Nucleation of filaments of the TGBA phase in free-standing films

Czech Academy of Sciences Publication Activity Database

Lejček, Lubor; Novotná, Vladimíra; Glogarová, Milada

2018-01-01

Roč. 45, č. 2 (2018), s. 173-179 ISSN 0267-8292 R&D Projects: GA ČR GA15-02843S Institutional support: RVO:68378271 Keywords : twist grain boundary * A phase * coherent twin boundary * incoherent twin boundary * dislocation loops Subject RIV: BJ - Thermodynamics OBOR OECD: Thermodynamics Impact factor: 2.661, year: 2016

The effect of lactate unit number in compounds with azo group in the molecular core

Czech Academy of Sciences Publication Activity Database

Novotná, Vladimíra; Hamplová, Věra; Kašpar, Miroslav; Podoliak, Natalia; Bubnov, Alexej; Glogarová, Milada; Nonnenmacher, D.; Giesselmann, F.

2011-01-01

Roč. 38, č. 5 (2011), s. 649-655 ISSN 0267-8292 R&D Projects: GA AV ČR IAA100100911; GA AV ČR(CZ) GA202/09/0047; GA ČR(CZ) GAP204/11/0723 Grant - others:RFASI(RU) 02.740.11.5166; Společný projekt AV ČR-DAAD SNR(CZ) D4-CZ5/2010-2011; GA UK(CZ) SVV-2011-263303 Institutional research plan: CEZ:AV0Z10100520 Keywords : liquid crystals * ferroelectricity * chirality * azo group * antiferroelectricity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.858, year: 2011 http://dx.doi.org/10.1080/02678292.2011.565426

Non-symmetrical bent-shaped compounds containing chiral moiety

Czech Academy of Sciences Publication Activity Database

Novotná, Vladimíra; Mieczkowska, B.; Hamplová, Věra; Domján, A.; Pociecha, D.; Kašpar, Miroslav; Fodor-Csorba, K.

2012-01-01

Roč. 39, č. 10 (2012), s. 1252-1260 ISSN 0267-8292 R&D Projects: GA ČR(CZ) GAP204/11/0723 Institutional research plan: CEZ:AV0Z10100520 Keywords : bent-shaped mesogen * columnar phase * ferroelectricity * polar switching Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.959, year: 2012 http://www.tandfonline.com/doi/abs/10.1080/02678292.2012.714485

Crystal structure determination of CoGeTe from powder diffraction data

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Navrátil, Jiří; Plášil, J.; Plecháček, T.

2008-01-01

Roč. 460, č. 1-2 (2008), s. 155-159 ISSN 0925-8388 R&D Projects: GA ČR GA203/07/0267 Institutional research plan: CEZ:AV0Z40500505 Keywords : crystal structure Subject RIV: CA - Inorganic Chemistry Impact factor: 1.510, year: 2008

Exon: CBRC-RNOR-04-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0267 atggctgtagactcagctgcctctgcctgccaagggctagaattaaagctgtgcactactaccaccaccatcaccaccacca...tcacccaccaccaccaccaccaccaccaccaccaccaccaccaccaccaccaccaccaccaccatcatcatccaccatcaccaccaccaccatcatcaccatcaccaccacca...tcatcatccaccaccaccatcatcatccaccaccaccatcaccaccaccaccatcatcatccaccaccaccatcatcatccaccaccaccgtcaccCAGAAGAAATG ...

Synthesis crystal stuctrure and thermoelectric properties of the ternary skutterudite Fe2Pd2Sb12

Czech Academy of Sciences Publication Activity Database

Navrátil, Jiří; Laufek, F.; Plecháček, T.; Plášil, J.

2010-01-01

Roč. 493, 1-2 (2010), s. 50-54 ISSN 0925-8388 R&D Projects: GA ČR GA203/07/0267 Institutional research plan: CEZ:AV0Z40500505 Keywords : Fe2Pd2Sb12 * crystal structure * skutterudite Subject RIV: CA - Inorganic Chemistry Impact factor: 2.138, year: 2010

NCBI nr-aa BLAST: CBRC-XTRO-01-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0267 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 8e-16 18% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0267 ref|YP_001033817.1| Ice nucleation protein [Rhodobacter sphaeroid...es 2.4.1] gb|ABA81712.1| Ice nucleation protein [Rhodobacter sphaeroides 2.4.1] YP_001033817.1 6e-27 25% ...

The small molecule inhibitor QLT0267 Radiosensitizes squamous cell carcinoma cells of the head and neck.

Directory of Open Access Journals (Sweden)

Iris Eke

Full Text Available BACKGROUND: The constant increase of cancer cell resistance to radio- and chemotherapy hampers improvement of patient survival and requires novel targeting approaches. Integrin-Linked Kinase (ILK has been postulated as potent druggable cancer target. On the basis of our previous findings clearly showing that ILK transduces antisurvival signals in cells exposed to ionizing radiation, this study evaluated the impact of the small molecule inhibitor QLT0267, reported as putative ILK inhibitor, on the cellular radiation survival response of human head and neck squamous cell carcinoma cells (hHNSCC. METHODOLOGY/PRINCIPAL FINDINGS: Parental FaDu cells and FaDu cells stably transfected with a constitutively active ILK mutant (FaDu-IH or empty vectors, UTSCC45 cells, ILK(floxed/floxed(fl/fl and ILK(-/- mouse fibroblasts were used. Cells grew either two-dimensionally (2D on or three-dimensionally (3D in laminin-rich extracellular matrix. Cells were treated with QLT0267 alone or in combination with irradiation (X-rays, 0-6 Gy single dose. ILK knockdown was achieved by small interfering RNA transfection. ILK kinase activity, clonogenic survival, number of residual DNA double strand breaks (rDSB; gammaH2AX/53BP1 foci assay, cell cycle distribution, protein expression and phosphorylation (e.g. Akt, p44/42 mitogen-activated protein kinase (MAPK were measured. Data on ILK kinase activity and phosphorylation of Akt and p44/42 MAPK revealed a broad inhibitory spectrum of QLT0267 without specificity for ILK. QLT0267 significantly reduced basal cell survival and enhanced the radiosensitivity of FaDu and UTSCC45 cells in a time- and concentration-dependent manner. QLT0267 exerted differential, cell culture model-dependent effects with regard to radiogenic rDSB and accumulation of cells in the G2 cell cycle phase. Relative to corresponding controls, FaDu-IH and ILK(fl/fl fibroblasts showed enhanced radiosensitivity, which failed to be antagonized by QLT0267. A

NCBI nr-aa BLAST: CBRC-OPRI-01-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0267 ref|NP_056891.1| RT-IN [Mason-Pfizer monkey virus] ref|NP_954565....2| RT-IN [Mason-Pfizer monkey virus] gb|AAC82576.1| RT-IN [Mason-Pfizer monkey virus] NP_056891.1 1e-148 50% ...

Immiscible melt droplets in garnet, as represented by ilmenite-magnetite-spinel spheroids in an eclogite-garnet peridotite association, Blanský les Granulite Massif, Czech Republic

Czech Academy of Sciences Publication Activity Database

Vrána, S.; Ackerman, Lukáš; Erban, V.; Halodová, P.

2016-01-01

Roč. 101, č. 1 (2016), s. 82-92 ISSN 0003-004X Institutional support: RVO:67985831 Keywords : eclogite * Fe-Ti-rich melt * garnet peridotite * garnetite * Ilmenite-magnetite-spinel * Invited Centennial article * Moldanubian Zone * UHP crystallization Subject RIV: DD - Geochemistry Impact factor: 2.021, year: 2016

Butterfly extinctions in European states: do socioeconomic conditions matter more than physical geography?

Czech Academy of Sciences Publication Activity Database

Konvička, Martin; Fric, Zdeněk; Beneš, Jiří

2006-01-01

Roč. 15, č. 1 (2006), s. 82-92 ISSN 1466-822X R&D Projects: GA AV ČR KJB6007306 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterflies * distibution * Europe Subject RIV: EH - Ecology, Behaviour Impact factor: 3.314, year: 2006

Alphabetical order effects in school admissions

Czech Academy of Sciences Publication Activity Database

Jurajda, Štěpán; Münich, Daniel

2016-01-01

Roč. 31, č. 4 (2016), s. 483-498 ISSN 0267-1522 Institutional support: PRVOUK-P23 Keywords : admissions * alphabetical order * order effects Subject RIV: AH - Economics Impact factor: 1.033, year: 2016

Northern European summer temperature variations over the Common Era from integrated tree-ring density records

Czech Academy of Sciences Publication Activity Database

Esper, J.; Düthorn, E.; Krusic, P. J.; Timonen, M.; Büntgen, Ulf

2014-01-01

Roč. 29, č. 5 (2014), s. 487-494 ISSN 0267-8179 Institutional support: RVO:67179843 Keywords : dendrochronology * Finland * late holocene * Sweden * temperature reconstruction Subject RIV: EH - Ecology, Behaviour Impact factor: 3.357, year: 2014

Analysis of biomarkers in a Czech population exposed to heavy air pollution. Part II. Chromosomal aberrations and oxidative stress

Czech Academy of Sciences Publication Activity Database

Rössner Jr., P.; Rössnerová, A.; Špátová, M.; Beskid, O.; Uhlířová, Kateřina; Líbalová, H.; Solanský, I.; Topinka, J.; Šrám, R.

2013-01-01

Roč. 28, č. 1 (2013), s. 97-106 ISSN 0267-8357 Institutional support: RVO:60077344 Keywords : air pollution * benzo[a]pyrene * benzene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.497, year: 2013

Guest Editorial - Smart materials

Czech Academy of Sciences Publication Activity Database

Barber, Z. H.; Clyne, T. W.; Šittner, Petr

2014-01-01

Roč. 30, 13a (2014), s. 1515-1516 ISSN 0267-0836 Institutional support: RVO:68378271 Keywords : smart materials * shape memory effect (SME) Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.995, year: 2014

Od intenzivního pařezení k lesu ochrannému - analýza historického vývoje lesů na Karlštejnském panství

Czech Academy of Sciences Publication Activity Database

Dörner, Petr; Müllerová, Jana

2014-01-01

Roč. 2014, č. 32 (2014), s. 425-437 ISSN 0231-5807 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67985939 Keywords : coppicing * history * nature protection Subject RIV: EF - Botanics

Surfactant assisted chemical vapour generation of silver for AAS and ICP-OES: a mechanistic study

Czech Academy of Sciences Publication Activity Database

Matoušek, Tomáš; Sturgeon, R. E.

2003-01-01

Roč. 18, č. 5 (2003), s. 487-494 ISSN 0267-9477 Institutional research plan: CEZ:AV0Z4031919 Keywords : vapour generation * ICP-OES * silver Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.200, year: 2003

How a Sphagnum fuscum-dominated bog changed into a calcareous fen: the unique Holocene history of a Slovak spring-fed mire

Czech Academy of Sciences Publication Activity Database

Hájková, Petra; Grootjans, A.B.; Lamentowicz, M.; Rybníčková, E.; Madaras, M.; Opravilová, V.; Michaelis, D.; Hájek, Michal; Joosten, H.; Wolejko, L.

2012-01-01

Roč. 27, č. 3 (2012), s. 233-243 ISSN 0267-8179 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : Holocene * succession * mire Subject RIV: EF - Botanics Impact factor: 2.939, year: 2012

Copper co-crystallization and divalent metal salts cross-influence effect: A new optimization tool improving crystal morphology and diffraction quality

Czech Academy of Sciences Publication Activity Database

Kutá-Smatanová, Ivana

2007-01-01

Roč. 306, č. 2 (2007), s. 383-389 ISSN 0022-0248 Institutional research plan: CEZ:AV0Z60870520 Keywords : crystal * crystallization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.950, year: 2007

Mitochondrial G8292A and C8794T mutations in patients with Niemann-Pick disease type C.

Science.gov (United States)

Masserrat, Abbas; Sharifpanah, Fatemeh; Akbari, Leila; Tonekaboni, Seyed Hasan; Karimzadeh, Parvaneh; Asharafi, Mahmood Reza; Mazouei, Safoura; Sauer, Heinrich; Houshmand, Massoud

2018-07-01

Niemann-Pick disease type C (NP-C) is a neurovisceral lipid storage disorder. At the cellular level, the disorder is characterized by accumulation of unesterified cholesterol and glycolipids in the lysosomal/late endosomal system. NP-C is transmitted in an autosomal recessive manner and is caused by mutations in either the NPC1 (95% of families) or NPC2 gene. The estimated disease incidence is 1 in 120,000 live births, but this likely represents an underestimate, as the disease may be under-diagnosed due to its highly heterogeneous presentation. Variants of adenosine triphosphatase (ATPase) subunit 6 and ATPase subunit 8 ( ATPase6/8 ) in mitochondrial DNA (mtDNA) have been reported in different types of genetic diseases including NP-C. In the present study, the blood samples of 22 Iranian patients with NP-C and 150 healthy subjects as a control group were analyzed. The DNA of the blood samples was extracted by the salting out method and analyzed for ATPase6/8 mutations using polymerase chain reaction sequencing. Sequence variations in mitochondrial genome samples were determined via the Mitomap database. Analysis of sequencing data confirmed the existence of 11 different single nucleotide polymorphisms (SNPs) in patients with NP-C1. One of the most prevalent polymorphisms was the A8860G variant, which was observed in both affected and non-affected groups and determined to have no significant association with NP-C incidence. Amongst the 11 polymorphisms, only one was identified in the ATPase8 gene, while 9 including A8860G were observed in the ATPase6 gene. Furthermore, two SNPs, G8292A and C8792A, located in the non-coding region of mtDNA and the ATPase6 gene, respectively, exhibited significantly higher prevalence rates in NP-C1 patients compared with the control group (PC disease. In addition, the mitochondrial SNPs identified maybe pathogenic mutations involved in the development and prevalence of NP-C. Furthermore, these results suggest a higher occurrence of

Cytokine production by porcine mononuclear leukocytes stimulated by mitogens

Czech Academy of Sciences Publication Activity Database

Rašková, G.; Kovářů, František; Bártová, J.

2005-01-01

Roč. 74, - (2005), s. 521-525 ISSN 0001-7213 R&D Projects: GA ČR GA524/05/0267 Institutional research plan: CEZ:AV0Z50450515 Keywords : cytokine * ELISpot * mitogen Subject RIV: ED - Physiology Impact factor: 0.353, year: 2005

Selective hydride generation–cryotrapping–ICP-MS for arsenic speciation analysis at picogram levels: analysis of river and sea water reference materials and human bladder epithelial cells

Czech Academy of Sciences Publication Activity Database

Matoušek, Tomáš; Currier, J. M.; Trojánková, Nikola; Saunders, R. J.; Ishida, M. C.; González-Horta, C.; Musil, Stanislav; Mester, Z.; Stýblo, M.; Dědina, Jiří

2013-01-01

Roč. 28, č. 9 (2013), s. 1456-1465 ISSN 0267-9477 R&D Projects: GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : arsenic * speciaton analysis * hydride generation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.396, year: 2013

Comparative oxidation state specific analysis of arsenic species by high-performance liquid chromatography- inductively coupled plasma-mass spectrometry and hydride generation-cryotrapping-atomic absorption spectrometry

Czech Academy of Sciences Publication Activity Database

Currier, J. M.; Saunders, R. J.; Ding, L.; Bodnar, W.; Cable, P.; Matoušek, Tomáš; Creed, J. T.; Stýblo, M.

