

    2013-10-15

    Some N-acetyl pyrazoles including 1-(3-(3,4-dichlorophenyl)-5-(substituted phenyl)-4,5-dihydro-{sup 1}H-pyrazole-1-yl) ethanones have been synthesised by solvent free cyclization cum acetylation of chalcones like substituted styryl 3,4-dichlorophenyl ketones using hydrazine hydrate and acetic anhydride in presence of catalytic amount of fly-ash: H{sub 2}SO{sub 4} catalyst. The yield of these N-acetyl pyrazole derivatives are more than 75%. The synthesised N-acetyl pyrazoline derivatives were characterized by their physical constants and spectral data.

  11. A teoria geral dos campos de Pierre Bourdieu : uma leitura

    OpenAIRE

    Miguel Ângelo MONTAGNER; Montagner,Maria Inez

    2011-01-01

    Este artigo analisa as obras de Pierre Bourdieu, e por meio delas, realiza um esboço de uma teoria geral dos campos, ausência assumida pelo autor e por ele encarada como um vade-mécum. A despeito desse temor e do perigo de reducionismo inerente a tal tarefa, julgo importante ensaiar essa síntese, dadas a complexidade do pensamento do autor aliada a uma escrita por vezes acachapante e barroca, as imprecisões de tradução, a existência de textos não traduzidos e, por fm, lacunas explicativas da...

  12. Coupling bosonic modes with a qubit: entanglement dynamics at zero and finite temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Ciancio, Emanuele [Institute for Scientific Interchange (ISI), Viale Settimio Severo 65, 10133 Turin (Italy)]. E-mail: ciancio@isiosf.isi.it; Zanardi, Paolo [Institute for Scientific Interchange (ISI), Viale Settimio Severo 65, 10133 Turin (Italy)]. E-mail: zanardi@isiosf.isi.it

    2006-12-18

    We consider a system of two iso-spectral bosonic modes coupled with a single two-level systems i.e., a qubit. The dynamics is described by a mode-symmetric two-modes Jaynes-Cummings Hamiltonian. The entanglement, induced between the two bosonic modes, is analyzed and quantified by negativity. We computed the time evolution of negativity starting from an initial thermal state of the bosonic sector for both zero and finite temperature. We also studied the entangling power of the interaction as a function of mode-qubit detuning and its resilience against temperature increase. Finally a two-qubit gate based on bosonic virtual subsystem is discussed.

  13. VESICO-URETERIC REFLUX IN CHILDREN WITH PRENATALLY DIAGNOSED HYDRONEPHROSIS: CHARACTERISTICS AND EVOLUTION

    OpenAIRE

    Hernandez, T.; Madalena, C.; Teixeira, P.; Matos, P.

    2004-01-01

    Objectivo: conhecer as características e evolução do Refluxo vésicoureteral ( RVU) de diagnóstico pré-natal, nas crianças vigiadas numa na Consulta de Nefrologia Pediátrica nos último 10 anos. Material e Métodos: entre Janeiro de 1992 e Dezembro de 2002 foram enviados à consulta 322 crianças com diagnóstico pré-natal de uropatia malformativa. Destas, 216 tinham critérios para realizar Cistouretrografia miccional seriada (CUMS) e 29 apresentaram RVU primá...

  14. El proceso de diseño. En tesis “El taller total, una evaluación formativa”, p. 68-83

    OpenAIRE

    Kuna, Graciela de

    2006-01-01

    Extracto (Parte 1, capítulo 2) de la Tesis Doctoral “El taller total, una evaluación formativa”, Sobresaliente Cum Laude por la Universidad de Sevilla, España 2006 de la Dra. Arq. Graciela Gayetzky de Kuna - Arquitecta (Universidad de Buenos Aires, 1985), Doctora en Educación en Artes Visuales (Universidad de Sevilla, 2006) Diplomada en Estudios Avanzados-Suficiencia Investigativa (Universidad de Sevilla, España, 2003) Magister en Educación por el Arte (Universidad de Misiones, 2002). Profeso...

  15. AN IMPROVED SNOOP FOR TCP RENO AND TCP SACK IN WIRED-CUMWIRELESS NETWORKS

    OpenAIRE

    Rimmi Saini; Sanjay Kumar Dubey; Ajay Rana

    2011-01-01

    TCP is the most widely used transport protocol originally designed for wired networks. But many experiments have shown that its performance is poor when used in wireless networks. Also improving its performance in wired-cum-wireless networks preserving the end-to-end nature of TCP is a difficult task. To address this issue,several new protocols and TCP modifications have been proposed. Snoop is one such modification. But it can not be used in isolation but has to be combined with TCP. Wheneve...

  16. How Modern Science Came into the World : Four Civilizations, One 17th-Century Breakthrough

    OpenAIRE

    Cohen, H. Floris

    2010-01-01

    Once upon a time ‘The Scientific Revolution of the 17th century’ was an innovative concept that inspired a stimulating narrative of how modern science came into the world. Half a century later, what we now know as ‘the master narrative’ serves rather as a strait-jacket — so often events and contexts just fail to fit in. No attempt has been made so far to replace the master narrative. H. Floris Cohen now comes up with precisely such a replacement. Key to his path-breaking analysis-cum-narrativ...

  17. Measurement of excitation functions of helion-induced reactions on enriched Ru targets for production of medically important 103Pd and 101mRh and some other radionuclides.

    Science.gov (United States)

    Skakun, Ye; Qaim, S M

    2008-05-01

    Excitation functions were determined by the stacked-foil and induced radioactivity measurement technique for the reactions (100)Ru(alpha,n)(103)Pd, (101)Ru(alpha,2n)(103)Pd, (101)Ru((3)He,n)(103)Pd, and (102)Ru((3)He,2n)(103)Pd, producing the therapeutic radionuclide (103)Pd, and for the reactions (101)Ru((3)He,x)(101 m)Rh(Cum) and (102)Ru((3)He,x)(101 m)Rh(Cum), producing the medically interesting radionuclide (101 m)Rh. Data were also measured for the reactions (101)Ru((3)He,pn+d)(102 m,g)Rh, (102)Ru((3)He,p2n+dn+t)(102 m,g)Rh, (101)Ru((3)He,x)(101 g)Rh(Cum), (102)Ru((3)He,x)(101 g)Rh(Cum), (101)Ru((3)He,3n)(101)Pd, (102)Ru((3)He,4n)(101)Pd, (101)Ru((3)He,4n)(100)Pd, and (101)Ru((3)He,p3n+d2n+tn)(100)Rh, producing other palladium and rhodium isotopes/isomers. The energy ranges covered were up to 25 MeV for alpha-particles and up to 34 MeV for (3)He ions. The radioactivity of the radionuclide (103)Pd induced in thin metallic foils of the enriched ruthenium isotopes was measured by high-resolution X-ray spectrometry and the radioactivities of other radionuclides by gamma-ray spectrometry. The integral thick target yields of the radionuclide (103)Pd calculated from the excitation functions of the first four of the above-named reactions amount to 960, 1050, 50, and 725 kBq/microAh, respectively, at the maximum investigated energies of the incident particles. The integral thick target yields of the radionuclide (101 m)Rh amount to 16.1 and 2.9 MBq/microAh for (101)Ru and (102)Ru targets, respectively, at 34 MeV energy of incident (3)He ions. The integral yields of the other observed radionuclides were also deduced from the excitation functions of the above-mentioned respective nuclear reactions. The excitation functions and integral yields of some rare reaction products were also determined. The experimental excitation functions of some reactions are compared with the predictions of nuclear model calculations. In general, good agreement was obtained.

  18. Excitation function and yield for the (103)Rh(d,2n)(103)Pd nuclear reaction: Optimization of the production of palladium-103.

    Science.gov (United States)

    Manenti, Simone; Alí Santoro, María Del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia

    2017-06-01

    Deuteron-induced nuclear reactions for the generation of (103)Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to Ed=33MeV. The excitation functions of the reactions (103)Rh(d,xn)(101,103)Pd, (103)Rh(d,x)(100g,cum,101m,g,102m,g)Rh and (103)Rh(d,2p)(103)Ru have been measured, and the Thick-Target Yield for (103)Pd has been calculated. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. From Complex Organisms to a Complex Organization: An Oral History with UCSC Chancellor M.R.C. Greenwood, 1996-2004

    OpenAIRE

    Reti, Irene H.; Greenwood, M.R.C.

    2014-01-01

    The Regional History Project conducted this oral history with UCSC Chancellor M.R.C. (Mary Rita Cooke) Greenwood as part of its University History series. Greenwood was appointed as chancellor of UC Santa Cruz in July of 1996 and served until April of 2004. While at UCSC, she also held an appointment as a professor of biology. M.R.C. Greenwood was born in 1943 in Gainesville, Florida. She graduated summa cum laude in biology from Vassar College in 1968, and earned her PhD in physiolo...

  20. Spin-orbit-induced strong coupling of a single spin to a nanomechanical resonator

    DEFF Research Database (Denmark)

    Pályi, András; Struck, P R; Rudner, Mark

    2012-01-01

    We theoretically investigate the deflection-induced coupling of an electron spin to vibrational motion due to spin-orbit coupling in suspended carbon nanotube quantum dots. Our estimates indicate that, with current capabilities, a quantum dot with an odd number of electrons can serve...... as a realization of the Jaynes-Cummings model of quantum electrodynamics in the strong-coupling regime. A quantized flexural mode of the suspended tube plays the role of the optical mode and we identify two distinct two-level subspaces, at small and large magnetic field, which can be used as qubits in this setup...

  1. Da den danske skole satte humanistlatin i system

    DEFF Research Database (Denmark)

    Horster, Camilla

    2017-01-01

    This article presents a pilot study of the use of moods and tenses in Danish humanist Latin after ne and cum. Comparing descriptions in humanist school grammars with linguistic practice, three states of humanist Latin are under investigation in minor text corpora: literary prose from fifteenth......-century Italy, literary prose from sixteenth-century Denmark, and entrance exams from the University of Copenhagen (1631– 32). The results indicate that the distribution of moods and the sequence of tenses are stable grammatical systems that exist in all three states of Latin, though with less variation...

  2. How to solve the tragedy of the commons? Social entrepreneurs and global public goods

    DEFF Research Database (Denmark)

    Ueda, Yoshifumi; Svendsen, Gert Tinggaard

    2002-01-01

    and efficacy of financing a global public good on a local scale is analyzed in a "selective incentive-cum-global public good" model. Because local networks can play a significant role in preserving the global commons, this finding has important policy implications for global public good provisions......We show that when a star type network is formed by an entrepreneur, a non-profit organization run by a social entrepreneur is more reconcilable with the social objective of providing the global public good than a profit organization run by a business entrepreneur. This network formation...

  3. Photon Berry phases, Instantons and Schrodinger Cats with oscillating parities in cavity QED

    CERN Document Server

    Yi-Xiang, Yu; Liu, W M; Zhang, CunLin

    2015-01-01

    The four standard quantum optics model in cavity QED such as Rabi, Dicke, Jaynes-Cummings ( JC ) and Tavis-Cummings (TC) model were proposed many decades ago. Despite their relative simple forms and many previous theoretical works, their solutions at a finite $ N $ inside the superradiant regime remain unknown. In view of recent remarkable experimental advances in several experimental systems such as cold atoms inside a cavity or superconducting qubits inside a microcavity to realize these models, it becomes topical and important to understand what would be the new phenomena in these models at a finite $ N $, especially inside the superradaint regime. In this work, we resolved this outstanding problem. We use three independent methods such as $ 1/J $ expansion, the strong coupling expansion and exact diagonization (ED) to study $ U(1)/Z_2 $ Dicke model at a finite $ N $ and different anisotropy parameters $ 0 \\leq \\beta \\leq 1 $ as the atom-photon interaction strength increases. This model include the four st...

  4. Evolution of Integrated Open Aquaculture Systems in Hungary: Results from a Case Study

    Directory of Open Access Journals (Sweden)

    József Popp

    2018-01-01

    Full Text Available This article presents the history of integrated farming in aquaculture through a Hungarian case study. The development of Hungarian integrated aquaculture is aligned with global trends. In the previous millennium, the utilization of the nutrients introduced into the system was the main aspect of the integration. In Hungary, technologies that integrated fish production with growing crops and animal husbandry appeared, including for example: large-scale fish-cum-rice production; fish-cum-duck production; and integrated pig-fish farming which were introduced in the second half of the 20th century. Today, the emphasis is on integrating the use of the kind of feed where the main goal is to minimize nutrient loads in the surrounding natural ecosystems and to maximize the utilization of the unit’s water resources. The various modern integrated freshwater aquaculture systems, such as intensive fish production combined with wetland, recirculation aquaculture system and multi-functional aquaculture, have proved their viability. However, the future opportunities for these systems have not always been properly recognized and acknowledged when the future of European aquaculture is discussed.

  5. PLS and shape-based similarity analysis of maleimides--GSK-3 inhibitors.

    Science.gov (United States)

    Crisan, Luminita; Pacureanu, Liliana; Avram, Sorin; Bora, Alina; Avram, Speranta; Kurunczi, Ludovic

    2014-08-01

    Glycogen synthase kinase-3 (GSK-3) overactivity was correlated with several pathologies including type 2 diabetes mellitus, Alzheimer's disease, cancer, inflammation, obesity, etc. The aim of the current investigation was to model the inhibitory activity of maleimide derivatives--inhibitors of GSK-3, to evaluate the impact of alignment on statistical performances of the Quantitative Structure-Activity Relationship (QSAR) and the effect of the template on shape-similarity--binding affinity relationship. Dragon descriptors were used to generate Projection to Latent Structures (PLS) models in order to identify the structural prerequisites of maleimides to inhibit GSK-3. Additionally, shape/volume structural analysis of binding site interactions was evaluated. Reliable statistics R(2)(Y(CUM)) = 0.938/0.920, Q((2)(Y)(CUM)) = 0.866/0.838 for aligned and alignment free QSAR models and significant (Pearson, Kendall and Spearman) correlations between shape/volume similarity and affinities were obtained. The crucial structural features modulating the activity of maleimides include topology, charge, geometry, 2D autocorrelations, 3D-MoRSE as well as shape/volume and molecular flexibility.

  6. The tradition of alchemy in India.

    Science.gov (United States)

    Mahdihassan, S

    1981-01-01

    The Aryan of ancient times was a nomad who lived mainly by hunting. The aged, incapable of partaking in such activity, were considered parasites and were exiled as lonely ascetics to the forest. The ascetic began searching for a strength-giving drug so that he could collect edible plants from the forest. He discovered ephedra or the soma plant as an energizer-cum-euphoriant. Feeling stronger and happier he entertained the idea of a drug of rejuvenation. The Aryan nomad as a hunter often over-exerted himself and became exhausted. He then took soma juice thrice daily to prevent exhaustion. With such benefits soma became a popular drink in the Aryan community as a whole. When the Aryans entered India soma became unavailable. Its need persisting, the ascetic substituted ephedra with a mixture of other drugs. If soma was Rasa, or the juice, the substituted medicament was called Rasayana, signifying "juice-incorporate". Rasayana again was geriatric medicine which promised rejuvenation. Later came contact with the Chinese and their use of mercurials. These proved to be efficient energizers and were accepted as Rasayana. Then Aryan medicine first extolled ephedra, next some herbal drugs, and finally mercurials. As energizers-cum-euphoriants, both ephedra and mercurials are anti-somnolents, a feature absent in intoxicants and nacrotics.