2013-01-01

Roč. 28, č. 6 (2013), s. 843-852 ISSN 0267-9477 R&D Projects: GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : arsenic * speciaton analysis * As metabolism Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.396, year: 2013

COGENT (COlorectal cancer GENeTics) revisited

Czech Academy of Sciences Publication Activity Database

Aaltonen, L. A.; Brenner, H.; Buch, S.; Campbell, H.; Carracedo, A.; Carvajal-Carmona, L.; Castells, A.; Castellví-Bel, S.; Cheadle, J. P.; Devilee, P.; Dunlop, M.; Echeverry, M.; Gallinger, S.; Galvan, A.; Hampe, J.; Hemminki, K.; Ho, J. W. C.; Hofstra, R. M. W.; Hudson, T. J.; Kirac, I.; Lerch, M. M.; Li, L.; Lindblom, A.; Lipton, L.; Matsuda, K.; Maughan, T. S.; Moreno, V.; Morreau, H.; Naccarati, Alessio; Nakamura, Y.; Peterlongo, P.; Pharoah, P. D.; Sieber, O.; Radice, P.; Ruiz-Ponte, C.; Schafmayer, C.; Schmidt, C. A.; von Schönfels, W.; Schreiber, S.; Scott, R.; Sham, P.; Souček, P.; Tenesa, A.; Tomplinson, P. M.; Velez, A.; Villanueva, C. M.; Vodička, Pavel; Völzke, H.; van Wezel, T.; Wijnen, J.T.; Zanke, B.

2012-01-01

Roč. 27, č. 2 (2012), s. 143-151 ISSN 0267-8357 Institutional research plan: CEZ:AV0Z50390703 Keywords : identification of low-risk variants * disease causing variants * susceptibility alleles Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Elemental mapping of structural materials for a nuclear reactor by means of LA-ICP-MS

Czech Academy of Sciences Publication Activity Database

Vaculovič, T.; Warchilová, T.; Šimo, T.; Matal, O.; Otruba, V.; Mikuška, Pavel; Kanický, V.

2012-01-01

Roč. 27, č. 8 (2012), s. 1321-1326 ISSN 0267-9477 Institutional research plan: CEZ:AV0Z40310501 Keywords : LA- ICP -MS * ICP -OES * LiF–NaF salts Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.155, year: 2012

Observations on the transmission and the seasonality of infection of the nematode Cystidicoloides ephemeridarum in Salmo trutta fario in a small trout stream in North Bohemia, the Czech Republic

Czech Academy of Sciences Publication Activity Database

Moravec, František; Frantová, Denisa

2003-01-01

Roč. 48, č. 1 (2003), s. 41-46 ISSN 1230-2821 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Cystidicoloides * seasonality Subject RIV: EG - Zoology Impact factor: 0.495, year: 2003

External morphological differences between Crepidostomum farionis and Crepidostomum metoecus (Trematoda: Allocreadiidae), parasites of salmonids, as revealed by SEM

Czech Academy of Sciences Publication Activity Database

Moravec, František

2002-01-01

Roč. 49, č. 3 (2002), s. 211-217 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : Trematoda * Crepidostomum * surface morphology Subject RIV: EG - Zoology Impact factor: 0.515, year: 2002

Alphabetical order effects in school admissions

Czech Academy of Sciences Publication Activity Database

Jurajda, Štěpán; Münich, Daniel

2016-01-01

Roč. 31, č. 4 (2016), s. 483-498 ISSN 0267-1522 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : admissions * alphabetical order * order effects Subject RIV: AH - Economics Impact factor: 1.033, year: 2016

Crystal structure of vanadite: Refinement of anisotropic displacement parameters

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Skála, Roman; Haloda, J.; Císařová, I.

2006-01-01

Roč. 51, 3-4 (2006), s. 271-275 ISSN 1210-8197 Institutional research plan: CEZ:AV0Z30130516 Keywords : anisotropic displacement parameter * crystal structure * single-crystal X-ray refinement * vanadinite Subject RIV: DB - Geology ; Mineralogy

Characterization and mutual comparison of new electrolytic cell designs for hydride generation-atomic absorption spectrometry with a quartz tube atomizer using Se as a model analyte and Se-75 as a radioactive indicator

Czech Academy of Sciences Publication Activity Database

Hraníček, J.; Červený, V.; Kratzer, Jan; Vobecký, Miloslav; Rychlovský, P.

2012-01-01

Roč. 27, č. 10 (2012), s. 1761-1771 ISSN 0267-9477 R&D Projects: GA ČR GA203/09/1783 Institutional support: RVO:68081715 Keywords : electrochemical hydride generation AAS * selenium hydride * radiotracer study Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.155, year: 2012

Dielectric properties of CaTiO3 coatings prepared by plasma spraying

Czech Academy of Sciences Publication Activity Database

Sedláček, J.; Ctibor, Pavel; Kotlan, J.; Pala, Zdeněk

2013-01-01

Roč. 29, č. 5 (2013), s. 384-389 ISSN 0267-0844 Institutional support: RVO:61389021 Keywords : Plasma * Ceramics * CaTiO3 * Permittivity * Resistivity Subject RIV: JG - Metallurgy Impact factor: 1.510, year: 2013 http://www.ingentaconnect.com/content/maney/se/2013/00000029/00000005/art00012

Public Housing in the Post-Socialist States of Central and Eastern Europe: Decline and an Open Future

Czech Academy of Sciences Publication Activity Database

Lux, Martin; Sunega, Petr

2014-01-01

Roč. 29, č. 4 (2014), s. 501-519 ISSN 0267-3037 R&D Projects: GA ČR(CZ) GAP404/12/1446 Institutional support: RVO:68378025 Keywords : housing policy * post- social ist states * housing privatization Subject RIV: AO - Sociology, Demography Impact factor: 0.991, year: 2014

Variation in vegetation and microbial linkages with slope aspect in a montane temperate hardwood forest

Czech Academy of Sciences Publication Activity Database

Gilliam, F. S.; Hédl, Radim; Chudomelová, Markéta; McCulley, R. L.; Nelson, J. A.

2014-01-01

Roč. 5, č. 5 (2014), s. 1-17, A66 ISSN 2150-8925 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67985939 Keywords : vegetation * soil microorganisms * slope aspect Subject RIV: EH - Ecology, Behaviour Impact factor: 2.255, year: 2014

Redescription of Raphidascaris gigi Fujita, 1928 (Nematoda: Anisakidae), a parasite of freshwater fishes in Japan

Czech Academy of Sciences Publication Activity Database

Moravec, František; Nagasawa, K.

2002-01-01

Roč. 52, č. 3 (2002), s. 193-198 ISSN 0165-5752 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : nematodes * parasite of fish * Japan Subject RIV: EG - Zoology Impact factor: 0.640, year: 2002

Crystal growth and scintillation properties of Lu substituted CeBr.sub.3./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Ito, T.; Yokota, Y.; Kurosawa, S.; Král, Robert; Kamada, K.; Pejchal, Jan; Ohashi, Y.; Yoshikawa, A.

2016-01-01

Roč. 452, Oct (2016), s. 65-68 ISSN 0022-0248. [American Conference on Crystal Growth and Epitaxy /20./ (ACCGE) / 17th Biennial Workshop on Organometallic Vapor Phase Epitaxy (OMVPE) / 2nd 2D Electronic Materials Symposium. Big Sky, MT, 02.08.2015-07.08.2015] Institutional support: RVO:68378271 Keywords : radiation * halides * scintillator materials * crystal growth Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.751, year: 2016

Responses in young Quercus petraea: coppices and standards under favourable and drought conditions

Czech Academy of Sciences Publication Activity Database

Stojanović, Marko; Čater, M.; Pokorný, Radek

2016-01-01

Roč. 76, jan (2016), s. 127-136 ISSN 1641-1307 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67179843 Keywords : coppice * standards * comparison * photosynthetic response * quantum yield * light conditions * drought response Subject RIV: EF - Botanics Impact factor: 0.776, year: 2016

Preparation of nitinol by non-conventional powder metallurgy techniques

Czech Academy of Sciences Publication Activity Database

Novák, P.; Moravec, H.; Salvetr, P.; Průša, F.; Drahokoupil, Jan; Kopeček, Jaromír; Karlík, M.; Kubatík, Tomáš František

2015-01-01

Roč. 31, č. 15 (2015), s. 1886-1893 ISSN 0267-0836 R&D Projects: GA ČR(CZ) GA14-03044S Institutional support: RVO:68378271 ; RVO:61389021 Keywords : shape memory alloys * SHS process * SEM * powder metallurgy Subject RIV: JG - Metallurgy Impact factor: 1.008, year: 2015

Chemical vapour generation of silver: reduced palladium as permanent reaction modifier for enhanced performance

Czech Academy of Sciences Publication Activity Database

Matoušek, Tomáš; Sturgeon, R. E.

2004-01-01

Roč. 19, č. 8 (2004), s. 1014-1017 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453 Institutional research plan: CEZ:AV0Z4031919 Keywords : chemical vapour generation * chemical modification * silver Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2004

Comparison of assimilation parameters of coppiced and non-coppiced sessile oaks

Czech Academy of Sciences Publication Activity Database

Holišová, Petra; Pietras, Justyna; Dařenová, Eva; Novosadová, Kateřina; Pokorný, Radek

2016-01-01

Roč. 9, AUG (2016), s. 553-559 ISSN 1971-7458 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67179843 Keywords : Drought * Photosynthesis * Seedlings * Sprouts Subject RIV: GK - Forestry Impact factor: 1.623, year: 2016

Investigation of in situ trapping of selenium and arsenic hydrides within a tungsten tube atomiser

Czech Academy of Sciences Publication Activity Database

Dočekal, Bohumil; Marek, Petr

2001-01-01

Roč. 16, č. 8 (2001), s. 831-837 ISSN 0267-9477 R&D Projects: GA ČR GA203/98/0754 Institutional research plan: CEZ:AV0Z4031919 Keywords : graphite furnace * absorption spectrometry * atomization Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.305, year: 2001

Detection of Interictal Epileptiform Discharges Using Signal Envelope Distribution Modelling: Application to Epileptic and Non-Epileptic Intracranial Recordings

Czech Academy of Sciences Publication Activity Database

Janča, R.; Ježdík, P.; Čmejla, R.; Tomášek, M.; Worrell, G. A.; Stead, M.; Wagenaar, J.; Jefferys, J. G. R.; Kršek, P.; Komárek, V.; Jiruška, Přemysl; Marusič, P.

2015-01-01

Roč. 28, č. 1 (2015), s. 172-183 ISSN 0896-0267 Grant - others:GA Mzd(CZ) NT11460 Institutional support: RVO:67985823 Keywords : spike detection * interictal epileptiform discharges * intracranial recording * automatic detection * Hilbert transform * principal component analysis Subject RIV: FH - Neurology Impact factor: 3.727, year: 2015

Inhibition of beta-catenin signalling promotes DNA damage elicited by benzo[a]pyrene in a model of human colon cancer cells via CYP1 deregulation

Czech Academy of Sciences Publication Activity Database

Kabátková, Markéta; Zapletal, Ondřej; Tylichová, Zuzana; Neca, J.; Machala, M.; Milcová, Alena; Topinka, Jan; Kozubík, Alois; Vondráček, Jan

2015-01-01

Roč. 30, č. 4 (2015), s. 565-576 ISSN 0267-8357 R&D Projects: GA ČR(CZ) GA13-09766S Institutional support: RVO:68081707 ; RVO:68378041 Keywords : ARYL-HYDROCARBON RECEPTOR * POLYCYCLIC AROMATIC-HYDROCARBONS * COLORECTAL - CANCER Subject RIV: BO - Biophysics Impact factor: 2.297, year: 2015

Reasoning behind choices: rationality and social norms in the housing market behaviour of first-time buyers in the Czech Republic.

Czech Academy of Sciences Publication Activity Database

Lux, Martin; Gibas, Petr; Boumová, Irena; Hájek, Martin; Sunega, Petr

2017-01-01

Roč. 32, č. 4 (2017), s. 517-539 ISSN 0267-3037 R&D Projects: GA ČR(CZ) GAP404/12/1446 Institutional support: RVO:68378025 Keywords : housing market * social norms * housing system Subject RIV: AO - Sociology, Demography OBOR OECD: Sociology Impact factor: 1.513, year: 2016

Property Restitution and Private Rental Housing in Transition: The Case of the Czech Republic

Czech Academy of Sciences Publication Activity Database

Lux, Martin; Mikeszová, Martina

2012-01-01

Roč. 27, č. 1 (2012), s. 77-96 ISSN 0267-3037 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : transition * property restitution * private rental housing Subject RIV: AO - Sociology, Demography Impact factor: 0.951, year: 2012

Selective generation of substituted arsines-cryotrapping-atomic absorption spectrometry for arsenic speciation analysis in N-methylglucamine antimonate

Czech Academy of Sciences Publication Activity Database

Moraes, D. P.; Svoboda, Milan; Matoušek, Tomáš; Flores, E. M. D.; Dědina, Jiří

2012-01-01

Roč. 27, č. 10 (2012), s. 1734-1742 ISSN 0267-9477 R&D Projects: GA ČR GA203/09/1783 Institutional research plan: CEZ:AV0Z40310501 Keywords : hydride generation * cryotrapping * arsenic speciation analysis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.155, year: 2012

The rise and fall of traditional forest management in southern Moravia: A history of the past 700 years

Czech Academy of Sciences Publication Activity Database

Müllerová, Jana; Szabó, Péter; Hédl, Radim

2014-01-01

Roč. 331, Nov 1 (2014), s. 104-115 ISSN 0378-1127 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : archival sources * coppicing * GIS Subject RIV: EF - Botanics Impact factor: 2.660, year: 2014

Coppice abandonment and its implications for species diversity in forest vegetation

Czech Academy of Sciences Publication Activity Database

Müllerová, Jana; Hédl, Radim; Szabó, Péter

2015-01-01

Roč. 343, May 1 (2015), s. 88-100 ISSN 0378-1127 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : conversation * forest management * history Subject RIV: EF - Botanics Impact factor: 2.826, year: 2015

Oak sprouts grow better than seedlings under drought stress

Czech Academy of Sciences Publication Activity Database

Pietras, Justyna; Stojanović, Marko; Knott, R.; Pokorný, Radek

2016-01-01

Roč. 9, č. 4 (2016), s. 529-535 ISSN 1971-7458 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67179843 Keywords : drought stress * sap flow * transpiration * biomass Production * sessile Oak * sprout * seedling Subject RIV: EF - Botanics Impact factor: 1.623, year: 2016

Vegetation resurvey is robust to plot location uncertainty

Czech Academy of Sciences Publication Activity Database

Kopecký, Martin; Macek, Martin

2015-01-01

Roč. 21, č. 3 (2015), s. 322-330 ISSN 1366-9516 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : vegetation change * vegetation resurvey * pseudoturnover Subject RIV: EF - Botanics Impact factor: 4.566, year: 2015

Observations on the metazoan parasites of the Atlantic salmon (Salmo salar) after its reintroduction into the Elbe River basin in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Moravec, František

2003-01-01

Roč. 50, č. 4 (2003), s. 296-304 ISSN 0015-5683 R&D Projects: GA ČR GA524/00/0267 Institutional research plan: CEZ:AV0Z6022909 Keywords : Atlantic salmon * helminths * Czech Republic Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.469, year: 2003

Experimental restoration of coppice-with-standards: Response of understorey vegetation from the conservation perspective

Czech Academy of Sciences Publication Activity Database

Vild, Ondřej; Roleček, Jan; Hédl, Radim; Kopecký, Martin; Utinek, D.