  7. Stress-induced endocrine response and anxiety: the effects of comfort food in rats.

    Science.gov (United States)

    Ortolani, Daniela; Garcia, Márcia Carvalho; Melo-Thomas, Liana; Spadari-Bratfisch, Regina Celia

    2014-05-01

    The long-term effects of comfort food in an anxiogenic model of stress have yet to be analyzed. Here, we evaluated behavioral, endocrine and metabolic parameters in rats submitted or not to chronic unpredictable mild stress (CUMS), with access to commercial chow alone or to commercial chow and comfort food. Stress did not alter the preference for comfort food but decreased food intake. In the elevated plus-maze (EPM) test, stressed rats were less likely to enter/remain in the open arms, as well as being more likely to enter/remain in the closed arms, than were control rats, both conditions being more pronounced in the rats given access to comfort food. In the open field test, stress decreased the time spent in the centre, independent of diet; neither stress nor diet affected the number of crossing, rearing or grooming episodes. The stress-induced increase in serum corticosterone was attenuated in rats given access to comfort food. Serum concentration of triglycerides were unaffected by stress or diet, although access to comfort food increased total cholesterol and glucose. It is concluded that CUMS has an anorexigenic effect. Chronic stress and comfort food ingestion induced an anxiogenic profile although comfort food attenuated the endocrine stress response. The present data indicate that the combination of stress and access to comfort food, common aspects of modern life, may constitute a link among stress, feeding behavior and anxiety.

  8. Fluoxetine regulates mTOR signalling in a region-dependent manner in depression-like mice.

    Science.gov (United States)

    Liu, Xiao-Long; Luo, Liu; Mu, Rong-Hao; Liu, Bin-Bin; Geng, Di; Liu, Qing; Yi, Li-Tao

    2015-11-02

    Previous studies have demonstrated that the mammalian target of rapamycin (mTOR) signaling pathway has an important role in ketamine-induced, rapid antidepressant effects despite the acute administration of fluoxetine not affecting mTOR phosphorylation in the brain. However, the effects of long-term fluoxetine treatment on mTOR modulation have not been assessed to date. In the present study, we examined whether fluoxetine, a type of commonly used antidepressant agent, alters mTOR signaling following chronic administration in different brain regions, including the frontal cortex, hippocampus, amygdala and hypothalamus. We also investigated whether fluoxetine enhanced synaptic protein levels in these regions via the activation of the mTOR signaling pathway and its downstream regulators, p70S6K and 4E-BP-1. The results indicated that chronic fluoxetine treatment attenuated the chronic, unpredictable, mild stress (CUMS)-induced mTOR phosphorylation reduction in the hippocampus and amygdala of mice but not in the frontal cortex or the hypothalamus. Moreover, the CUMS-decreased PSD-95 and synapsin I levels were reversed by fluoxetine, and these effects were blocked by rapamycin only in the hippocampus. In conclusion, our findings suggest that chronic treatment with fluoxetine can induce synaptic protein expression by activating the mTOR signaling pathway in a region-dependent manner and mainly in the hippocampus.

  9. Analytical solution for the anisotropic Rabi model: effects of counter-rotating terms.

    Science.gov (United States)

    Zhang, Guofeng; Zhu, Hanjie

    2015-03-04

    The anisotropic Rabi model, which was proposed recently, differs from the original Rabi model: the rotating and counter-rotating terms are governed by two different coupling constants. This feature allows us to vary the counter-rotating interaction independently and explore the effects of it on some quantum properties. In this paper, we eliminate the counter-rotating terms approximately and obtain the analytical energy spectrums and wavefunctions. These analytical results agree well with the numerical calculations in a wide range of the parameters including the ultrastrong coupling regime. In the weak counter-rotating coupling limit we find out that the counter-rotating terms can be considered as the shifts to the parameters of the Jaynes-Cummings model. This modification shows the validness of the rotating-wave approximation on the assumption of near-resonance and relatively weak coupling. Moreover, the analytical expressions of several physics quantities are also derived, and the results show the break-down of the U(1)-symmetry and the deviation from the Jaynes-Cummings model.

  10. Quantum phases of the Rabi lattice in the dispersive regime

    Science.gov (United States)

    Zhu, Guanyu; Schmidt, Sebastian; Koch, Jens

    2014-03-01

    Photon-based strongly correlated lattice models like the Jaynes-Cummings and Rabi lattices differ from their more conventional relatives like the Bose-Hubbard model by the presence of an additional tunable parameter: the frequency detuning between the pseudo-spin degree of freedom and the harmonic mode frequency on each site. Whenever this detuning is large compared to relevant coupling strengths, the system is said to be in the dispersive regime. The physics of this regime is well-understood at the level of a single Jaynes-Cummings or Rabi site, and can be realized in circuit-QED architecture. Here, we extend the theoretical description of the dispersive regime to lattices with many sites, for both strong and ultra-strong coupling. We discuss the nature and spatial range of the resulting qubit-qubit and photon-photon coupling. In the ultra-strong coupling regime, we demonstrate the emergence of the paramagnetic-to-ferromagnetic phase transition of photon-dressed qubits in the negative detuning regime, and the photon-pairing and vacuum squeezing in the positive detuning regime. We illustrate our results by exact diagonalization of the Rabi dimer.

  11. GSTT2, a phase II gene induced by apple polyphenols, protects colon epithelial cells against genotoxic damage.

    Science.gov (United States)

    Petermann, Astrid; Miene, Claudia; Schulz-Raffelt, Gabriele; Palige, Katja; Hölzer, Jana; Glei, Michael; Böhmer, Frank-D

    2009-10-01

    The potential protective effect of a polyphenol-rich diet for colon carcinogenesis is of great scientific and medical interest. Apples are a main source of polyphenols, and apple juice has been shown to attenuate chemically induced colon carcinogenesis in animal models. In addition to an antioxidant and antiproliferative activity, apple polyphenols have been shown to elevate expression of the phase II gene glutathione S-transferase T2 (GSTT2) in colon epithelial cells. We hypothesized that apple polyphenols may thereby provide protection against oxidant-induced DNA damage. Using GSTT2 promoter constructs and luciferase reporter assays, we found that polyphenolic apple extracts (AE) can directly enhance GSTT2 promoter activity. Comet assays demonstrated that the genotoxicity of the GSTT2 substrate cumene hydroperoxide (CumOOH) was significantly reduced when HT29 colon epithelial cells were pretreated with AE. Overexpression of GSTT2 in HT29 cells significantly reduced CumOOH induced DNA damage, whereas shRNA mediated knockdown of GSTT2 gene expression resulted in higher damage. Our results causally link GSTT2 levels with protection from genotoxic stress, and provide evidence that the antigenotoxic effects of apple polyphenols in vitro are at least in part due to an induction of GSTT2 expression. Induction of phase II genes may contribute to primary chemoprevention of colon cancer by apple polyphenols.

  12. High-precision force sensing using a single trapped ion

    Science.gov (United States)

    Ivanov, Peter A.; Vitanov, Nikolay V.; Singer, Kilian

    2016-06-01

    We introduce quantum sensing schemes for measuring very weak forces with a single trapped ion. They use the spin-motional coupling induced by the laser-ion interaction to transfer the relevant force information to the spin-degree of freedom. Therefore, the force estimation is carried out simply by observing the Ramsey-type oscillations of the ion spin states. Three quantum probes are considered, which are represented by systems obeying the Jaynes-Cummings, quantum Rabi (in 1D) and Jahn-Teller (in 2D) models. By using dynamical decoupling schemes in the Jaynes-Cummings and Jahn-Teller models, our force sensing protocols can be made robust to the spin dephasing caused by the thermal and magnetic field fluctuations. In the quantum-Rabi probe, the residual spin-phonon coupling vanishes, which makes this sensing protocol naturally robust to thermally-induced spin dephasing. We show that the proposed techniques can be used to sense the axial and transverse components of the force with a sensitivity beyond the range, i.e. in the (xennonewton, 10-27). The Jahn-Teller protocol, in particular, can be used to implement a two-channel vector spectrum analyzer for measuring ultra-low voltages.

  13. Investigation on the antidepressant effect of sea buckthorn seed oil through the GC-MS-based metabolomics approach coupled with multivariate analysis.

    Science.gov (United States)

    Tian, Jun-sheng; Liu, Cai-chun; Xiang, Huan; Zheng, Xiao-fen; Peng, Guo-jiang; Zhang, Xiang; Du, Guan-hua; Qin, Xue-mei

    2015-11-01

    Depression is one of the prevalent and serious mental disorders and the number of depressed patients has been on the rise globally during the recent decades. Sea buckthorn seed oil from traditional Chinese medicine (TCM) is edible and has been widely used for treatment of different diseases for a long time. However, there are few published reports on the antidepressant effect of sea buckthorn seed oil. With the objective of finding potential biomarkers of the therapeutic response of sea buckthorn seed oil in chronic unpredictable mild stress (CUMS) rats, urine metabolomics based on gas chromatography-mass spectrometry (GC-MS) coupled with multivariate analysis was applied. In this study, we discovered a higher level of pimelic acid as well as palmitic acid and a lower level of suberic acid, citrate, phthalic acid, cinnamic acid and Sumiki's acid in urine of rats exposed to CUMS procedures after sea buckthorn seed oil was administered. These changes of metabolites are involved in energy metabolism, fatty acid metabolism and other metabolic pathways as well as in the synthesis of neurotransmitters and it is helpful to facilitate the efficacy evaluation and mechanism elucidating the effect of sea buckthorn seed oil for depression management.

  14. Linguistic research in the empirical paradigm as outlined by Mario Bunge.

    Science.gov (United States)

    Zielińska, Dorota

    2016-01-01

    In view of the critique of the methodology of the dominant interdisciplinary research involving language studies as the main component, in particular clinical linguistics, Cummings (Pragmatic disorders. Perspectives in pragmatics, philosophy and psychology, vol 3. Springer, Dordrecht, 2014) proposes that "It is perhaps appropriate at this point to move the debate onto non-empirical grounds." In Cummings (2014: 113) she starts such a debate on the grounds of the philosophy of language and pragmatics. In this article, I propose to expand that debate by including the input of the philosophy of science. I start the discussion by presenting the way one may carry out language research in the paradigm of empirical sciences from the perspective outlined in Bunge (Scientific research. Strategy and philosophy. Berlin, Springer, 1967; Method, model and matter (synthese library). D. Reidel Publishing Company, Dordrecht, 1973; Emergence and convergence: qualitative novelty and the unity of knowledge. University of Toronto Press, Toronto, 2003) and constrained by Altmann's (Towards a theory of language. Glottometrica 1:1-25, 1978) assumption about self-originating and self-regulatory nature of language.

  15. Interplay of uniaxial and cubic anisotropy in epitaxial Fe thin films on MgO (001 substrate

    Directory of Open Access Journals (Sweden)

    Srijani Mallik

    2014-09-01

    Full Text Available Epitaxial Fe thin films were grown on annealed MgO(001 substrates at oblique incidence by DC magnetron sputtering. Due to the oblique growth configuration, uniaxial anisotropy was found to be superimposed on the expected four-fold cubic anisotropy. A detailed study of in-plane magnetic hysteresis for Fe on MgO thin films has been performed by Magneto Optic Kerr Effect (MOKE magnetometer. Both single step and double step loops have been observed depending on the angle between the applied field and easy axis i.e. along ⟨100⟩ direction. Domain images during magnetization reversal were captured by Kerr microscope. Domain images clearly evidence two successive and separate 90° domain wall (DW nucleation and motion along cubic easy cum uniaxial easy axis and cubic easy cum uniaxial hard axis, respectively. However, along cubic hard axis two 180° domain wall motion dominate the magnetization reversal process. In spite of having four-fold anisotropy it is essential to explain magnetization reversal mechanism in 0°< ϕ < 90° span as uniaxial anisotropy plays a major role in this system. Also it is shown that substrate rotation can suppress the effect of uniaxial anisotropy superimposed on four-fold anisotropy.

  16. Antidepressant-like behavioral, anatomical, and biochemical effects of petroleum ether extract from maca (Lepidium meyenii) in mice exposed to chronic unpredictable mild stress.

    Science.gov (United States)

    Ai, Zhong; Cheng, Ai-Fang; Yu, Yuan-Tao; Yu, Long-Jiang; Jin, Wenwen

    2014-05-01

    Maca has been consumed as a medical food in Peru for thousands of years, and exerts anxiolytic and antidepressant effects. Our present study aimed to evaluate the behavior and anatomical and biochemical effects of petroleum ether extract from maca (ME) in the chronic unpredictable mild stress (CUMS) model of depression in mice. Three different doses of maca extract (125, 250, and 500 mg/kg) were orally administrated in the six-week CUMS procedure. Fluoxetine (10 mg/kg) was used as a positive control drug. Maca extract (250 and 500 mg/kg) significantly decreased the duration of immobility time in the tail suspension test. After treatment with maca extract (250 and 500 mg/kg), the granule cell layer in the dentate gyrus appeared thicker. Maca extract (250 and 500 mg/kg) also induced a significant reduction in corticosterone levels in mouse serum. In mouse brain tissue, after six weeks of treatment, noradrenaline and dopamine levels were increased by maca extract, and the activity of reactive oxygen species was significantly inhibited. Serotonin levels were not significantly altered. These results demonstrated that maca extract (250 and 500 mg/kg) showed antidepressant-like effects and was related to the activation of both noradrenergic and dopaminergic systems, as well as attenuation of oxidative stress in mouse brain.

  17. The Antidepressant Effect of Angelica sinensis Extracts on Chronic Unpredictable Mild Stress-Induced Depression Is Mediated via the Upregulation of the BDNF Signaling Pathway in Rats

    Directory of Open Access Journals (Sweden)

    Jun Shen

    2016-01-01

    Full Text Available Angelica sinensis (AS, a traditional Chinese herbal medicine, has pharmaceutical effects on menstrual illness, cerebrovascular diseases, cardiovascular diseases, and cognitive impairments. However, until recently, few studies had explored its antidepressant effect. The current study attempts to investigate the effect of AS extracts on chronic unpredictable mild stress- (CUMS- induced depression in rats. Male SD rats were exposed to a CUMS-inducing procedure for 5 weeks, resulting in rodent depressive behaviors that included reduced sucrose consumption and lessened sucrose preference ratios in sucrose preference test, prolonged immobility times and decreased struggling time in force swim test, and decreased locomotor activity in open field test. Moreover, the expression of brain derived neurotrophic factor (BDNF and the phosphorylation of cAMP-response element binding protein (CREB and extracellular signal-regulated protein kinase (ERK 1/2 were markedly decreased in the hippocampus in depressed rats. However, chronically treating the depressed rats with AS (1 g/kg normalized their depression-related behaviors and molecular profiles. In conclusion, in the present study, we show that AS extracts exerted antidepressant effects that were mediated by the BDNF signaling pathway: in AS-treated depressed rats, the expression of the BDNF protein and the phosphorylation of its downstream targets (ERK 1/2, CREB were upregulated in the hippocampus.