2013-01-01

Roč. 310, Dec 2013 (2013), s. 234-241 ISSN 0378-1127 R&D Projects: GA AV ČR IAA600050812; GA MŠk EE2.3.20.0267 Institutional support: RVO:67985939 Keywords : restoration experiment * endangered species * traditional woodland management Subject RIV: EF - Botanics Impact factor: 2.667, year: 2013

Different harvest intensity and soil CO2 efflux in sessile oak coppice forests

Czech Academy of Sciences Publication Activity Database

Dařenová, Eva; Majtaz, C.; Pavelka, Marian

2016-01-01

Roč. 9, feb (2016), s. 546-552 ISSN 1971-7458 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67179843 Keywords : Low Forest * Soil Moisture * Soil Respiration * Temperature Dependence Subject RIV: GK - Forestry Impact factor: 1.623, year: 2016

Drivers of temporal changes in temperate forest plant diversity vary across spatial scales

Czech Academy of Sciences Publication Activity Database

Bernhardt-Römermann, M.; Baeten, L.; Craven, D.; De Frenne, P.; Hédl, Radim; Lenoir, J.; Bert, D.; Brunet, J.; Chudomelová, Markéta; Decocq, G.; Dierschke, H.; Dirnböck, T.; Dörfler, I.; Heinken, T.; Hermy, M.; Hommel, P.; Jaroszewicz, B.; Keczynski, A.; Kelly, D. L.; Kirkby, K.J.; Kopecký, Martin; Macek, Martin; Máliš, F.; Mirtl, M.; Mitchell, F. J. G.; Naaf, T.; Newman, M.; Peterken, G.; Petřík, Petr; Schmidt, W.; Standovár, T.; Tóth, Z.; Van Calster, H.; Verstraeten, G.; Vladovič, J.; Vild, Ondřej; Wulf, M.; Verheyen, K.

2015-01-01

Roč. 21, č. 10 (2015), s. 3726-3737 ISSN 1354-1013 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : temperate forest * long-term change * herbaceous layer Subject RIV: EF - Botanics Impact factor: 8.444, year: 2015

Post-Socialist Housing Systems in Europe: Housing Welfare Regimes by Default?

Czech Academy of Sciences Publication Activity Database

Stephens, M.; Lux, Martin; Sunega, Petr

2015-01-01

Roč. 30, č. 8 (2015), s. 1210-1234 ISSN 0267-3037 R&D Projects: GA ČR(CZ) GAP404/12/1446 Institutional support: RVO:68378025 Keywords : Welfare regimes * financialisation * housing policy Subject RIV: AO - Sociology, Demography Impact factor: 1.309, year: 2015 http://dx.doi.org/10.1080/02673037.2015.1013090

Novel acyclic nucleoside phosphonate analogues with potent anti-hepatitis B virus activities

Czech Academy of Sciences Publication Activity Database

Ying, C.; Holý, Antonín; Hocková, Dana; Havlas, Zdeněk; De Clercq, E.; Neyts, J.

2005-01-01

Roč. 49, č. 3 (2005), 1177-1180 ISSN 0066-4804 R&D Projects: GA AV ČR(CZ) IBS4055109 Grant - others:FWO(BE) G.0267.04 Institutional research plan: CEZ:AV0Z4055905 Keywords : antivirals * hepatitis B * ANP Subject RIV: CC - Organic Chemistry Impact factor: 4.379, year: 2005

Structural chromosomal aberrations as potential risk markers in incident cancer patients

Czech Academy of Sciences Publication Activity Database

Vodenková, Soňa; Polívková, Z.; Musak, L.; Smerhovský, Z.; Zoubková, H.; Sytarová, S.; Kavcová, E.; Halasová, E.; Vodičková, Ludmila; Jirásková, Kateřina; Svoboda, Miroslav; Ambruš, M.; Hemminki, K.; Vodička, Pavel

2015-01-01

Roč. 30, č. 4 (2015), s. 557-563 ISSN 0267-8357 R&D Projects: GA MŠk(CZ) LD14050 Institutional support: RVO:68378041 Keywords : peripheral-blood lymphocytes * dna-repair genes * healthy humans * polymorphisms * frequency * damage * biomarkers * association * carcinogens * instability Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.297, year: 2015

New crystals for dual-readout calorimetry

Czech Academy of Sciences Publication Activity Database

Akchurin, N.; Bedeschi, F.; Cardini, A.; Carosi, R.; Ciapetti, G.; Ferrari, R.; Franchino, S.; Fraternali, M.; Gaudio, G.; Hauptman, J.; Incagli, M.; Korzhik, M.; Lacava, F.; La Rotonda, L.; Livan, M.; Meoni, E.; Nikl, Martin; Pinci, D.; Policicchio, A.; Popescu, S.; Scuri, F.; Sill, A.; Vandelli, W.; Vedda, A.; Venturelli, T.; Voena, C.; Volobouev, I.; Wigmans, R.

2009-01-01

Roč. 604, č. 3 (2009), s. 512-526 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10100521 Keywords : calorimetry * Cherenkov light * high-Z scintillating crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.317, year: 2009

Influence of clay content on the melting behavior and crystal structure of nonisothermal crystallized poly(L-lactic acid)/nanocomposites

Czech Academy of Sciences Publication Activity Database

Ublekov, F.; Baldrian, Josef; Kratochvíl, Jaroslav; Steinhart, M.; Nedkov, E.

2012-01-01

Roč. 124, č. 2 (2012), s. 1643-1648 ISSN 0021-8995 Institutional research plan: CEZ:AV0Z40500505 Keywords : biopolymers * nanocomposite s * crystal structures Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.395, year: 2012

Mechanism of selenium hydride atomization, fate of free atoms and temperature distribution in an argon shielded, highly fuel-rich, hydrogen-oxygen diffusion micro-flame studied by atomic absorption spectrometry

Czech Academy of Sciences Publication Activity Database

D'Ulivo, A.; Dědina, Jiří; Lampugnani, L.; Matoušek, Tomáš

2002-01-01

Roč. 17, č. 3 (2002), s. 253-257 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453; GA ČR GA203/98/0754 Institutional research plan: CEZ:AV0Z4031919 Keywords : hydride atomization * hydride generation * atomic absorption spectrometry Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.250, year: 2002

Neurobiological aspects of depressive disorder and antidepressant treatment: role of glia

Czech Academy of Sciences Publication Activity Database

Páv, M.; Kovářů, H.; Fišerová, Anna; Havrdová, E.; Lisá, Věra

2008-01-01

Roč. 57, č. 2 (2008), s. 151-164 ISSN 0862-8408 R&D Projects: GA ČR GA524/05/0267; GA AV ČR IAA500200620 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z50200510 Keywords : major depression * mood disorder * antidepressant Subject RIV: EC - Immunology Impact factor: 1.653, year: 2008

Tree-Rings Mirror Management Legacy: Dramatic Response of Standard Oaks to Past Coppicing in Central Europe

Czech Academy of Sciences Publication Activity Database

Altman, Jan; Hédl, Radim; Szabó, Péter; Mazůrek, Petr; Riedl, Vladan; Müllerová, Jana; Kopecký, Martin; Doležal, Jiří

2013-01-01

Roč. 8, č. 2 (2013), e55770 E-ISSN 1932-6203 R&D Projects: GA ČR GAP504/12/1952; GA AV ČR IAA600050812; GA MŠk(CZ) EE2.3.20.0267 Institutional support: RVO:67985939 Keywords : tree-rings * coppicing * competition Subject RIV: EH - Ecology, Behaviour Impact factor: 3.534, year: 2013

Silver chemical vapor generation for atomic absorption spectrometry: Minimization of transport losses, interferences and application to water analysis

Czech Academy of Sciences Publication Activity Database

Musil, Stanislav; Kratzer, Jan; Vobecký, Miloslav; Benada, Oldřich; Matoušek, Tomáš

2010-01-01

Roč. 25, č. 10 (2010), s. 1618-1626 ISSN 0267-9477 R&D Projects: GA ČR GA203/09/1783 Institutional research plan: CEZ:AV0Z40310501; CEZ:AV0Z50200510 Keywords : chemical vapor generation * 111Ag radioindicator * transport losses Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.372, year: 2010

Influence of thickness on properties of YbxCo4Sb12 layers prepared by laser ablation

Czech Academy of Sciences Publication Activity Database

Zeipl, Radek; Jelínek, M.; Kocourek, Tomáš; Navrátil, Jiří; Yatskiv, Roman; Josieková, M.; Leshkov, Sergey; Jurek, Karel; Walachová, Jarmila

2010-01-01

Roč. 12, č. 3 (2010), s. 572-575 ISSN 1454-4164 R&D Projects: GA ČR GA203/07/0267 Institutional research plan: CEZ:AV0Z20670512; CEZ:AV0Z40500505; CEZ:AV0Z10100521 Keywords : thermoelectrics * thin layers * skutterudites Subject RIV: JA - Electronics ; Optoelectronics , Electrical Engineering Impact factor: 0.412, year: 2010

Habitat requirements of endangered species in a former coppice of high conservation value

Czech Academy of Sciences Publication Activity Database

Roleček, Jan; Vild, Ondřej; Sladký, J.; Řepka, R.

2017-01-01

Roč. 52, č. 1 (2017), s. 59-69 ISSN 1211-9520 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : abandoned coppice * environmental requirements * red-list species Subject RIV: EH - Ecology, Behaviour OBOR OECD: Plant sciences, botany Impact factor: 1.017, year: 2016

Dynamics of herbaceous vegetation during four years of experimental coppice introduction

Czech Academy of Sciences Publication Activity Database

Hédl, Radim; Šipoš, Jan; Chudomelová, Markéta; Utinek, D.

2017-01-01

Roč. 52, č. 1 (2017), s. 83-99 ISSN 1211-9520 R&D Projects: GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : biodiversity * ecological restoration * coppice-with-standards Subject RIV: EH - Ecology, Behaviour OBOR OECD: Plant sciences, botany Impact factor: 1.017, year: 2016

Laser ablation of an indium target: time-resolved Fourier-transform infrared spectra of In I in the 700–7700 cm−1 range

Czech Academy of Sciences Publication Activity Database

Civiš, Svatopluk; Kubelík, Petr; Ferus, Martin; Chernov, Vladislav E.; Zanozina, Ekaterina M.; Juha, Libor

2014-01-01

Roč. 29, č. 12 (2014), s. 2275-2283 ISSN 0267-9477 R&D Projects: GA MŠk LD14115; GA MŠk(CZ) LG13029 Institutional support: RVO:61388955 ; RVO:68378271 Keywords : time-resolved fluorescence * Fourier transform infra reds * Laser-induced breakdown spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.466, year: 2014

Variations in mismatch repair genes and colorectal cancer risk and clinical outcome

Czech Academy of Sciences Publication Activity Database

Vymetálková, Veronika; Pardini, B.; Rosa, F.; Di Gaetano, C.; Novotný, J.; Levý, M.; Buchler, T.; Slyšková, Jana; Vodičková, Ludmila; Naccarati, Alessio; Vodička, Pavel

2014-01-01

Roč. 29, č. 4 (2014), s. 259-265 ISSN 0267-8357 R&D Projects: GA ČR GPP304/11/P715; GA ČR GAP304/10/1286; GA MZd NT12025 Institutional support: RVO:68378041 Keywords : colorectal cancer , , * mismatch repair genes * miRNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.793, year: 2014

The role of ABC transporters in progression and clinical outcome of colorectal cancer

Czech Academy of Sciences Publication Activity Database

Hlavatá, I.; Mohelníková-Duchoňová, B.; Václavíková, R.; Liška, V.; Pitule, P.; Novák, P.; Bruha, J.; Vyčítal, O.; Holubec, L.; Treska, V.; Vodička, Pavel (ed.); Souček, P.

2012-01-01

Roč. 27, č. 2 (2012), s. 187-196 ISSN 0267-8357 R&D Projects: GA MZd NS10230; GA ČR GA310/07/1430 Grant - others:MŠk(CZ) GAUK15109/2009 Institutional research plan: CEZ:AV0Z50390512 Keywords : biomarkers, * chemotherapy * gene expression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Crystallic silver amalgam – a novel electrode material

Czech Academy of Sciences Publication Activity Database

Daňhel, A.; Mansfeldová, Věra; Janda, Pavel; Vyskočil, V.; Barek, J.

2011-01-01

Roč. 136, č. 118 (2011), s. 36563662 ISSN 0003-2654 Institutional research plan: CEZ:AV0Z40400503 Keywords : crystallic silver amalgam * electrode materials * electrochemistry Subject RIV: CG - Electrochemistry Impact factor: 4.230, year: 2011

Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

2014-01-01

Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

Crystal growth and characterization of calcium metaborate scintillators

Czech Academy of Sciences Publication Activity Database

Fujimoto, Y.; Yanagida, T.; Kawaguchi, N.; Fukuda, K.; Totsuka, D.; Watanabe, K.; Yamazaki, A.; Chani, V.; Nikl, Martin; Yoshikawa, A.

2013-01-01

Roč. 703, MAR (2013), s. 7-10 ISSN 0168-9002 Institutional support: RVO:68378271 Keywords : Czochralski method * single crystal * scintillator * calcium metaborate * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.316, year: 2013

Nanotag-enabled photonic crystal fiber as quantitative surface-enhanced Raman scattering optofluidic platform

Czech Academy of Sciences Publication Activity Database

Pinkhasova, P.; Chen, H.; Kaňka, Jiří; Mergo, P.; Du, H.

2015-01-01

Roč. 106, č. 7 (2015), 0711061-0711064 ISSN 0003-6951 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Photonic crystal fibers * Raman scattering * Crystal whiskers Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.142, year: 2015

Patterns of functional diversity of two trophic groups after canopy thinning in an abandoned coppice

Czech Academy of Sciences Publication Activity Database

Šipoš, Jan; Hédl, Radim; Hula, V.; Chudomelová, Markéta; Košulič, O.; Niedobová, J.; Riedl, Vladan

2017-01-01

Roč. 52, č. 1 (2017), s. 45-58 ISSN 1211-9520 R&D Projects: GA AV ČR IAA600050812; GA MŠk(CZ) EE2.3.20.0267 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : coppice restoration * functional diversity * trophic groups Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.017, year: 2016

Magnetic shape memory effect and highly mobile twin boundaries

Czech Academy of Sciences Publication Activity Database

Heczko, Oleg

2014-01-01

Roč. 30, č. 13 (2014), s. 1559-1578 ISSN 0267-0836 R&D Projects: GA ČR(CZ) GAP107/11/0391 Institutional support: RVO:68378271 Keywords : magnetic shape memory effect * ferromagnetic martensite * twinning * magnetically induced reorientation * reviews Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.995, year: 2014 http://dx.doi.org/10.1179/1743284714Y.0000000599

Gene expression variations: potentialities of master regulator polymorphisms in colorectal cancer risk

Czech Academy of Sciences Publication Activity Database

Pardini, Barbara; Naccarati, Alessio; Vodička, Pavel (ed.); Kumar, R.

2012-01-01

Roč. 27, č. 2 (2012), s. 161-167 ISSN 0267-8357 R&D Projects: GA ČR GP305/09/P194; GA ČR GAP304/10/1286 Institutional research plan: CEZ:AV0Z50390512 Keywords : master regulators of transcrition * genome-wide association studies (GWAS) * colorectal cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Life stage, not climate change, explains observed tree range shifts

Czech Academy of Sciences Publication Activity Database

Máliš, F.; Kopecký, Martin; Petřík, Petr; Vladovič, J.; Merganič, J.; Vida, T.