  18. Comparative effectiveness of three adult mosquito sampling methods in habitats representative of four different biomes of California.

    Science.gov (United States)

    Reisen, W K; Boyce, K; Cummings, R C; Delgado, O; Gutierrez, A; Meyer, R P; Scott, T W

    1999-03-01

    The effectiveness of New Jersey (NJ) light, dry ice baited, and gravid female traps for collecting adult mosquitoes was compared at representative habitats in the Coachella, San Joaquin, and Sacramento valleys and the Los Angeles basin of California. The NJ light traps effectively sampled Anopheles freeborni, Culex tarsalis, Psorophora columbiae, and several Aedes when abundance was high in rural areas with minimal competitive illumination. Dry ice-baited encephalitis virus surveillance or CDC style traps collected significantly more females of most species at most localities than did NJ light traps, regardless of background illumination. The Cummings modification of the Reiter gravid female trap baited with a bulrush (Schoenoplectus) infusion was the best method for collecting Culex pipiens complex females in most habitats. In the Los Angeles basin, gravid traps baited with bulrush infusion collected, on average, 4.5 times more Culex quinquefasciatus females than did traps baited with the Reiter infusion. The bulrush infusion in combination with the Cummings trap design seemed to provide resting site cues and collected males as well as empty and bloodfed females. Mosquito surveillance programs in California should include the systematic operation of dry ice-baited and gravid female traps to improve surveillance sensitivity for selected species in appropriate habitats.

  19. Effects of hydrogen-rich water on depressive-like behavior in mice

    Science.gov (United States)

    Zhang, Yi; Su, Wen-Jun; Chen, Ying; Wu, Teng-Yun; Gong, Hong; Shen, Xiao-Liang; Wang, Yun-Xia; Sun, Xue-Jun; Jiang, Chun-Lei

    2016-01-01

    Emerging evidence suggests that neuroinflammation and oxidative stress may be major contributors to major depressive disorder (MDD). Patients or animal models of depression show significant increase of proinflammatory cytokine interleukin-1β (IL-1β) and oxidative stress biomarkers in the periphery or central nervous system (CNS). Recent studies show that hydrogen selectively reduces cytotoxic oxygen radicals, and hydrogen-rich saline potentially suppresses the production of several proinflammatory mediators. Since current depression medications are accompanied by a wide spectrum of side effects, novel preventative or therapeutic measures with fewer side effects might have a promising future. We investigated the effects of drinking hydrogen-rich water on the depressive-like behavior in mice and its underlying mechanisms. Our study show that hydrogen-rich water treatment prevents chronic unpredictable mild stress (CUMS) induced depressive-like behavior. CUMS induced elevation in IL-1β protein levels in the hippocampus, and the cortex was significantly attenuated after 4 weeks of feeding the mice hydrogen-rich water. Over-expression of caspase-1 (the IL-1β converting enzyme) and excessive reactive oxygen species (ROS) production in the hippocampus and prefrontal cortex (PFC) was successfully suppressed by hydrogen-rich water treatment. Our data suggest that the beneficial effects of hydrogen-rich water on depressive-like behavior may be mediated by suppression of the inflammasome activation resulting in attenuated protein IL-1β and ROS production. PMID:27026206

  20. Metabolomics approach for multibiomarkers determination to investigate dengue virus infection in human patients.

    Science.gov (United States)

    Shahfiza, Nurul; Osman, Hasnah; Hock, Tang Thean; Abdel-Hamid, Abdel-Hamid Zaki

    2017-01-01

    Dengue is one of the major public health problems in the world, affecting more than fifty million cases in tropical and subtropical region every year. The metabolome, as pathophysiological end-points, provide significant understanding of the mechanism and progression of dengue pathogenesis via changes in the metabolite profile of infected patients. Recent developments in diagnostic technologies provide metabolomics for the early detection of infectious diseases. The mid-stream urine was collected from 96 patients diagnosed with dengue fever at Penang General Hospital (PGH) and 50 healthy volunteers. Urine samples were analyzed with proton nuclear magnetic resonance ((1)H NMR) spectroscopy, followed by chemometric multivariate analysis. NMR signals highlighted in the orthogonal partial least square-discriminant analysis (OPLS-DA) S-plots were selected and identified using Human Metabolome Database (HMDB) and Chenomx Profiler. A highly predictive model was constructed from urine profile of dengue infected patients versus healthy individuals with the total R(2)Y (cum) value 0.935, and the total Q(2)Y (cum) value 0.832. Data showed that dengue infection is related to amino acid metabolism, tricarboxylic acid intermediates cycle and β-oxidation of fatty acids. Distinct variations in certain metabolites were recorded in infected patients including amino acids, various organic acids, betaine, valerylglycine, myo-inositol and glycine. Metabolomics approach provides essential insight into host metabolic disturbances following dengue infection.

  1. 3,5,6,7,8,3′,4′-Heptamethoxyflavone Ameliorates Depressive-Like Behavior and Hippocampal Neurochemical Changes in Chronic Unpredictable Mild Stressed Mice by Regulating the Brain-Derived Neurotrophic Factor: Requirement for ERK Activation

    Science.gov (United States)

    Sawamoto, Atsushi; Okuyama, Satoshi; Amakura, Yoshiaki; Yoshimura, Morio; Yamada, Takashi; Yokogoshi, Hidehiko; Nakajima, Mitsunari

    2017-01-01

    We previously reported that the subcutaneous administration of 3,5,6,7,8,3′,4′-heptamethoxyflavone (HMF), a citrus polymethoxyflavone, attenuated depressive-like behavior and increased the expression of brain-derived neurotrophic factor (BDNF) in the hippocampus of a corticosterone-induced depression-like mouse model. We herein demonstrated that (1) HMF was detectable in the brain 10 and 30 min after its oral administration, (2) orally administered HMF improved chronic unpredictable mild stress (CUMS)-induced pathological conditions, including body weight loss and depressive-like behavior, and CUMS-induced neurochemical changes, such as reduction in BDNF expression, decrease in neurogenesis, and decreased level of phosphorylated calcium-calmodulin-dependent protein kinase II in the hippocampus, and (3) these effects of HMF were inhibited by the pre-administration of U0126, a mitogen-activated protein (MAP) kinase inhibitor. These results suggest that orally administered HMF is beneficial for the upregulation of BDNF in the hippocampus via the extracellular signal-regulated kinase1/2 (ERK1/2)/MAP system, which may account for its antidepression effects. PMID:29023414

  2. 3,5,6,7,8,3′,4′-Heptamethoxyflavone Ameliorates Depressive-Like Behavior and Hippocampal Neurochemical Changes in Chronic Unpredictable Mild Stressed Mice by Regulating the Brain-Derived Neurotrophic Factor: Requirement for ERK Activation

    Directory of Open Access Journals (Sweden)

    Atsushi Sawamoto

    2017-10-01

    Full Text Available We previously reported that the subcutaneous administration of 3,5,6,7,8,3′,4′-heptamethoxyflavone (HMF, a citrus polymethoxyflavone, attenuated depressive-like behavior and increased the expression of brain-derived neurotrophic factor (BDNF in the hippocampus of a corticosterone-induced depression-like mouse model. We herein demonstrated that (1 HMF was detectable in the brain 10 and 30 min after its oral administration, (2 orally administered HMF improved chronic unpredictable mild stress (CUMS-induced pathological conditions, including body weight loss and depressive-like behavior, and CUMS-induced neurochemical changes, such as reduction in BDNF expression, decrease in neurogenesis, and decreased level of phosphorylated calcium-calmodulin-dependent protein kinase II in the hippocampus, and (3 these effects of HMF were inhibited by the pre-administration of U0126, a mitogen-activated protein (MAP kinase inhibitor. These results suggest that orally administered HMF is beneficial for the upregulation of BDNF in the hippocampus via the extracellular signal-regulated kinase1/2 (ERK1/2/MAP system, which may account for its antidepression effects.

  3. Activitatea parlamentară în memoriile ,,labirintul destinului” de Mircea Snegur

    Directory of Open Access Journals (Sweden)

    Iurie ȚAP

    2017-03-01

    Full Text Available ,,Labirintul destinului” este o carte foarte importantă. Preşedintele Mircea Snegur este persoana care, în virtutea circumstanțelor, s-a aflat la baza constituirii statului modern – Republica Moldova. Or, în calitatea sa de Preşedinte al Sovietului Suprem, ulterior Preşedinte al Parlamentului şi al țării, a fost cel care cu mâna lui a redactat aceste volume, făcând trimitere, după cum spune autorul, la multe documente, precum ar fi Declarația de Suveranitate a Republicii Moldova, Decretul cu privire la putere, Decretul privind Independența Republicii Moldova, respectiv, Constituția din 1994. Primele trei documente s-au aflat la baza Constituției, aşa cum spune Mircea Snegur în primul volum. Şi, de fapt, aceasta este istoria modernă a țării noastre. Putem vedea un punct de vedere al unui om, al unei personalități, care a văzut din interior, a făcut şi ştie ce spune.

  4. Modelos determinísticos de inventarios para demanda independiente. Un estudio en Venezuela

    Directory of Open Access Journals (Sweden)

    Carlos Enrique Bustos Flores

    2012-01-01

    Full Text Available El objetivo de este trabajo es analizar los siguientes modelos determinísticos de inventarios para demanda independiente: un solo lote, lote por lote, cantidad económica de pedido (EOQ, algoritmo Silver-Meal (SM, costo unitario mínimo (CUM, balanceo de periodo fragmentado (BPF y algoritmo de Wagner-Whitin (WW. Estos modelos surgen del supuesto clave de que la demanda conocida con cierto grado de certidumbre de un artículo que se lleva en inventario es independiente de la demanda de cualquier otro artículo que también se lleve en dicho inventario. Con la intención de lograr el objetivo planteado, los modelos mencionados son aplicados para el cálculo de los tamaños de lotes óptimos de resmas de papel carta y oficio de acuerdo con los registros de demanda real e independiente suministrados por el departamento de Publicaciones de la Facultad de Ciencias Económicas y Sociales (FACES en la Universidad de Los Andes (ULA, en Mérida, Venezuela. La principal conclusión que se deriva de los resultados obtenidos es que el método de un solo lote, utilizado por la administración de la FACES, comparado con los modelos de lote por lote, EOQ, SM, CUM, BPF y WW, es el más costoso y, en consecuencia, el menos indicado.

  5. Early-life stress leads to impaired spatial learning and memory in middle-aged ApoE4-TR mice.

    Science.gov (United States)

    Lin, Lan-Yan; Zhang, Jing; Dai, Xiao-Man; Xiao, Nai-An; Wu, Xi-Lin; Wei, Zhen; Fang, Wen-Ting; Zhu, Yuan-Gui; Chen, Xiao-Chun

    2016-07-12

    Apolipoprotein E (ApoE) is a major lipid carrier that supports lipid transport and injury repair in the brain. The APOE ε4 allele is associated with depression, mild cognitive impairment (MCI) and dementia; however, the precise molecular mechanism through which ApoE4 influences the risk of disease development remains unknown. To address this gap in knowledge, we investigated the potential effects of chronic unpredictable mild stress (CUMS) on ApoE3 and ApoE4 target replacement (ApoE3-TR and ApoE4-TR) mice. All ApoE-TR mice exposed to CUMS at 3 months old recovered from a depression-like state by the age of 12 months. Of note, ApoE4-TR mice, unlike age-matched ApoE3-TR mice, displayed impaired spatial cognitive abilities, loss of GABAergic neurons, decreased expression of Reelin, PSD95, SYN and Fyn, and reduced phosphorylation of NMDAR2B and CREB. These results suggest that early-life stress may mediate cognitive impairment in middle-age ApoE4-TR mice through sustained reduction of GABAergic neurons and Reelin expression, which might further diminish the activation of the Fyn/NMDAR2B signaling pathway.

  6. Threshold for onset of injury in Chinook salmon from exposure to impulsive pile driving sounds.

    Directory of Open Access Journals (Sweden)

    Michele B Halvorsen

    Full Text Available The risk of effects to fishes and other aquatic life from impulsive sound produced by activities such as pile driving and seismic exploration is increasing throughout the world, particularly with the increased exploitation of oceans for energy production. At the same time, there are few data that provide insight into the effects of these sounds on fishes. The goal of this study was to provide quantitative data to define the levels of impulsive sound that could result in the onset of barotrauma to fish. A High Intensity Controlled Impedance Fluid filled wave Tube was developed that enabled laboratory simulation of high-energy impulsive sound that were characteristic of aquatic far-field, plane-wave acoustic conditions. The sounds used were based upon the impulsive sounds generated by an impact hammer striking a steel shell pile. Neutrally buoyant juvenile Chinook salmon (Oncorhynchus tshawytscha were exposed to impulsive sounds and subsequently evaluated for barotrauma injuries. Observed injuries ranged from mild hematomas at the lowest sound exposure levels to organ hemorrhage at the highest sound exposure levels. Frequency of observed injuries were used to compute a biological response weighted index (RWI to evaluate the physiological impact of injuries at the different exposure levels. As single strike and cumulative sound exposure levels (SEL(ss, SEL(cum respectively increased, RWI values increased. Based on the results, tissue damage associated with adverse physiological costs occurred when the RWI was greater than 2. In terms of sound exposure levels a RWI of 2 was achieved for 1920 strikes by 177 dB re 1 µPa(2⋅s SEL(ss yielding a SEL(cum of 210 dB re 1 µPa(2⋅s, and for 960 strikes by 180 dB re 1 µPa(2⋅s SEL(ss yielding a SEL(cum of 210 dB re 1 µPa(2⋅s. These metrics define thresholds for onset of injury in juvenile Chinook salmon.

  7. Effect of metal ions on the reactions of the cumyloxyl radical with hydrogen atom donors. Fine control on hydrogen abstraction reactivity determined by Lewis acid-base interactions.

    Science.gov (United States)

    Salamone, Michela; Mangiacapra, Livia; DiLabio, Gino A; Bietti, Massimo

    2013-01-09

    A time-resolved kinetic study on the effect of metal ions (M(n+)) on hydrogen abstraction reactions from C-H donor substrates by the cumyloxyl radical (CumO(•)) was carried out in acetonitrile. Metal salt addition was observed to increase the CumO(•) β-scission rate constant in the order Li(+) > Mg(2+) > Na(+). These effects were explained in terms of the stabilization of the β-scission transition state determined by Lewis acid-base interactions between M(n+) and the radical. When hydrogen abstraction from 1,4-cyclohexadiene was studied in the presence of LiClO(4) and Mg(ClO(4))(2), a slight increase in rate constant (k(H)) was observed indicating that interaction between M(n+) and CumO(•) can also influence, although to a limited extent, the hydrogen abstraction reactivity of alkoxyl radicals. With Lewis basic C-H donors such as THF and tertiary amines, a decrease in k(H) with increasing Lewis acidity of M(n+) was observed (k(H)(MeCN) > k(H)(Li(+)) > k(H)(Mg(2+))). This behavior was explained in terms of the stronger Lewis acid-base interaction of M(n+) with the substrate as compared to the radical. This interaction reduces the degree of overlap between the α-C-H σ* orbital and a heteroatom lone-pair, increasing the C-H BDE and destabilizing the carbon centered radical formed after abstraction. With tertiary amines, a >2-order of magnitude decrease in k(H) was measured after Mg(ClO(4))(2) addition up to a 1.5:1 amine/Mg(ClO(4))(2) ratio. At higher amine concentrations, very similar k(H) values were measured with and without Mg(ClO(4))(2). These results clearly show that with strong Lewis basic substrates variations in the nature and concentration of M(n+) can dramatically influence k(H), allowing for a fine control of the substrate hydrogen atom donor ability, thus providing a convenient method for C-H deactivation. The implications and generality of these findings are discussed.