2016-01-01

Roč. 22, č. 5 (2016), s. 1904-1914 ISSN 1354-1013 R&D Projects: GA MŠk(CZ) EE2.3.20.0267; GA ČR GPP505/10/P173 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : elevational range shift * vegetation resurvey * temperate forests Subject RIV: EH - Ecology, Behaviour Impact factor: 8.502, year: 2016

Twinning processes in Cu-Al-Ni martensite single crystals investigated by neutron single crystal diffraction method

Czech Academy of Sciences Publication Activity Database

Molnar, P.; Šittner, P.; Novák, V.; Lukáš, Petr

2008-01-01

Roč. 481, Sp.Iss.SI (2008), s. 513-517 ISSN 0921-5093 R&D Projects: GA AV ČR IAA100480704 Institutional research plan: CEZ:AV0Z10480505 Keywords : Cu-Al-Ni * single crystals * neutron diffraction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.806, year: 2008

Formation of structured nanophases in halide crystals

Czech Academy of Sciences Publication Activity Database

Kulveit, Jan; Demo, Pavel; Polák, Karel; Sveshnikov, Alexey; Kožíšek, Zdeněk

2013-01-01

Roč. 5, č. 6 (2013), s. 561-564 ISSN 2164-6627 R&D Projects: GA ČR GAP108/12/0891 Institutional support: RVO:68378271 Keywords : halide crystals * nucleation Subject RIV: BM - Solid Matter Physics ; Magnetism http://www.aspbs.com/asem.html#v5n6

Photosensitive bent-core liquid crystals based on methyl substituted 3-hydroxybenzoic acid.

Czech Academy of Sciences Publication Activity Database

Kohout, M.; Alaasar, M.; Poryvai, A.; Novotná, Vladimíra; Poppe, S.; Tschierske, C.; Svoboda, J.

2017-01-01

Roč. 7, č. 57 (2017), s. 35805-35813 ISSN 2046-2069 R&D Projects: GA ČR GA16-12150S Institutional support: RVO:68378271 Keywords : liquid crystals * photosensitivity * bent-core liquid crystals * 3-hydroxybenzoic acid Subject RIV: JJ - Other Materials OBOR OECD: Nano-materials (production and properties) Impact factor: 3.108, year: 2016

Crystal growth and optical properties of Gd admixed Ce-doped Lu.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Horiai, T.; Kurosawa, S.; Murakami, R.; Yamaji, A.; Shoji, Y.; Ohashi, Y.; Pejchal, Jan; Kamada, K.; Yokota, Y.; Yoshikawa, A.

2017-01-01

Roč. 468, Jun (2017), s. 391-394 ISSN 0022-0248 Grant - others:AV ČR(CZ) JSPS-17-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : growth from melt * seed crystals * single crystal growth * oxides * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.751, year: 2016

Properties of thin N-type Yb0.14Co4Sb12 and P-type Ce0.09Fe0.67Co3.33Sb12 skutterudite layers prepared by laser ablation

Czech Academy of Sciences Publication Activity Database

Zeipl, Radek; Walachová, Jarmila; Lorinčík, J.; Leshkov, Sergey; Josieková, M.; Jelínek, M.; Kocourek, Tomáš; Jurek, Karel; Navrátil, Jiří; Beneš, L.; Plecháček, T.

2010-01-01

Roč. 28, č. 4 (2010), s. 523-527 ISSN 0734-2101 R&D Projects: GA ČR GAP108/10/1315; GA ČR GA203/07/0267 Institutional research plan: CEZ:AV0Z20670512; CEZ:AV0Z40500505; CEZ:AV0Z10100521 Keywords : thermoelectrics * thin layers * skutterudites Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.291, year: 2010

Automated scoring of lymphocyte micronuclei by the MetaSystems Metafer image cytometry system and its application in studies of human mutagen sensitivity and biodosimetry of genotoxin exposure

Czech Academy of Sciences Publication Activity Database

Rössnerová, Andrea; Špátová, Milada; Schunck, CH.; Šrám, Radim

2011-01-01

Roč. 26, č. 1 (2011), s. 169-175 ISSN 0267-8357 R&D Projects: GA MŽP(CZ) SP/1B3/8/08; GA AV ČR 1QS500390506 Institutional research plan: CEZ:AV0Z50390512 Keywords : automated micronucleus assay * environmental exposure * Metasystems Metafer image cytometry system Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 3.183, year: 2011

Complex Motor–Cognitive Factors Processed in the Anterior Nucleus of the Thalamus: An Intracerebral Recording Study

Czech Academy of Sciences Publication Activity Database

Bočková, M.; Chládek, Jan; Jurák, Pavel; Halámek, Josef; Štillová, K.; Baláž, M.; Chrastina, J.; Rektor, I.

2015-01-01

Roč. 28, č. 2 (2015), s. 269-278 ISSN 0896-0267 R&D Projects: GA ČR GAP103/11/0933; GA MŠk ED0017/01/01; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : Anterior nucleus of the thalamus * Complex cognitive functions * Deep brain stimulation * ERD/S * ERP Subject RIV: BD - Theory of Information Impact factor: 3.727, year: 2015

Differences in nucleotide excision repair capacity between newly diagnosed colorectal cancer patients and healthy controls

Czech Academy of Sciences Publication Activity Database

Slyšková, Jana; Naccarati, Alessio; Pardini, Barbara; Poláková, Veronika; Vodičková, Ludmila; Šmerhovský, Z.; Levý, M.; Lipská, L.; Liška, V.; Vodička, Pavel (ed.)

2012-01-01

Roč. 27, č. 2 (2012), s. 225-232 ISSN 0267-8357 R&D Projects: GA ČR GAP304/10/1286; GA MZd NS10230 Grant - others:EEA-research fund:(NO) A/CZ0046/2/0012 Institutional research plan: CEZ:AV0Z50390512 Keywords : biomarkers * DNA damage * DNA repair capacity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Ancestral susceptibility to colorectal cancer

Czech Academy of Sciences Publication Activity Database

Huhn, S.; Pardini, Barbara; Naccarati, Alessio; Vodička, Pavel (ed.); Hemminki, K.; Försti, A.

2012-01-01

Roč. 27, č. 2 (2012), s. 197-204 ISSN 0267-8357 R&D Projects: GA ČR GA310/07/1430; GA ČR GAP304/10/1286 Grant - others:EU FP7(XE) HEALTH-F4-2007-200767 Institutional research plan: CEZ:AV0Z50390512 Keywords : cancer susceptibility * molecular epidemiology * genetic susceptibility Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Molecular crystals of 2-amino-1,3,4-thiadiazole with inorganic oxyacids – crystal engineering, phase transformations and NLO properties

Czech Academy of Sciences Publication Activity Database

Matulková, Irena; Cihelka, J.; Pojarová, Michaela; Fejfarová, Karla; Dušek, Michal; Císařová, I.; Vaněk, Přemysl; Kroupa, Jan; Němec, P.; Tesařová, N.; Němec, I.

2014-01-01

Roč. 16, č. 9 (2014), s. 1763-1776 ISSN 1466-8033 Grant - others:AVČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : molecular crystals * inorganic salts * structure determination * second harmonic generation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.034, year: 2014

Optimization of crystals for applications in dual-readout calorimetry

Czech Academy of Sciences Publication Activity Database

Akchurin, N.; Bedeschi, F.; Cardini, A.; Carosi, R.; Ciapetti, G.; Fasoli, M.; Ferrari, R.; Franchino, S.; Fraternali, M.; Gaudio, G.; Hauptman, J.; Incagli, M.; Lacava, F.; La Rotonda, L.; Lee, S.; Livan, M.; Meoni, E.; Nikl, Martin; Pinci, D.; Policicchio, A.; Popescu, S.; Scuri, F.; Sill, A.; Susinno, G.; Vandelli, W.; Vedda, A.; Venturelli, T.; Voena, C.; Volobouev, I.; Wigmans, R.

2010-01-01

Roč. 621, 1-3 (2010), 212-221 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10100521 Keywords : calorimetry * Cherenkov light * High-Z scintillating crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.142, year: 2010

A Double-Crystal Monochromator for Neutron Stress Diffractometry

Czech Academy of Sciences Publication Activity Database

Em, V.; Balagurov, A. M.; Glazkov, V. P.; Karpov, I. D.; Mikula, Pavol; Miron, N. F.; Somenkov, V. A.; Sumin, V. V.; Šaroun, Jan; Shushunov, M. N.

2017-01-01

Roč. 60, č. 4 (2017), s. 526-532 ISSN 0020-4412 Institutional support: RVO:61389005 Keywords : neutron diffraction * double-crystal * monochromator Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.437, year: 2016

Magnetic structure of URhSi single crystal

Czech Academy of Sciences Publication Activity Database

Prokeš, K.; Andreev, Alexander V.; Honda, F.; Sechovský, V.

2003-01-01

Roč. 261, - (2003), s. 131-138 ISSN 0304-8853 R&D Projects: GA ČR GA202/02/0739 Institutional research plan: CEZ:AV0Z1010914 Keywords : URhSi single crystal * magnetization * neutron diffraction * magnetic structure determination Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

Crystallization of carbohydrate oxidase from Microdochium nivale

Czech Academy of Sciences Publication Activity Database

Dušková, Jarmila; Dohnálek, Jan; Skálová, Tereza; Ostergaard, L. H.; Fuglsang, C. C.; Kolenko, Petr; Štěpánková, Andrea; Hašek, Jindřich

2009-01-01

Roč. 65, č. 6 (2009), s. 638-640 ISSN 1744-3091 R&D Projects: GA AV ČR IAA500500701; GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : carbohydrate oxidase * crystallization * data processing Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.551, year: 2009

Scintillation properties of a La,Lu-admix gadolinium pyrosilicate crystal

Czech Academy of Sciences Publication Activity Database

Kurosawa, S.; Shishido, T.; Suzuki, A.; Sugawara, T.; Nomura, A.; Yubuta, K.; Shoji, Y.; Yokota, Y.; Pejchal, Jan; Ohashi, Y.; Kamada, K.; Yoshikawa, A.

2015-01-01

Roč. 784, Jun (2015), s. 115-118 ISSN 0168-9002 Institutional support: RVO:68378271 Keywords : scintillator * pyrosilicate crystal * Ce-doped (La, Lu, Gd) Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.200, year: 2015

Bulk study of a DyNiAl single crystal

Czech Academy of Sciences Publication Activity Database

Prchal, J.; Andreev, Alexander V.; Javorský, P.; Honda, F.; Jurek, Karel

272-276, - (2004), e419-e420 ISSN 0304-8853 R&D Projects: GA ČR GA106/02/0943 Keywords : rare-earth * DyNiAl * magnetic anisotropy * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

Detecting Coppice Legacies from Tree Growth

Czech Academy of Sciences Publication Activity Database

Müllerová, Jana; Pejcha, Vít; Altman, Jan; Plener, Tomáš; Dörner, Petr; Doležal, Jiří

2016-01-01

Roč. 11, č. 1 (2016), s. 1-14 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.20.0267; GA ČR GAP504/12/1952; GA ČR(CZ) GA14-12262S EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : coppicing * history * tree-ring analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 2.806, year: 2016

Micronuclei in neonates and children: effects of environmental, genetic, demographic and disease variables

Czech Academy of Sciences Publication Activity Database

Holland, N.; Fucic, A.; Merlo, D.F.; Šrám, Radim; Kirsch-Volders, M.

2011-01-01

Roč. 26, č. 1 (2011), s. 51-56 ISSN 0267-8357 R&D Projects: GA MŽP(CZ) SP/1B3/8/08 Grant - others:European Union(XE) FOOD-CT-2005-513943; European Union(XE) FOOD-CT-2005-016320 Institutional research plan: CEZ:AV0Z50390512 Keywords : Micronucleus assay * newborns * children Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 3.183, year: 2011

Mutations and polymorphisms in TP53 gene--an overview on the role in colorectal cancer

Czech Academy of Sciences Publication Activity Database

Naccarati, Alessio; Poláková, Veronika; Pardini, Barbara; Vodičková, Ludmila; Hemminki, K.; Kumar, R.; Vodička, Pavel (ed.)

2012-01-01

Roč. 27, č. 2 (2012), s. 211-218 ISSN 0267-8357 R&D Projects: GA ČR GP305/09/P194; GA ČR GAP304/10/1286 Grant - others:GA UK(CZ) GA96908/B/2008 Institutional research plan: CEZ:AV0Z50390512 Keywords : TP53 mutations * TP53 polymorphisms * cancer risk Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.500, year: 2012

Crystal structures and vibrational spectra of biuret co-crystals with cyanuric and glutaric acids, discussion of hydrogen bonding involving carbonyl groups

Czech Academy of Sciences Publication Activity Database

Matulková, I.; Mathauserová, J.; Císařová, I.; Němec, I.; Fábry, Jan

2016-01-01

Roč. 231, č. 5 (2016), s. 291-300 ISSN 2194-4946 R&D Projects: GA ČR GA14-05506S Institutional support: RVO:68378271 Keywords : biuret * crystal structure analysis * hydrogen bonding * vibrational spectroscopy * X-ray diffraction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.179, year: 2016

Electron effective mass in Sn-doped monoclinic single crystal β-gallium oxide determined by mid-infrared optical Hall effect

Science.gov (United States)

Knight, Sean; Mock, Alyssa; Korlacki, Rafał; Darakchieva, Vanya; Monemar, Bo; Kumagai, Yoshinao; Goto, Ken; Higashiwaki, Masataka; Schubert, Mathias

2018-01-01

The isotropic average conduction band minimum electron effective mass in Sn-doped monoclinic single crystal β-Ga2O3 is experimentally determined by the mid-infrared optical Hall effect to be (0.284 ± 0.013)m0 combining investigations on (010) and ( 2 ¯01 ) surface cuts. This result falls within the broad range of values predicted by theoretical calculations for undoped β-Ga2O3. The result is also comparable to recent density functional calculations using the Gaussian-attenuation-Perdew-Burke-Ernzerhof hybrid density functional, which predict an average effective mass of 0.267m0. Within our uncertainty limits, we detect no anisotropy for the electron effective mass, which is consistent with most previous theoretical calculations. We discuss upper limits for possible anisotropy of the electron effective mass parameter from our experimental uncertainty limits, and we compare our findings with recent theoretical results.

Crystallization and diffraction analysis of thioredoxin reductase from Streptomyces coelicolor

Czech Academy of Sciences Publication Activity Database

Koháryová, M.; Brynda, Jiří; Řezáčová, Pavlína; Kollárová, M.

F67, č. 8 (2011), s. 917-921 ISSN 1744-3091 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50520514 Keywords : flavoenzymes * potential antibiotic target * crystallization Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.506, year: 2011

New crystal-chemical data for marécottite

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Škoda, R.