  8. Efficacy of a workplace relaxation exercise program on muscle tenderness in a working community with headache and neck pain: a longitudinal, controlled study.

    Science.gov (United States)

    Rota, Eugenia; Evangelista, Andrea; Ceccarelli, Manuela; Ferrero, Luca; Milani, Chantal; Ugolini, Alessandro; Mongini, Franco

    2016-08-01

    Pericranial muscle tenderness shows a remarkable prevalence not only in tension-type headache, but also in migraine, both episodic and chronic. Neck pain is a common disorder and leads to a high rate of work disability; its prevalence increases for headache. This study aimed at examining the effects of a relaxation exercise programme on pericranial/cervical muscle tenderness in a working community with headache and neck pain. This was a controlled, non-randomized trial. The study was carried out in a working community, on the employees of the City of Turin's central and peripheral registry and tax offices. A total of 384 workers were enrolled and divided into two groups: a study group (group 1; 192 subjects) and a control group (group 2; 192 subjects). A programme, with relaxation/posture exercises and a visual feedback, was carried out for Group 1 for 6 months and, afterwards, also for group 2 for the same follow-up period throughout. Data on head/neck pain were collected. Standard palpation of pericranial and cervical muscles was done, scoring each patient for Pericranial Muscle Tenderness (PTS) (0-3), Cervical Muscle Tenderness (CTS) (0-3) and a Cumulative Muscle Tenderness (CUM) (0-6). After 6 months from baseline, a significant difference was observed between the groups: i.e. group 1 had an average change from baseline of -0.19 for PTS, -0.2 for CTS and -0.36 for the CUM score - in association with a reduction in headache, neck and shoulder pain. The difference between the groups in PTS, CTS and CUM scores was no longer detectable at the end of the study, after also group 2 performed the programme. The administration of a workplace relaxation exercise intervention significantly decreased pericranial/cervical muscle tenderness in the working community, in association with head-neck pain benefit. This relaxation exercise programme was remarkably cost-effective, yielding a relevant benefit on pericranial/cervical muscle tenderness in a working community, at a

  9. Lack of behavioural responses of humpback whales (Megaptera novaeangliae) indicate limited effectiveness of sonar mitigation.

    Science.gov (United States)

    Wensveen, Paul J; Kvadsheim, Petter H; Lam, Frans-Peter A; von Benda-Beckmann, Alexander M; Sivle, Lise D; Visser, Fleur; Curé, Charlotte; Tyack, Peter L; Miller, Patrick J O

    2017-11-15

    Exposure to underwater sound can cause permanent hearing loss and other physiological effects in marine animals. To reduce this risk, naval sonars are sometimes gradually increased in intensity at the start of transmission ('ramp-up'). Here, we conducted experiments in which tagged humpback whales were approached with a ship to test whether a sonar operation preceded by ramp-up reduced three risk indicators - maximum sound pressure level (SPL max ), cumulative sound exposure level (SEL cum ) and minimum source-whale range ( R min ) - compared with a sonar operation not preceded by ramp-up. Whales were subject to one no-sonar control session and either two successive ramp-up sessions (RampUp1, RampUp2) or a ramp-up session (RampUp1) and a full-power session (FullPower). Full-power sessions were conducted only twice; for other whales we used acoustic modelling that assumed transmission of the full-power sequence during their no-sonar control. Averaged over all whales, risk indicators in RampUp1 ( n =11) differed significantly from those in FullPower ( n =12) by -3.0 dB (SPL max ), -2.0 dB (SEL cum ) and +168 m ( R min ), but not significantly from those in RampUp2 ( n =9). Only five whales in RampUp1, four whales in RampUp2 and none in FullPower or control sessions avoided the sound source. For RampUp1, we found statistically significant differences in risk indicators between whales that avoided the sonar and whales that did not: -4.7 dB (SPL max ), -3.4 dB (SEL cum ) and +291 m ( R min ). In contrast, for RampUp2, these differences were smaller and not significant. This study suggests that sonar ramp-up has a positive but limited mitigative effect for humpback whales overall, but that ramp-up can reduce the risk of harm more effectively in situations when animals are more responsive and likely to avoid the sonar, e.g. owing to novelty of the stimulus, when they are in the path of an approaching sonar ship. © 2017. Published by The Company of Biologists

  10. Üks doktor ja kaks magistrit / Halliki Uibu

    Index Scriptorium Estoniae

    Uibu, Halliki

    2001-01-01

    18. juunil 2001 toimus TPÜ kultuuriajaloo kaitsmisnõukogus Lauri Lindströmi doktoritöö "Album Academicum Universitatis Tartuensis 1918-1944. Rahvus, sugu, sünni- ja keskhariduse omandamise koht üliõpilaskonna kujunemist ja kõrghariduse omandamist mõjutavate teguritena" kaitsmine. Lauri Lindströmile omistati teaduskraad doctor philosophiae (PhD) kultuuriajaloo alal. TPÜ kultuuriajaloo magistrikraadi kaitsmisnõukogus kaitsesid 18. juunil 2001 Igor Tõnurist magistritööd "Pillid ja pillimäng eesti külaelus" ja Tatjana Tšervova magistritööd "Vene kogukonna ühiskondlikust ja kultuurielust Tallinnas 1880-1905". Igor Tõnuristile ja Tatjana Tšervovale omistati teaduskraad magister artium kultuuriajaloo alal hindega cum laude

  11. Integrated 18F-fluorodeoxyglucose positron emission tomography magnetic resonance imaging (18F-FDG PET/MRI), a multimodality approach for comprehensive evaluation of dementia patients: A pictorial essay

    Science.gov (United States)

    Jena, Amarnath; Renjen, Pushpendra Nath; Taneja, Sangeeta; Gambhir, Aashish; Negi, Pradeep

    2015-01-01

    Dementia, caused by irreversible neurodegenerative disorders such as Alzheimer's disease or reversible non-degenerative conditions, is rapidly becoming one of the most alarming health problems in our aging society. This cognitive disorder associated with a multitude of clinical differentials with overlapping clinical, pathological, and imaging features is difficult to diagnose and treat, as it often presents late after significant neuronal damage has already occurred. Novel disease-modifying treatments being developed will have to be corroborated with innovative imaging biomarkers so that earlier reliable diagnosis can be made and treatment initiated upon. Along with new specific PET radiotracers, integrated PET/MRI with combined methodological advantage and simultaneously acquired structural-cum-functional information may help achieve this goal. The present pictorial essay details our experiences with PET/MRI in dementing disorders, along with reviewing recent advances and future scope. PMID:26752814

  12. The degree of community engagement: empirical research in Baltimore City

    Directory of Open Access Journals (Sweden)

    Soyoung PARK

    2014-12-01

    Full Text Available The purpose of this study is to investigate influential factors that affect the levels of community engagement. Factors include community-level characteristics as well as demographic features of individuals in the community of Baltimore City. The study examines various community factors that affect the level of community engagement in the urban area, such as the level of homeownership, socioeconomic factors such as income and education, and demographic factors such as race, age, and sex. Findings from the study indicate that various factors from the social-cum-ethnic stratification influence the degree of community engagement in this urban area. Specifically, communities with high income levels and high levels of homeownership are more likely to induce residents to participate in their community. With regard to demographic factors, African-Americans and persons over the age of 65 years old are more willing to engage in community activities.