2015-01-01

Roč. 79, č. 3 (2015), s. 649-660 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : marécottite * uranyl sulfate * zippeite group * crystal structure * chemical composition * hydrogen bonds. Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2015

EVALUASI KEPUASAN PELANGGAN PADA JASA PERPUSTAKAAN DAN ISSN PDII-LIPI

Directory of Open Access Journals (Sweden)

Wahid Nashihuddin

2016-03-01

Full Text Available The purposes of this study are: (a determine the level of customer satisfaction in library and ISSN services; (b determine customers feedback in improving the quality of library and ISSN services. Type of data this study is quantitative. Data were collected by distributing Survei Kepuasan Masyarakat (SKM questionnaires. There are nine indicators in SKM: (1 compliance with the service requirements; (2 easy of servicing procedures; (3 the timeliness of service; (4 the suitability of the service charge; (5 product assurance services; (6 the competence of service personnel; (7 the behavior of the service personnel; (8 clear intimation of service; and (9 the handling of complaints, suggestions, and feedback of services. SKM questionnaire distributed to 60 respondents who have received services from the concierge of library and ISSN service. The data are interpreted with a frequency distribution table. Each indicator item in SKM has processed by the value/score of the class interval system. Results of this study indicated that the information service on library and ISSN are satisfactory of customer. The results based on customer survey uses nine indicators of SKM. Most respondents who become customers of the library and ISSN feel satisfied, the number of 43 respondents (71,7% said they were satisfied and 11 respondents (18,3% expressed great satisfaction with the services. If viewed from the service unit, there are 25 respondents (83,33% as a subscribers of library services and 18 respondents (60% as a ISSN customers whose are satisfied with the those services. However, despite on the results of SKM had been satisfaction, the institution must be to improve the quality system of services ongoing basis. This is done to reduce or eliminate various forms of complaints from customers.

Crystallization processes in Ge2Sb2Se4Te glass

Czech Academy of Sciences Publication Activity Database

Svoboda, R.; Bezdička, Petr; Gutwirth, J.; Malek, J.

2015-01-01

Roč. 61, JAN (2015), s. 207-214 ISSN 0025-5408 Institutional support: RVO:61388980 Keywords : Chalcogenides * Glass es * Differential scanning calorimetry (DSC) * X-ray diffraction * Crystal structure Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015

Differences in crystallization of two LinB variants from Sphingobium japonicum UT26

Czech Academy of Sciences Publication Activity Database

Degtjarik, O.; Chaloupková, R.; Řezáčová, Pavlína; Kutý, M.; Damborský, J.; Smatanová, I.K.

2013-01-01

Roč. 69, č. 3 (2013), s. 284-287 ISSN 1744-3091 Institutional support: RVO:68378050 Keywords : protein crystallization * dehalogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.568, year: 2013

Nonlinear absorption of fullerene- and nanotubes-doped liquid crystal systems

Czech Academy of Sciences Publication Activity Database

Kamanina, N.; Reshak, Ali H; Vasiliev, P.Y.; Vangonen, A. I.; Studeonov, V. I.; Usanov, Y. E.; Ebothe, J.; Gondek, E.; Wojcik, W.; Danel, A.

2009-01-01

Roč. 41, č. 3 (2009), s. 391-394 ISSN 1386-9477 Institutional research plan: CEZ:AV0Z60870520 Keywords : nonlinear absorption properties * organic electrooptical systems * liquid crystal * fullerene s * nanotubes * PVK-derivatives Subject RIV: BO - Biophysics Impact factor: 1.177, year: 2009

Synthesis and crystal structure of tischendorfite, Pd8Hg3Se9

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, J.; Navrátil, Jiří; Drahokoupil, Jan

2014-01-01

Roč. 26, č. 1 (2014), s. 157-162 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : tischendorfite * crystal structure * Pd-Hg selenides Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.483, year: 2014

Double minimum creep of single crystal Ni-base superalloys

Czech Academy of Sciences Publication Activity Database

WU, X.; Wollgramm, P.; Somsen, C.; Dlouhý, Antonín; Kostka, A.; Eggeler, G.

2016-01-01

Roč. 112, JUN (2016), s. 242-260 ISSN 1359-6454 R&D Projects: GA ČR(CZ) GA14-22834S Institutional support: RVO:68081723 Keywords : Single crystal Ni-base superalloys * Primary creep * Transmission electron microscopy * Dislocations * Stacking faults Subject RIV: JG - Metallurgy Impact factor: 5.301, year: 2016

Analysis of biomarkers in a Czech population exposed to heavy air pollution. Part II. Chromosomal aberrations and oxidative stress

Czech Academy of Sciences Publication Activity Database

Rössner ml., Pavel; Rössnerová, Andrea; Špátová, Milada; Beskid, Olena; Uhlířová, Kateřina; Líbalová, Helena; Solanský, I.; Topinka, Jan; Šrám, Radim

2013-01-01

Roč. 28, č. 1 (2013), s. 97-106 ISSN 0267-8357 R&D Projects: GA MŽP(CZ) SP/1B3/8/08; GA MŠk 2B08005; GA ČR GAP503/11/0084 Institutional research plan: CEZ:AV0Z50390703 Institutional support: RVO:68378041 Keywords : air pollution * benzo[a]pyrene * benzene Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 3.497, year: 2013

MicroRNA-binding site polymorphisms in genes involved in colorectal cancer etiopathogenesis and their impact on disease prognosis

Czech Academy of Sciences Publication Activity Database

Schneiderová, B.; Naccarati, Alessio; Pardini, Barbara; Rosa, F.; Di Gaetano, C.; Jirásková, Kateřina; Opattová, Alena; Levý, M.; Veskrna, K.; Veškrnová, V.; Buchler, T.; Landi, S.; Vodička, Pavel; Vymetálková, Veronika

2017-01-01

Roč. 32, č. 5 (2017), s. 533-542 ISSN 0267-8357 R&D Projects: GA MZd(CZ) NV15-26535A; GA MŠk(CZ) LD14050; GA MZd(CZ) NV15-27580A; GA ČR(CZ) GA17-16857S Institutional support: RVO:68378041 Keywords : excision-repair genes * bladder- cancer * tumor-growth Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 2.507, year: 2016

Crystal structure of the uranyl-oxide mineral rameauite

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Škoda, R.; Čejka, J.; Bourgoin, V.; Boulliard, J.C.

2016-01-01

Roč. 28, č. 5 (2016), s. 959-967 ISSN 0935-1221 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : rameauite * uranyl-oxide hydroxy-hydrate * crystal structure * Raman spectrum Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.362, year: 2016

Nanodomains and nanometer-scale disorder in multiferroic bismuth ferrite single crystals

Czech Academy of Sciences Publication Activity Database

Jia, C.L.; Jin, L.; Wang, D.; Mi, S.B.; Alexe, M.; Hesse, D.; Reichlová, Helena; Martí, Xavier; Bellaiche, L.; Urban, K.W.

2015-01-01

Roč. 82, Jan (2015), s. 356-368 ISSN 1359-6454 Institutional support: RVO:68378271 Keywords : bismuth ferrite * crystal growth * high-resolution electron microscopy * atomic structure * first-principles calculations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.058, year: 2015

Crystal field and magnetism with Wannier functions: Orthorhombic rare-earth manganites

Czech Academy of Sciences Publication Activity Database

Novák, Pavel; Nekvasil, Vladimír; Knížek, Karel

358-359, MAY (2014), s. 228-232 ISSN 0304-8853 R&D Projects: GA ČR GA13-25251S Institutional support: RVO:68378271 Keywords : crystal field * rare- earth magnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.970, year: 2014

The crystal structure of Pd.sub.3./sub.HgTe.sub.3./sub., the synthetic analogue of temagamite

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, M.; Dušek, Michal; Navrátil, Jiří; Černošková, E.

2016-01-01

Roč. 28, č. 4 (2016), s. 825-834 ISSN 0935-1221 Institutional support: RVO:68378271 ; RVO:61389013 Keywords : temagamite * crystal structure * crystal-structure solution * Pd-Hg telluride Subject RIV: BM - Solid Matter Physics ; Magnetism; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 1.362, year: 2016

Crystal field effect in YbMnO.sub.3./sub..

Czech Academy of Sciences Publication Activity Database

Diviš, M.; Hölsä, J.; Lastusaari, M.; Litvinchuk, A. P.; Nekvasil, Vladimír

2008-01-01

Roč. 451, 1-2 (2008), s. 662-665 ISSN 0925-8388 R&D Projects: GA AV ČR IAA100100627 Institutional research plan: CEZ:AV0Z10100521 Keywords : ytterbium * manganites * IR spectroscopy * crystal field Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.510, year: 2008

Magnetic properties of a hydrogenation-extracted UCoSn single crystal

Czech Academy of Sciences Publication Activity Database

Kolomiets, A.; Andreev, Alexander V.; Havela, L.

2009-01-01

Roč. 471, 1-2 (2009), s. 21-23 ISSN 0925-8388 R&D Projects: GA MŠk OC 144 Institutional research plan: CEZ:AV0Z10100520 Keywords : uranium intermetallics * single crystal * ferromagnetism * hydrides Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.135, year: 2009

Alloy hardening of a smectic A liquid crystal doped with gold nanoparticles

Czech Academy of Sciences Publication Activity Database

Oswald, P.; Milette, J.; Relaix, S.; Reven, L.; Dequidt, A.; Lejček, Lubor

2013-01-01

Roč. 103, AUG (2013), "46004-p1"-"46004-p6" ISSN 0295-5075 Institutional support: RVO:68378271 Keywords : smectic A liquid crystals * gold nanoparticles * edge dislocation * precipitation hardening Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013

Crystal structure and transport properties of Pd5HgSe

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, M.; Navrátil, Jiří; Plecháček, T.; Drahokoupil, Jan

2012-01-01

Roč. 14, č. 10 (2012), s. 1476-1479 ISSN 1293-2558 R&D Projects: GA ČR GAP108/10/1315 Institutional support: RVO:61389013 ; RVO:68378271 Keywords : Pd5HgSe * Pd-Hg-Se system * crystal structure Subject RIV: CA - Inorganic Chemistry Impact factor: 1.671, year: 2012

Characterization and crystal structures of new Schiff base macrocyclic compounds

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Ghoran, S.H.; Pojarová, Michaela; Dušek, Michal

2015-01-01

Roč. 56, č. 7 (2015), s. 1410-1414 ISSN 0022-4766 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : synthesis * macrocyclic Schiff base * single crystal structure analysis * spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015

Crystal field and magnetism with Wannier functions: rare-earth dopedaluminum garnets

Czech Academy of Sciences Publication Activity Database

Mihóková, Eva; Novák, Pavel; Laguta, Valentyn

2015-01-01

Roč. 33, č. 12 (2015), 1316-1323 ISSN 1002-0721 R&D Projects: GA ČR GA13-09876S Institutional support: RVO:68378271 Keywords : crystal field * ab initio calculations * garnets * rare earths Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.188, year: 2015

Luminescence-induced noise in single photon sources based on BBO crystals

Czech Academy of Sciences Publication Activity Database

Machulka, R.; Lemr, Karel; Haderka, Ondřej; Lamperti, M.; Allevi, A.; Bondani, M.

2014-01-01

Roč. 47, č. 21 (2014), s. 215501 ISSN 0953-4075 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : luminescence * BBO crystal * photon source * noise * streak camera Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.975, year: 2014

On a hyperbolic system arising in liquid crystals modeling

Czech Academy of Sciences Publication Activity Database

Feireisl, Eduard; Rocca, E.; Schimperna, G.; Zarnescu, A.

2018-01-01

Roč. 15, č. 1 (2018), s. 15-35 ISSN 0219-8916 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : dissipative solution * liquid crystal * weak-strong uniqueness Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.940, year: 2016 https://www.worldscientific.com/doi/abs/10.1142/S0219891618500029

The crystal structure of the phosphatidylinositol 4-kinase IIalpha

Czech Academy of Sciences Publication Activity Database

Bäumlová, Adriana; Chalupská, Dominika; Rozycki, B.; Jovic, M.; Wisniewski, E.; Klíma, Martin; Dubánková, Anna; Kloer, D. P.; Nencka, Radim; Balla, T.; Bouřa, Evžen

2015-01-01

Roč. 22, č. 1 (2015), s. 5 ISSN 1211-5894. [Discussions in Structural Molecular Biology. Annual Meeting of the Czech Society for Structural Biology /13./. 19.03.2015-21.03.2015, Nové Hrady] EU Projects: European Commission(XE) 333916 - STARPI4K Institutional support: RVO:61388963 Keywords : PI4K IIalpha * crystal structure Subject RIV: CE - Biochemistry

On asymptotic isotropy for a hydrodynamic model of liquid crystals

Czech Academy of Sciences Publication Activity Database

Dai, M.; Feireisl, Eduard; Rocca, E.; Schimperna, G.; Schonbek, M.E.

2016-01-01

Roč. 97, 3-4 (2016), s. 189-210 ISSN 0921-7134 Grant - others:European Research Council(XE) MATHEF(320078) Institutional support: RVO:67985840 Keywords : liquid crystal * Q-tensor description * long-time behavior Subject RIV: BA - General Mathematics Impact factor: 0.933, year: 2016 http://content.iospress.com/articles/asymptotic-analysis/asy1348

On asymptotic isotropy for a hydrodynamic model of liquid crystals

Czech Academy of Sciences Publication Activity Database

Dai, M.; Feireisl, Eduard; Rocca, E.; Schimperna, G.; Schonbek, M.E.

2016-01-01

Roč. 97, 3-4 (2016), s. 189-210 ISSN 0921-7134 Grant - others:European Research Council(XE) MATHEF(320078) Institutional support: RVO:67985840 Keywords : liquid crystal * Q-tensor description * long-time behavior Subject RIV: BA - General Mathematics Impact factor: 0.933, year: 2016 http://content.iospress.com/articles/asymptotic- analysis /asy1348

Deuteron NMR resolved mesogen vs. crosslinker molecular order and reorientational exchange in liquid single crystal elastomers

Czech Academy of Sciences Publication Activity Database

Milavec, J.; Domenici, V.; Zupančič, B.; Rešetič, A.; Bubnov, Alexej; Zalar, B.

2016-01-01

Roč. 18, č. 5 (2016), s. 4071-4077 ISSN 1463-9076 R&D Projects: GA ČR GA15-02843S; GA MŠk(CZ) LD14007 Grant - others:EU - ICT(XE) COST Action IC1208 Institutional support: RVO:68378271 Keywords : liquid single crystal elastomer * NMR * liquid crystal * molecular order * monomers Subject RIV: JJ - Other Materials Impact factor: 4.123, year: 2016

Detection of low concentration of malachite green and crystal violet in water

Czech Academy of Sciences Publication Activity Database

Šafařík, Ivo; Šafaříková, Miroslava

2002-01-01

Roč. 36, - (2002), s. 196-200 ISSN 0043-1354 R&D Projects: GA ČR GA203/98/1145 Institutional research plan: CEZ:AV0Z6087904 Keywords : magnetic particles * crystal violet Subject RIV: EH - Ecology, Behaviour Impact factor: 1.611, year: 2002

H-1 NMR relaxometric study of molecular dynamics in a "de Vries" liquid crystal

Czech Academy of Sciences Publication Activity Database

Gradišek, A.; Domenici, V.; Apih, T.; Novotná, Vladimíra; Sebastiao, P.J.

2016-01-01

Roč. 120, č. 20 (2016), s. 4706-4714 ISSN 1520-6106 Grant - others:AVČR(CZ) M100101204 Institutional support: RVO:68378271 Keywords : liquid crystals Subject RIV: JJ - Other Materials Impact factor: 3.177, year: 2016

INTRAMOLECULAR ALKOXIDE-TETHERED PERMETHYLTITANOCENE(III) COMPLEXES - SYNTHESIS AND CRYSTAL STRUCTURE

Czech Academy of Sciences Publication Activity Database

Varga, V.; Císařová, I.; Horáček, Michal; Pinkas, Jiří; Kubišta, Jiří; Mach, Karel

2009-01-01

Roč. 74, č. 3 (2009), s. 453-468 ISSN 0010-0765 R&D Projects: GA MPO FT-TA3/078; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40400503 Keywords : titanocene * Permethyltitanocene * crystal structure Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.856, year: 2009

High-temperature and low-stress creep anisotropy of single-crystal superalloys

Czech Academy of Sciences Publication Activity Database

Jacome, L. A.; Nortershauser, P.; Heyer, J. K.; Lahni, A.; Frenzel, J.; Dlouhý, Antonín; Somsen, C.; Eggeler, G.

2013-01-01

Roč. 61, č. 8 (2013), s. 2926-2943 ISSN 1359-6454 R&D Projects: GA ČR(CZ) GA202/09/2073 Institutional support: RVO:68081723 Keywords : superalloy single crystals * creep anisotropy * rafting * dislocations * deformation mechanisms Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.940, year: 2013

Fine structures of wing scales in Sasakia charonda butterflies as photonic crystals

Czech Academy of Sciences Publication Activity Database

Matějková, Jiřina; Shiojiri, S.; Shiojiri, M.

2009-01-01

Roč. 236, č. 2 (2009), s. 88-93 ISSN 0022-2720 Institutional research plan: CEZ:AV0Z20650511 Keywords : Butterfly * field-emission scanning electron microscopy * photonic crystal * Sasakia charonda * wing scale Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.612, year: 2009

Luminescent properties of Cr-doped gallium garnet crystals grown by the micro-pulling-down method

Czech Academy of Sciences Publication Activity Database

Kurosawa, S.; Suzuki, A.; Yamaji, A.; Kamada, K.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Chani, V.I.; Yoshikawa, A.

2016-01-01

Roč. 452, Oct (2016), s. 95-100 ISSN 0022-0248. [American Conference on Crystal Growth and Epitaxy /20./ (ACCGE) / 17th Biennial Workshop on Organometallic Vapor Phase Epitaxy (OMVPE) / 2nd 2D Electronic Materials Symposium. Big Sky, MT, 02.08.2015-07.08.2015] Institutional support: RVO:68378271 Keywords : scintillator materials * single crystal growth * gallium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.751, year: 2016

Fast one-dimensional photonic crystal modulators for the terahertz range

Czech Academy of Sciences Publication Activity Database

Fekete, Ladislav; Kadlec, Filip; Němec, Hynek; Kužel, Petr

2007-01-01

Roč. 15, č. 14 (2007), s. 8898-8912 ISSN 1094-4087 R&D Projects: GA AV ČR KJB100100512; GA MŠk LC512 Institutional research plan: CEZ:AV0Z10100520 Keywords : optical control * terahertz * modulator * GaAs * photonic crystal * photoconductivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.709, year: 2007

Diffractive-refractive optics: (+,-,-,+) X-ray crystal monochromator with harmonics separation

Czech Academy of Sciences Publication Activity Database

Hrdý, Jaromír; Mikulík, P.; Oberta, Peter

2011-01-01

Roč. 18, č. 2 (2011), s. 299-301 ISSN 0909-0495 R&D Projects: GA MPO FR-TI1/412 Institutional research plan: CEZ:AV0Z10100522 Keywords : diffractive-refractive optics * x-ray synchrotron radiation monochromator * x-ray crystal monochromator * harmonics separation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.726, year: 2011

New banana-type liquid crystal with a methoxy group substituted near the central ring

Czech Academy of Sciences Publication Activity Database

Kašpar, Miroslav; Hamplová, Věra; Novotná, Vladimíra; Glogarová, Milada; Vaněk, Přemysl

2002-01-01

Roč. 12, - (2002), s. 2221-2224 ISSN 0959-9428 Institutional research plan: CEZ:AV0Z1010914 Keywords : bent-shaped liquid crystal * nm-chiral * B 2 phase Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.683, year: 2002

Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals

Czech Academy of Sciences Publication Activity Database

Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.

2004-01-01

Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004

Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

Czech Academy of Sciences Publication Activity Database

Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

2012-01-01

Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

Transition between metamaterial and photonic-crystal behavior in arrays of dielectric rods

Czech Academy of Sciences Publication Activity Database

Dominec, Filip; Kadlec, Christelle; Němec, Hynek; Kužel, Petr; Kadlec, Filip

2014-01-01

Roč. 22, č. 25 (2014), s. 30492-30503 ISSN 1094-4087 R&D Projects: GA ČR(CZ) GA14-25639S Institutional support: RVO:68378271 Keywords : metamaterials * photonic crystals * negative refractive index * dielectrics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.488, year: 2014

Crystal structure determination from powder diffraction data of the coumarin vanillin chalcone

Czech Academy of Sciences Publication Activity Database

Ghouili, A.; Rohlíček, Jan; Ayed, T.B.; Hassen, R.B.

2014-01-01

Roč. 29, č. 4 (2014), s. 361-365 ISSN 0885-7156 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : chalcone * absorption spectra * powder diffraction * crystal structure determination * coumarin derivatives Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.636, year: 2014

Synthesis, characterization, crystal structures, QSAR study and antibacterial activities of organotin bisphosphoramidates

Czech Academy of Sciences Publication Activity Database

Gholivand, K.; Valmoozi, A.A.E.; Gholami, A.; Dušek, Michal; Eigner, Václav; Abolghasemi, S.

2016-01-01

Roč. 806, Mar (2016), s. 33-44 ISSN 0022-328X R&D Projects: GA ČR GA15-12653S Institutional support: RVO:68378271 Keywords : bisphosphoramidate * organotin compounds * crystal structure * antibacterial activity * QSAR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.184, year: 2016

Interaction of phonons with intraband electronic excitations and crystal field transitions in Raman spectra of (Nd,Eu,Gd)Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. crystals

Czech Academy of Sciences Publication Activity Database

Rameš, Michal; Železný, Vladimír; Gregora, Ivan; Wolf, T.; Jirsa, Miloš

2015-01-01

Roč. 197, Jul (2015), 10-17 ISSN 0921-5107 R&D Projects: GA MŠk(CZ) ME10069 Institutional support: RVO:68378271 Keywords : cuprate superconductors * phonons * crystal field * vortex pinning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.331, year: 2015

Neutron diffraction studies of a double-crystal ( plus n,-m) setting containing a fully asymmetric diffraction geometry (FAD) of a bent perfect crystal (BPC)

Czech Academy of Sciences Publication Activity Database

Mikula, Pavol; Vrána, Miroslav; Šaroun, Jan; Em, V.

2017-01-01

Roč. 32, Supl-1 (2017), s. 13-18 ISSN 0885-7156 R&D Projects: GA ČR GC16-08803J; GA MŠk LM2015048 Institutional support: RVO:61389005 Keywords : neutron diffraction * monochromator * bent perfect crystal Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.674, year: 2016

A macroscopic model for magnetic shape-memory single crystals

Czech Academy of Sciences Publication Activity Database

Bessoud, A. L.; Kružík, Martin; Stefanelli, U.

2013-01-01

Roč. 64, č. 2 (2013), s. 343-359 ISSN 0044-2275 R&D Projects: GA AV ČR IAA100750802; GA ČR GAP201/10/0357 Institutional support: RVO:67985556 Keywords : magnetostriction * evolution Subject RIV: BA - General Mathematics Impact factor: 1.214, year: 2013 http://library.utia.cas.cz/separaty/2012/MTR/kruzik-a macroscopic model for magnetic shape- memory single crystals.pdf

A simple method of evaluating non-isothermal crystallization kinetics in multicomponent polymer systems

Czech Academy of Sciences Publication Activity Database

Kratochvíl, Jaroslav; Kelnar, Ivan

2015-01-01

Roč. 47, October (2015), s. 79-86 ISSN 0142-9418 R&D Projects: GA ČR(CZ) GA13-15255S Institutional support: RVO:61389013 Keywords : non-isothermal crystallization kinetics * cumulative curves * inflection point Subject RIV: JI - Composite Materials Impact factor: 2.350, year: 2015

CrystalCMP: an easy-to-use tool for fast comparison of molecular packing

Czech Academy of Sciences Publication Activity Database

Rohlíček, Jan; Skořepová, E.; Babor, M.; Čejka, J.

2016-01-01

Roč. 49, č. 6 (2016), s. 2172-2183 ISSN 0021-8898 R&D Projects: GA ČR GA16-10035S Institutional support: RVO:68378271 Keywords : comparison * similarity packing * crystal structure * computer programs Subject RIV: JC - Computer Hardware ; Software Impact factor: 3.720, year: 2014

Broadband infrared detectors on the basis of PATGS/Pt(IV) single crystals

Czech Academy of Sciences Publication Activity Database

Novotný, Jan; Zelinka, Jiří; Moravec, František

2005-01-01

Roč. 119, č. 2 (2005), s. 300-304 ISSN 0924-4247 R&D Projects: GA MŠk(CZ) 1P04OCD14.40 Institutional research plan: CEZ:AV0Z20670512 Keywords : crystal growth * ferroelectric materials * sensors Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.363, year: 2005

Ledges and grooves at γ/γ′ interfaces of single crystal superalloys

Czech Academy of Sciences Publication Activity Database

Parsa, A. B.; Wollgramm, P.; Buck, H.; Kostka, A.; Somsen, C.; Dlouhý, Antonín; Eggeler, G.

2015-01-01

Roč. 90, MAY (2015), s. 105-117 ISSN 1359-6454 R&D Projects: GA ČR(CZ) GA14-22834S Institutional support: RVO:68081723 Keywords : Ni-base single crystal superalloys * γ/γ′ interfaces * Interface dislocations * Rafting * Grooves Subject RIV: JG - Metallurgy Impact factor: 5.058, year: 2015

Crystal structure of the (REE)-uranyl carbonate mineral kamotoite-(Y)

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Petříček, Václav

2017-01-01

Roč. 81, č. 3 (2017), s. 653-660 ISSN 0026-461X R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : kamotoite-(Y) * uranyl carbonate * rare-earth elements * crystal structure Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.285, year: 2016

Crystal chemistry, Mössbauer spectroscopy, and thermodynamic properties of botryogen

Czech Academy of Sciences Publication Activity Database

Majzlan, J.; Plášil, Jakub; Dachs, E.; Benisek, A.; Bender Koch, CH.

2016-01-01

Roč. 193, č. 2 (2016), s. 147-159 ISSN 0077-7757 R&D Projects: GA MŠk LO1603 Grant - others:EU(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : botryogen * crystal-structure refinement * H atoms * Mössbauer spectroscopy * thermodynamics * acid - mine drainage Subject RIV: DB - Geology ; Mine ralogy Impact factor: 0.811, year: 2016

Lithium ions in the van der Waals gap of Bi2Se3 single crystals

Czech Academy of Sciences Publication Activity Database

Bludská, Jana; Jakubec, Ivo; Karamazov, S.; Horák, Jaromír; Uher, C.

2010-01-01

Roč. 183, č. 12 (2010), s. 2813-2817 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z40320502 Keywords : intercalation * van Der Waals gap * Bi2Se3 crystals Subject RIV: CG - Electrochemistry Impact factor: 2.261, year: 2010

Electro-optic and thermo-optic and properties of phase separated polymer dispersed liquid crystal films

Czech Academy of Sciences Publication Activity Database

Malik, P.; Bubnov, Alexej M.; Raina, K.K.

2008-01-01

Roč. 494, č. 12 (2008), s. 242-251 ISSN 1542-1406 Institutional research plan: CEZ:AV0Z10100520 Keywords : polymer dispersed liquid crystals * electro-optics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.537, year: 2008

Nonisothermal nematic liquid crystal flows with the Ball-Majumdar free energy

Czech Academy of Sciences Publication Activity Database

Feireisl, Eduard; Schimperna, G.; Rocca, E.; Zarnescu, A.

2015-01-01

Roč. 194, č. 5 (2015), s. 1269-1299 ISSN 0373-3114 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : nematic liquid crystal * Ball-Majumdar free theory * nonisothermal model * existence theorem Subject RIV: BA - General Mathematics Impact factor: 0.861, year: 2015 http://link.springer.com/article/10.1007%2Fs10231-014-0419-1

A new approach to non-isothermal models for nematic liquid crystals

Czech Academy of Sciences Publication Activity Database

Feireisl, Eduard; Frémond, M.; Rocca, E.; Schimperna, G.

2012-01-01

Roč. 205, č. 2 (2012), s. 651-672 ISSN 0003-9527 R&D Projects: GA ČR GA201/09/0917 Institutional research plan: CEZ:AV0Z10190503 Keywords : liquid crystals * non-isothermal model * flows Subject RIV: BA - General Mathematics Impact factor: 2.292, year: 2012 http://www.springerlink.com/content/cl205h73077jr810/

Martensitic transformations of Cu-Al-Ni single crystals in tension/compresion

Czech Academy of Sciences Publication Activity Database

Novák, Václav; Šittner, Petr; VanHumbeeck, J.

2001-01-01

Roč. 11, - (2001), s. Pr8-191 - Pr8-196 ISSN 1155-4339 R&D Projects: GA AV ČR IAA1010909; GA MŠk ME 186 Institutional research plan: CEZ:AV0Z1010914 Keywords : shape memory alloy * single crystal modelling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.401, year: 2001

Xenon NMR of liquid crystals confined to cylindrical nanocavities: a simulation study

Czech Academy of Sciences Publication Activity Database

Karjalainen, J.; Vaara, J.; Straka, Michal; Lantto, P.

2015-01-01

Roč. 17, č. 11 (2015), s. 7158-7171 ISSN 1463-9076 R&D Projects: GA ČR(CZ) GA14-03564S Institutional support: RVO:61388963 Keywords : 129Xe NMR * liquid crystals * cylindrical cavities * phase transition s * Monte-Carlo simulations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.449, year: 2015

EPR study of charge compensation of chromium centers in the strontium titanate crystal

Czech Academy of Sciences Publication Activity Database

Badalyan, A. G.; Azamat, Dmitry; Babunts, R.A.; Neverova, E.V.; Dejneka, Alexandr; Trepakov, Vladimír; Jastrabík, Lubomír

2013-01-01

Roč. 55, č. 7 (2013), 1454-1458 ISSN 1063-7834 R&D Projects: GA ČR GAP108/12/1941 Institutional support: RVO:68378271 Keywords : EPR spectroscopy * SrTiO3:Cr crystal * chromium centers Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.782, year: 2013

Crystallization Kinetics of Nanocrystalline Materials by Combined X-ray Diffraction and Differential Scanning Calorimetry Experiments

Czech Academy of Sciences Publication Activity Database

Gil-González, E.; Perejón, A.; Sánchez-Jiménez, P. E.; Medina-Carrasco, S.; Kupčík, Jaroslav; Šubrt, Jan; Criado, J. M.; Pérez-Maqueda, L. A.

2018-01-01

Roč. 18, č. 5 (2018), s. 3107-3116 ISSN 1528-7483 Institutional support: RVO:61388980 Keywords : nanocrysalline alloys * combined X ray diffraction * crystallization kinetics Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.055, year: 2016

Crystal structure of the Copper(I) complex Cu(py-Clan)(PPh.sub.3./sub.)I

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Jafari, K.; Fejfarová, Karla; Dušek, Michal

2015-01-01

Roč. 56, č. 1 (2015), s. 175-178 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : copper(I) complex * Schiff base * crystal structure Subject RIV: CC - Organic Chemistry Impact factor: 0.536, year: 2015

Synthesis, characterization and crystal structure of N,N'-Bis(2,3-Dimethoxybenzylidene)-1,2-Diaminoethane

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Fejfarová, Karla; Dušek, Michal; Bijanzadeh, H.R.