  13. Preparative isolation of oligomeric procyanidins from Hawthorn (Crataegus spp.).

    Science.gov (United States)

    Zumdick, S; Petereit, F; Luftmann, H; Hensel, A

    2009-04-01

    The oligomeric procyanidins (OPC) from Hawthorn leaves and flowers (Crataegi folium cum flore) are considered to be in part responsible for the cardiotonic clinical activity of the herbal material. Effective methods for rapid isolation of these heterogenous oligomeric clusters with defined molecular weight as reference compounds are not published until now. Therefore the water soluble fraction of an acetone/water (7 + 3) extract of Hawthorn leaves and flowers was fractionated by a combination of MPLC on RP-18 material and preparative HPLC using a diol stationary phase. This procedure resulted in the effective isolation of procyanidins with a distinct degree of polymerization (DP) from dimers DP2 up to tridecamers DP13. Exact mass measurements with negative ESI-TOF/MS were employed to confirm the respective structures of the isolated procyanidins.

  14. Applications of metal-organic frameworks in heterogeneous supramolecular catalysis.

    Science.gov (United States)

    Liu, Jiewei; Chen, Lianfen; Cui, Hao; Zhang, Jianyong; Zhang, Li; Su, Cheng-Yong

    2014-08-21

    This review summarizes the use of metal-organic frameworks (MOFs) as a versatile supramolecular platform to develop heterogeneous catalysts for a variety of organic reactions, especially for liquid-phase reactions. Following a background introduction about catalytic relevance to various metal-organic materials, crystal engineering of MOFs, characterization and evaluation methods of MOF catalysis, we categorize catalytic MOFs based on the types of active sites, including coordinatively unsaturated metal sites (CUMs), metalloligands, functional organic sites (FOS), as well as metal nanoparticles (MNPs) embedded in the cavities. Throughout the review, we emphasize the incidental or deliberate formation of active sites, the stability, heterogeneity and shape/size selectivity for MOF catalysis. Finally, we briefly introduce their relevance into photo- and biomimetic catalysis, and compare MOFs with other typical porous solids such as zeolites and mesoporous silica with regard to their different attributes, and provide our view on future trends and developments in MOF-based catalysis.

  15. Performance analysis of aodv, dsdv and aomdv using wimax in NS - 2

    Directory of Open Access Journals (Sweden)

    Madhusrhee B

    2016-06-01

    Full Text Available WiMAX (IEEE 802.16 technology empowers ubiquitous delivery of wireless broadband facility for fixed and mobile users. WiMAX standard describes numerous physical and MAC layer characteristics. Here, an attempt is made to implement some of these physical and MAC layer structures including the mobility extension 802.16e. NS2 (Network Simulator - 2 is chosen as the simulator to implement these features as NS2 provides suitable library to simulate network scenario. The performance of the simulated module is analyzed by running AODV, DSDV and AOMDV routing protocols on a wired - cum - wireless WiMAX scenario. The throughput for each routing protocol is calculated for varying number of mobile nodes or subs criber stations.

  16. Influence of burning of fireworks on particle size distribution of PM10 and associated barium at Nagpur.

    Science.gov (United States)

    Khaparde, Vaishali V; Pipalatkar, Pradeep P; Pustode, Tushar; Rao, C V Chalapati; Gajghate, Daulat G

    2012-01-01

    Influence of burning of fireworks on particle size distribution of PM(10) and associated barium (Ba) were studied at a congested residential cum commercial area of Nagpur city, India. Sampling was carried out by cascade impactor having 50% cut-off aerodynamic diameters of fireworks activity was lower near the site. Trimodal distribution of Ba was observed on the first 2 days of diwali at 0.4-2.1, 2.1-4.7, and 4.7 to less than PM(10) micrometer range. While on the third day, it appeared bimodal with 70% contribution in coarse fraction whereas on the fourth day, distribution appeared unimodal with 66% contribution in alveolar region (fireworks used on different days and distance between the burning of firecrackers from the monitoring site.

  17. UNIVERSUL EMOŢIONAL ÎN DISCURSUL MEDIATIC. PERSUASIUNEA

    OpenAIRE

    Alina LOPATIUC

    2015-01-01

    În ultimul timp, discursul a devenit un concept-cheie al lingvisticii. Analiza discursului are tangenţe cu alte discipline, cum ar fi sociologia, teoria comunicării sau psihologia. Discursul mediatic este în interacţiune directă cu viaţa socială. Acest tip de discurs ne prezintă diverse teme de articole, publicitate şi dezbateri care implică şi diversitatea universului emoţional.Universul emoţional include totalitatea emoţiilor, atitudinilor şi stărilor emoţionale, dar şi persuasiunea şi mani...

  18. John Calvin and postmodern spirituality

    Directory of Open Access Journals (Sweden)

    P.H. Fick

    2010-07-01

    Full Text Available Postmodernists reject universal truth claims and brand them as violent impositions on a person by powerful institutions. Postmodernist spirituality seeks for a more subjective, life- experience based attitude towards values and truths of the Bible and relationship in community. Careful consideration should be given to the issues of community, knowledge/truth, faith, and faith experience. This article will show that, in his “Institutes”, Calvin gives ample attention to faith, the liberating truth about God as revealed in Jesus Christ, and to the Chris- tian’s intimate relationship with Him. Being in Christ, commu- nion with Christ or the “unio mystica cum Christo” through faith as a central theme in Calvin’s theology, needs to be redis- covered and re-applied to reformed spirituality as apologetic means in a postmodern world. This treasure should satisfy the kind of spirituality postmodernists yearn for.

  19. Can implementing a quiet room reduce the use of mechanical restraints?

    DEFF Research Database (Denmark)

    Lauge Berring, Lene; Bonde, SM; Johansen, L

    BackgroundIn order to reduce the use of mechanical restraints, this project aimed to implement a Quiet Room in a Psychiatric Intensive Care Unit (PICU). Previous studies has demonstrated that quiet rooms, such ascomfort rooms (Cf. Cummings, Grandfield and Coldwell, 2010) and sensory rooms......(Cf. Bjôrkdahl 2015), contributed to higher patient satisfaction and lower rates of violence, seclusion and restraints. This poster describes the preliminary results and the implementations process.AimThe study aim was to 1) reduce the use of coercive measures such as mechanical restraints, 2) redirect...... used the room between 1 and 5 times. Staff and patients report that coercive measures were avoided, however, we were not able to identify any changes within the registered use of mechanical restraints. Generally, patients experienced great benefits and reported that they appreciated the opportunity...

  20. AcEST: DK960303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in-4 OS=Zea mays GN=PRO4 PE=1 SV=1 138 2e-32 sp|Q64LH2|PROF2_AMBAR Profilin-2 OS=Ambrosia artemisiifolia GN=...A... 137 2e-32 sp|Q8H2C9|PROF1_ARTVU Profilin-1 OS=Artemisia vulgaris PE=1 SV=3 137 2e-32 sp|Q64LH1|PROF1_AMBAR Profilin-1 OS=Ambrosi...cum PE=1 SV=1 135 8e-32 sp|Q64LH0|PROF3_AMBAR Profilin-3 OS=Ambrosia artemisiifol...T ++L+IG+YDEP+TP +CN +VE+ Sbjct: 80 GVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVER 121 >sp|Q64LH2|PROF2_AMBAR Profilin-2 OS=Ambrosia