2011-01-01

Roč. 41, č. 12 (2011), 1955-1960 ISSN 1074-1542 Institutional research plan: CEZ:AV0Z10100521 Keywords : Shiff bases * X-ray diffraction * Jana2006 * crystal structure * characterization Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.566, year: 2011

The nature of hydrogen bonding in R-2(2)(8) crystal motifs - a computational exploration

Czech Academy of Sciences Publication Activity Database

Deepa, Palanisamy; Solomon, R. V.; Vedha, S. A.; Kolandaivel, P.; Venuvanalingam, P.

2014-01-01

Roč. 112, č. 24 (2014), s. 3195-3205 ISSN 0026-8976 Institutional support: RVO:61388963 Keywords : NCI plot * hydrogen bonds * R-2(2)(8) motif * organic crystals * NBO * QTAIM analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.720, year: 2014

E-T phase diagram of an antiferroelectric liquid crystal with re-entrand smectic C* phase

Czech Academy of Sciences Publication Activity Database

Na, Y.-H.; Naruse, Y.; Fukuda, N.; Orihara, H.; Fajar, A.; Hamplová, Věra; Kašpar, Miroslav; Glogarová, Milada

2008-01-01

Roč. 364, č. 1 (2008), s. 13-19 ISSN 0015-0193 Institutional research plan: CEZ:AV0Z10100520 Keywords : phase diagram * liquid crystals * dielectric measurements * electric field Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.562, year: 2008

Crystallization of the novel flavodoxine-like protein, WrbA, - on the way to three-dimensional structure

Czech Academy of Sciences Publication Activity Database

Kutá-Smatanová, Ivana; Wolfová, J.; Grandori, R.; Chatterjee, N.; Carey, J.

2004-01-01

Roč. 54, č. 2004 (2004), s. 35 ISSN 1210-8529. [European Crystallographic Meeting /22./. Budapešť, 26.08.2004-31.08.2004] R&D Projects: GA MŠk ME 640; GA MŠk LN00A141 Grant - others:GA ÚV1 INT-03-09049 Keywords : flavodoxine-like protein, tryprophan-repressor binding protein, WrbA apoprotein, WrbA holoprotein, FMN, standard crystallization techniques, advanced crystallization techniques Subject RIV: BO - Biophysics

Characterization of external refractive index sensitivity of a photonic crystal fiber long-period grating

Czech Academy of Sciences Publication Activity Database

Tian, F.; Kaňka, Jiří; Du, H.

2015-01-01

Roč. 13, č. 7 (2015), s. 0705011-0705013 ISSN 1671-7694 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Carbon dioxide lasers * Crystal whiskers * Optical fiber fabrication Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.899, year: 2015

Photonic crystal fiber for layer-by-layer assembly and measurements of polyelectrolyte thin films

Czech Academy of Sciences Publication Activity Database

Tian, F.; Kaňka, Jiří; Sukhishvili, S.; Du, H.

2012-01-01

Roč. 37, č. 20 (2012), s. 4299-4301 ISSN 0146-9592 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Photonic crystal fiber * Long-period grating * Optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.385, year: 2012

Synthesis, characterization and crystal structures of new organic compounds containing cyanoacrylic acid

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Mogheiseh, M.; Eigner, Václav; Dušek, Michal; Chow, T.J.; Maddahi, E.

2015-01-01

Roč. 1098, Oct (2015), s. 318-323 ISSN 0022-2860 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : organic compounds * cyanoacrylic acid * single-crystal structure analysis * dye-sensitized solar cells * density functional theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.780, year: 2015

Recent R&D trends in inorganic single crystal scintillator materials for radiation detection

Czech Academy of Sciences Publication Activity Database

Nikl, Martin; Yoshikawa, A.

2015-01-01

Roč. 3, č. 4 (2015), s. 463-481 ISSN 2195-1071 R&D Projects: GA MŠk(CZ) LH14266; GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : scintillator * single crystal * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.359, year: 2015

Refikite from Krásno, Czech Republic: a crystal- and molecular-structure study

Czech Academy of Sciences Publication Activity Database

Pažout, R.; Sejkora, J.; Maixner, J.; Dušek, Michal; Tvrdý, J.

2015-01-01

Roč. 79, č. 1 (2015), s. 59-70 ISSN 0026-461X Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : refikite * crystal structure * infrared spectroscopy * Raman spectroscopy * NMR * high-resolution mass spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2015

Direct measure of the tilt angle in “de Vries type” liquid crystals through NMR spectroscopy

Czech Academy of Sciences Publication Activity Database

Marchetti, A.; Domenici, V.; Novotná, Vladimíra; Lelli, M.; Cifelli, M.; Lesage, A.; Veracini, C.A.

2010-01-01

Roč. 11, č. 8 (2010), s. 1641-1645 ISSN 1439-4235 Institutional research plan: CEZ:AV0Z1010920 Keywords : liquid crystals * ferroelectricity * de Vries behaviour Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.339, year: 2010

In-situ temperature field measurements and direct observation of crystal/melt at vertical Bridgman growth of lead chloride under stationary and dynamic arrangement

Czech Academy of Sciences Publication Activity Database

Král, Robert; Nitsch, Karel

2015-01-01

Roč. 427, Oct (2015), 7-15 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : single crystal growth * temperature field measurements * crystal/melt interface * lead chloride * vertical Bridgman method Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.462, year: 2015

Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

Czech Academy of Sciences Publication Activity Database

Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

2014-01-01

Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

Crystal structure of the (REE)–uranyl carbonate mineral shabaite-(Nd)

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Škoda, R.

2017-01-01

Roč. 62, č. 2 (2017), s. 97-105 ISSN 1802-6222 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : shabaite-(Nd) * uranyl carbonate * rare-earth elements * crystal structure * mineral evolution Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016

Crystal field parameters with Wannier functions: application to rare-earth aluminates

Czech Academy of Sciences Publication Activity Database

Novák, Pavel; Knížek, Karel; Kuneš, Jan

2013-01-01

Roč. 87, č. 20 (2013), "205139-1"-"205139-7" ISSN 1098-0121 R&D Projects: GA ČR(CZ) GAP204/11/0713 Institutional support: RVO:68378271 Keywords : crystal-field * rare earths * Wannier functions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.664, year: 2013 http://link.aps.org/doi/10.1103/PhysRevB.87.205139

Ultrasonic characterization of Cu-Al-Ni single crystals lattice stability in the vicinity of the phase transition

Czech Academy of Sciences Publication Activity Database

Landa, Michal; Sedlák, Petr; Novák, Václav; Šittner, Petr

2004-01-01

Roč. 42, č. 1 (2004), s. 519-526 ISSN 0041-624X Institutional research plan: CEZ:AV0Z2076919 Keywords : crystal acoustics * phase transitions * acoustoelasticity Subject RIV: JJ - Other Materials Impact factor: 1.175, year: 2004

Charge carrier transport in layers of discotic liquid crystals as studied by transient photocurrents

Czech Academy of Sciences Publication Activity Database

Rybak, A.; Pfleger, Jiří; Jung, J. Y.; Pavlík, Martin; Glowacki, I.; Ulanski, J.; Tomovic, Z.; Müllen, K.; Geerts, Y.

2006-01-01

Roč. 156, 2-4 (2006), s. 302-309 ISSN 0379-6779 Grant - others:NANOFUN-POLY(PL) 5709/R04/R05 Institutional research plan: CEZ:AV0Z40500505 Keywords : organic semiconductors * discotic liquid crystals * photoconductivity Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.685, year: 2006

Synthesis and crystal structure of tischendorfite, Pd.sub.8./sub.Hg.sub.3./sub.Se.sub.9./sub

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, M.; Navrátil, J.; Drahokoupil, Jan

2014-01-01

Roč. 26, č. 1 (2014), s. 157-162 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : tischendorfite * crystal structure * Pd-Hg selenides Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.483, year: 2014

Thermally induced crystallization of amorphous Fe40Ni40P14B6 alloy

Czech Academy of Sciences Publication Activity Database

Vasić, M.; Blagojević, V. A.; Begović, N. N.; Žák, Tomáš; Pavlović, V. B.; Minić, Dragica M.

2015-01-01

Roč. 614, AUG (2015), s. 129-136 ISSN 0040-6031 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Amorphous alloy * Crystallization * Kinetics * Deconvolution * Impingement * Surface morphology Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.938, year: 2015

Observation of multiple Bragg reflections of neutrons in bent perfect crystals

Czech Academy of Sciences Publication Activity Database

Mikula, Pavol; Vrána, Miroslav; Šaroun, Jan; Seong, B. S.; Moon, MK.

2011-01-01

Roč. 634, č. 1 (2011), S108-S111 ISSN 0168-9002. [International Workshop on Neutron Optics. Grenoble, 17.03.2010-19.03.2010] R&D Projects: GA ČR GAP204/10/0654 Institutional research plan: CEZ:AV0Z10480505 Keywords : Neutron diffraction * Bent perfect crystal * Multiple reflections Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.207, year: 2011

Properties of entangled proton pairs generated in periodically poled nonlinear crystals

Czech Academy of Sciences Publication Activity Database

Svozilík, Jiří; Peřina ml., Jan

2009-01-01

Roč. 80, č. 2 (2009), 023819/1-023819/9 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) OC09026; GA AV ČR IAA100100713; GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : photon pairs * nonlinear crystals * nonlinear optics * quantum optics Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.866, year: 2009

INFLUENCE OF RARE-EARTH ELEMENTS ON THE ELECTRICAL AND OPTICAL PROPERTIES OF INP BULK CRYSTALS

Czech Academy of Sciences Publication Activity Database

Yatskiv, Roman; Zavadil, Jiří; Pekárek, Ladislav

-, - (2011), s. 58-65 ISSN 1335-9053. [Development of Materials Science in Research and Education . Závažná Poruba, 31.08.2009-04.09.2009] Institutional research plan: CEZ:AV0Z20670512 Keywords : Crystal growth * REEs elements * Electrical properties Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

Nonlinear magnetoelectric effect in paraelectric state of Co4Nb2O9 single crystal

Czech Academy of Sciences Publication Activity Database

Cao, Ym.; Deng, Gc.; Beran, Přemysl; Feng, Zj.; Kang, Bj.; Zhang, Jc.; Guiblin, N.; Dkhil, B.; Ren, W.; Cao, Sx.

2017-01-01

Roč. 7, č. 10 (2017), č. článku 14079. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : magnetoelectric * single crystal * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

Crystal field parameters with Wannier functions: application to Nd.sub.2./sub.Fe.sub.14./sub.B systems

Czech Academy of Sciences Publication Activity Database

Yoshioka, T.; Tsuchiura, H.; Novák, Pavel

2015-01-01

Roč. 19, Sup.3 (2015), S4-S8 ISSN 1432-8917 Institutional support: RVO:68378271 Keywords : crystal field parameters * Nd-Fe-B permanent magnet Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.830, year: 2014

Toward the crystallization of photosystem II core complex from Pisum sativum L

Czech Academy of Sciences Publication Activity Database

Prudnikova, T.; Gavira, J. A.; Řezáčová, Pavlína; Molina, E.P.; Hunalová, Ivana; Sviridova, E.; Schmidt, V.; Kohoutová, J.; Kutý, Michal; Kaftan, D.; Vácha, F.; Garcia-Ruiz, J. M.; Kutá-Smatanová, Ivana

2010-01-01

Roč. 10, č. 8 (2010), s. 3391-3396 ISSN 1528-7483 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50510513; CEZ:AV0Z60870520; CEZ:AV0Z40550506 Keywords : crystal-structure * cyanobacterial * elongatus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.390, year: 2010

The study of crystal structures and vibrational spectra of inorganicsalts of 2,4-diaminopyrimidine

Czech Academy of Sciences Publication Activity Database

Matulková, I.; Mathauserová, J.; Císařová, I.; Němec, I.; Fábry, Jan

2016-01-01

Roč. 1103, Jan (2016), s. 82-93 ISSN 0022-2860 R&D Projects: GA ČR GA14-05506S Institutional support: RVO:68378271 Keywords : salts of 2,4-diaminopyrimidine * single crystal X-ray structural analysis * vibrational spectra Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.753, year: 2016

Structure fits the purpose: photonic crystal fibers for evanescent-field surface-enhanced Raman spectroscopy

Czech Academy of Sciences Publication Activity Database

Oo, M. K .K.; Han, Y.; Kaňka, Jiří; Sukhishvili, S.; Du, H.

2010-01-01

Roč. 35, č. 4 (2010), s. 466-468 ISSN 0146-9592 R&D Projects: GA ČR GA102/08/1719 Institutional research plan: CEZ:AV0Z20670512 Keywords : Photonic crystal fiber * Raman spectroscopy * Fiber-optic evanescent sensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.316, year: 2010

Photonic Crystal Structure and Coloration of Wing Scales of Butterflies Exhibiting Selective Wavelength Iridescence

Czech Academy of Sciences Publication Activity Database

Mika, Filip; Matějková-Plšková, J.; Jiwajinda, S.; Dechkrong, P.; Shiojiri, M.

2012-01-01

Roč. 5, č. 5 (2012), s. 754-771 ISSN 1996-1944 R&D Projects: GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : butterfly scale * structure color * natural photonic crystal * E. mulciber * S. charonda * C. ataxus * T. aeacus Subject RIV: JJ - Other Materials Impact factor: 2.247, year: 2012

On the long-time behavior of some mathematical models for nematic liquid crystals

Czech Academy of Sciences Publication Activity Database

Petzeltová, Hana; Rocca, E.; Schimperna, G.

2013-01-01

Roč. 46, 3-4 (2013), s. 623-639 ISSN 0944-2669 R&D Projects: GA MŠk LC06052 Institutional research plan: CEZ:AV0Z10190503 Keywords : nematic liquid crystals * long-time behavior * flows Subject RIV: BA - General Mathematics Impact factor: 1.526, year: 2013 http://www.springerlink.com/content/d61u566014515884/

Influence of surrounding atmosphere on crystallization of as-quenched Fe-Ni-Zr ribbon

Czech Academy of Sciences Publication Activity Database

Roupcová, Pavla; Schneeweiss, Oldřich; Bezdička, Petr; Petrovič, P.

2006-01-01

Roč. 44, č. 3 (2006), s. 127-132 ISSN 0023-432X R&D Projects: GA MŠk 1M0512 Institutional research plan: CEZ:AV0Z20410507; CEZ:AV0Z40320502 Keywords : as-quenched material * kinetics of crystallization * Mossbauer spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.138, year: 2006

Interaction of high cycle fatigue with high temperature creep in superalloy single crystals

Czech Academy of Sciences Publication Activity Database

Lukáš, Petr; Kunz, Ludvík; Svoboda, Milan

2002-01-01

Roč. 93, č. 7 (2002), s. 661-665 ISSN 0044-3093 R&D Projects: GA AV ČR IAA2041002; GA AV ČR KSK1010104 Institutional research plan: CEZ:AV0Z2041904 Keywords : Single crystals * Creep/fatigue interaction * Persistent slip bands Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.636, year: 2002

Bis[(2,3,4-Trimethoxy-Benzylidenepropylideneamino)Phenyl] Ether: Synthesis, characterization and crystal structure

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Fejfarová, Karla; Dušek, Michal

2012-01-01

Roč. 42, č. 3 (2012), s. 263-266 ISSN 1074-1542 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : Shiff bases * crystal structure * X-ray diffraction * Jana2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.513, year: 2012

Time-of-flight studies of multiple Bragg reflections in cylindrically bent perfect crystals

Czech Academy of Sciences Publication Activity Database

Mikula, Pavol; Furusaka, M.; Ohkubob, K.; Šaroun, Jan

2012-01-01

Roč. 45, č. 12 (2012), s. 1248-1253 ISSN 0021-8898 R&D Projects: GA AV ČR KJB100480901; GA ČR GAP204/10/0654 Institutional support: RVO:61389005 Keywords : neutron diffraction * time-of-flight method * multiple reflections * bent perfect crystals Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.343, year: 2012

Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

Czech Academy of Sciences Publication Activity Database

Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

2001-01-01

Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

A kinetic model of the transformation of a micropatterned amorphous precursor into a porous single crystal

Czech Academy of Sciences Publication Activity Database

Fratzl, P.; Fischer, F. D.; Svoboda, Jiří; Aizenberg, J.

2010-01-01

Roč. 6, č. 3 (2010), s. 1001-1005 ISSN 1742-7061 R&D Projects: GA MŠk(CZ) OC10029 Institutional research plan: CEZ:AV0Z20410507 Keywords : Phase transformation * Crystallization * Nucleation and growth Subject RIV: BJ - Thermodynamics Impact factor: 4.824, year: 2010

Single crystal X-ray structural features of aromatic compounds having a pentafluorosulfuranyl (SF5) functional group

Czech Academy of Sciences Publication Activity Database

Du, J.; Hua, G.; Beier, Petr; Slawin, A. M. Z.; Woollins, J. D.

2017-01-01

Roč. 28, č. 3 (2017), s. 723-733 ISSN 1040-0400 Institutional support: RVO:61388963 Keywords : pentafluorosulfuranyl (SF5) group * aromatic compounds * single crystal X-ray structure * intramolecular interactions * intermolecular interactions Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 1.582, year: 2016

Stress induced martensitic transformations in tension/torsion of CuAlNi single crystal tube

Czech Academy of Sciences Publication Activity Database

Šittner, Petr; Hashimoto, K.; Kato, M.; Tokuda, M.

2003-01-01

Roč. 48, - (2003), s. 1153-1159 ISSN 1359-6462 R&D Projects: GA AV ČR IAA1048107 Institutional research plan: CEZ:AV0Z1010914 Keywords : shape memory alloys(SMAs) * martensitic phase transformation * single crystal tube * tension test * torsion Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.633, year: 2003

Hakite from Příbram, Czech Republic: compositional variability, crystal structure and the role in Se mineralization

Czech Academy of Sciences Publication Activity Database

Škácha, P.; Sejkora, J.; Palatinus, Lukáš; Makovicky, E.; Plášil, Jakub; Macek, I.; Goliáš, V.

2016-01-01

Roč. 80, č. 6 (2016), s. 1115-1128 ISSN 0026-461X Institutional support: RVO:68378271 Keywords : hakite * selenides * tetrahedrite group * crystal structure * Příbram * uranium district * analyses * diffraction data Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.285, year: 2016

I222 crystal form of despentapeptide (B26-B30) insulin provides new insights into the properties of monomeric insulin

Czech Academy of Sciences Publication Activity Database

Whittingham, J. L.; Youshang, Z.; Žáková, Lenka; Dodson, E. J.; Turkenburg, J. P.; Brange, J.; Dodson, G. G.

2006-01-01

Roč. 62, č. 5 (2006), s. 505-511 ISSN 0907-4449 Institutional research plan: CEZ:AV0Z40550506 Keywords : insulin * crystal structure * monomer * despentapeptid Subject RIV: CE - Biochemistry Impact factor: 1.687, year: 2006

Polymorphous transformation in the crystal structure of [Mg(H.sub.2./sub.O).sub.6./sub. Br.sub.2./sub.][(C.sub.7./sub.H.sub.14./sub.N.sub.4./sub.).sub.2./sub.] . 4 (H.sub.2./sub.O) studied by powder and single crystal X-ray diffraction

Czech Academy of Sciences Publication Activity Database

Rivera, A.; Rohlíček, Jan; Sadat-Bernal, J.; Ríos-Motta, J.; Dušek, Michal

2014-01-01

Roč. 229, č. 4 (2014), s. 319-327 ISSN 0044-2968 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : polymorphism * powder X-ray * single crystal diffraction * 1,3,6,8-tetraazatricyclo[4.3.1.13,ˑ 8]undecane * phase transformation * crystal structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.310, year: 2014

Growth of triglicine sulphate single crystals doped by cobalt (II) phosphate

Czech Academy of Sciences Publication Activity Database

Prokopová, Lucie; Novotný, Jan; Mička, Z.; Malina, Václav

2001-01-01

Roč. 36, č. 11 (2001), s. 1189-1195 ISSN 0232-1300 R&D Projects: GA ČR GA102/99/0364; GA AV ČR KSK1010601 Projekt 7/96/K:4076 Grant - others:GA MSk(CZ) OC P3.160 Institutional research plan: CEZ:AV0Z2067918 Keywords : crystal growth * pyroelectric devices * domains Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.536, year: 2001

Transport properties of Lu.sub.2./sub.Fe.sub.17./sub. single crystals under extreme conditions

Czech Academy of Sciences Publication Activity Database

Skorokhod, Yuriy; Arnold, Zdeněk; Kamarád, Jiří; Andreev, Alexander V.

2004-01-01

Roč. 11, č. 3 (2004), s. 471-475 ISSN 1027-5495 R&D Projects: GA ČR(CZ) GA106/02/0943 Institutional research plan: CEZ:AV0Z1010914 Keywords : transport properties * magnetotransport properties * pressure effect * single crystals * intermetallic compounds Subject RIV: BM - Solid Matter Physics ; Magnetism

Effect of Feed Melting, Temperature History, and Minor Component Addition on Spinel Crystallization in High-Level Waste Glass

Czech Academy of Sciences Publication Activity Database

Izák, Pavel; Hrma, P.; Arey, B. W.; Plaisted, T. J.

2001-01-01

Roč. 289, 1-3 (2001), s. 17-29 ISSN 0022-3093 Grant - others:DOE(US) DE/06/76RL01830 Keywords : feed melting * crystalization * high-level waste glass Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.363, year: 2001

L12-phase cutting during high temperature and low stress creep of a Re-containing Ni-base single crystal superalloy

Czech Academy of Sciences Publication Activity Database

Kostka, A.; Maelzer, G. (ed.); Eggeler, G.; Dlouhý, Antonín; Reese, S.; Mack, T.

2007-01-01

Roč. 42, č. 11 (2007), s. 3951-3957 ISSN 0022-2461 Institutional research plan: CEZ:AV0Z20410507 Keywords : nickel-base superalloys * single crystals * creep Subject RIV: JG - Metallurgy Impact factor: 1.081, year: 2007

Image plane digital holographic microscope for the inspection of ferroelectric single crystals.

Czech Academy of Sciences Publication Activity Database

Psota, Pavel; Mokrý, Pavel; Lédl, Vít; Vojtíšek, Petr

2016-01-01

Roč. 55, č. 12 (2016), č. článku 121731. ISSN 0091-3286 R&D Projects: GA ČR(CZ) GA14-32228S Institutional support: RVO:61389021 Keywords : Digital holography * barium titanate * domain pattern * ferroelectric crystals * holographic microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.082, year: 2016 http://dx.doi.org/10.1117/1.OE.55.12.121731

Synthesis, crystal structure, spectral and thermal studies of (E)-4-dimethamino[(1-phenylethyl)iminomethyl]benzyne

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Rad, S.M.; Grivani, G.; Fejfarová, Karla; Dušek, Michal; Das, D.

2011-01-01

Roč. 41, č. 8 (2011), s. 1145-1149 ISSN 1074-1542 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional research plan: CEZ:AV0Z10100521 Keywords : Shiff bases * crystal structure * X-ray diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.566, year: 2011

High-field magnetic behavior and forced-ferromagnetic state in an ErFe.sub.11./sub.TiH single crystal

Czech Academy of Sciences Publication Activity Database

Kostyuchenko, N.V.; Zvezdin, A. K.; Tereshina, Evgeniya; Skourski, Y.; Doerr, M.; Drulis, H.; Pelevin, I.A.; Tereshina, I. S.

2015-01-01

Roč. 92, č. 10 (2015), "104423-1"-"104423-5" ISSN 1098-0121 Institutional support: RVO:68378271 Keywords : high field magnetization * crystal field effects * hamiltonian * rare- earth intermetallics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014

Dipolar phases in liquid crystals with the chiral part based on the lactic acid

Czech Academy of Sciences Publication Activity Database

Glogarová, Milada; Novotná, Vladimíra; Kašpar, Miroslav; Hamplová, Věra; Pociecha, D.

2008-01-01

Roč. 81, 11-12 (2008), 963-970 ISSN 0141-1594 R&D Projects: GA MŠk OC 175; GA AV ČR IAA100100710 Institutional research plan: CEZ:AV0Z10100520 Keywords : liquid crystals * paraelectric * ferroelectric and antiferroelectric phases * TGB phases * lactate unit Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.201, year: 2008

Non-isothermal kinetics of cold crystallization in multicomponent PLA/thermoplastic polyurethane/nanofiller system

Czech Academy of Sciences Publication Activity Database

Kratochvíl, Jaroslav; Kelnar, Ivan

2017-01-01

Roč. 130, č. 2 (2017), s. 1043-1052 ISSN 1388-6150 R&D Projects: GA ČR(CZ) GA16-03194S Institutional support: RVO:61389013 Keywords : poly(lactic acid) * cold crystallization * thermoplastic polyurethane Subject RIV: JI - Composite Materials OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics Impact factor: 1.953, year: 2016

Crystal structure of richetite revisited: crystallographic evidence for the presence of pentavalent uranium

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub

2017-01-01

Roč. 102, č. 9 (2017), s. 1771-1775 ISSN 0003-004X R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : richetite * uranyl oxide hydroxy-hydrate * crystal structure * pentavalent uranium * weathering Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 2.021, year: 2016

Crystal growth and characterization of Ce:Gd.sub.3./sub.(Ga,Al).sub.5./sub.O.sub.12./sub. single crystal using floating zone method in different O.sub.2./sub. partial pressure

Czech Academy of Sciences Publication Activity Database

Yoshikawa, A.; Fujimoto, Y.; Yamaji, A.; Kurosawa, S.; Pejchal, Jan; Sugiyama, M.; Wakahara, S.; Futami, Y.; Yokota, Y.; Kamada, K.; Yubuta, K.; Shishido, T.; Nikl, Martin

2013-01-01

Roč. 35, č. 11 (2013), s. 1882-1886 ISSN 0925-3467 R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : Ce:GAGG * scintillator * single crystal * floating zone method * growth atmosphere * combinatorial Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.075, year: 2013 http://www.sciencedirect.com/science/article/pii/S0925346713001523

Nucleation of polypropylene crystallization with gold nanoparticles. Part 2: relation between particle morphology and nucleation activity

Czech Academy of Sciences Publication Activity Database

Šlouf, Miroslav; Vacková, Taťana; Zhigunov, Alexander; Sikora, Antonín; Piorkowska, E.

2016-01-01

Roč. 55, č. 4 (2016), s. 393-410 ISSN 0022-2348 R&D Projects: GA ČR GAP205/10/0348; GA ČR(CZ) GA14-17921S Institutional support: RVO:61389013 Keywords : crystallization * gold nanoparticles * isotactic polyproplylene Subject RIV: JJ - Other Materials Impact factor: 0.828, year: 2016

Drag of a Cottrell atmosphere by an edge dislocation in a smectic-A liquid crystal

Czech Academy of Sciences Publication Activity Database

Oswald, P.; Lejček, Lubor

2017-01-01

Roč. 40, č. 10 (2017), s. 84-93 ISSN 1292-8941 Institutional support: RVO:68378271 Keywords : soft matter * liquid crystal Subject RIV: BE - Theoretical Physics OBOR OECD: Atomic, molecular and chemical physics (physics of atoms and molecules including collision, interaction with radiation, magnetic resonances, Mössbauer effect) Impact factor: 1.464, year: 2016

Magnetic and transport properties of PrRu.sub.2./sub.Si.sub.2./sub. single crystal under high pressure

Czech Academy of Sciences Publication Activity Database

Vejpravová, J.; Kamarád, Jiří; Prchal, J.; Sechovsky, V.

2007-01-01

Roč. 76, suppl. A (2007), s. 49-50 ISSN 0031-9015 Institutional research plan: CEZ:AV0Z10100521 Keywords : pressure effect * magnetic properties * transport properties * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2007

Vanadium-rich tourmaline from graphitic rocks at Bítovánky, Czech republic; compositional variation, crystal structure

Czech Academy of Sciences Publication Activity Database

Cempírek, J.; Houzar, S.; Novák, M.; Selway, J.B.; Šrein, Vladimír

2006-01-01

Roč. 28, Spec. pap. (2006), s. 39-41 ISSN 1896-2203. [Central European Mineralogical Conference /1./. Vyšná Boca, 11.09.2006-15.09.2006] Institutional research plan: CEZ:AV0Z30460519 Keywords : V-rich tourmaline * compositional variation * crystal structure Subject RIV: DB - Geology ; Mineralogy

Entangled photon pair generation by spontaneous parametric down-conversion in finite-length one-dimensional photonic crystals

Czech Academy of Sciences Publication Activity Database

Centini, M.; Peřina ml., Jan; Sciscione, L.; Sibilia, C.; Scalora, M.; Bloemer, M.J.; Bertolotti, M.

2005-01-01

Roč. 72, 03 (2005), 033806/1-033806/11 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) OC P11.003 Institutional research plan: CEZ:AV0Z10100522 Keywords : photon pair * photonic crystals * spontaneous parametric down-conversion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.997, year: 2005

CW frequency doubling of 1029 nm radiation using single pass bulk and waveguide PPLN crystals

Czech Academy of Sciences Publication Activity Database

Chiodo, N.; Du Burck, F.; Hrabina, Jan; Candela, Y.; Wallerand, J. P.; Acef, O.

2013-01-01

Roč. 311, 15 January (2013), s. 239-244 ISSN 0030-4018 R&D Projects: GA ČR GPP102/11/P820 Institutional support: RVO:68081731 Keywords : IR laser * second harmonic generation * waveguide and bulk crystals * periodically poled lithium niobate * 1029 nm wavelength Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.542, year: 2013

Growth and characterization of TGS single crystals doped with D-phenylalanine and Pt/IV/ ions

Czech Academy of Sciences Publication Activity Database

Novotný, Jan; Zelinka, Jiří; Podvalová, Zdislava

2004-01-01

Roč. 313, - (2004), s. 1-6 ISSN 0015-0193 R&D Projects: GA AV ČR(CZ) IBS2067204; GA MŠk(CZ) OC D14.40; GA MŠk(CZ) 1P04OCD14.40 Keywords : crystal growth * ferroelectric materials * sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.517, year: 2004

Electric-field-tunable defect mode in one-dimensional photonic crystal operating in the terahertz range

Czech Academy of Sciences Publication Activity Database

Skoromets, Volodymyr; Němec, Hynek; Kadlec, Christelle; Fattakhova-Rohlfing, D.; Kužel, Petr

2013-01-01

Roč. 102, č. 24 (2013), "241106-1"-"241106-5" ISSN 0003-6951 R&D Projects: GA ČR GA13-12386S Grant - others:AVČR(CZ) M100101218 Institutional support: RVO:68378271 Keywords : terahertz spectroscopy * strontium titanate * dielectric properties * photonic crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.515, year: 2013

Temperature dependence of CIE-x,y color coordinates in YAG:Ce single crystal phosphor

Czech Academy of Sciences Publication Activity Database

Rejman, M.; Babin, Vladimir; Kučerková, Romana; Nikl, Martin

2017-01-01

Roč. 187, Jul (2017), s. 20-25 ISSN 0022-2313 R&D Projects: GA TA ČR TA04010135 Institutional support: RVO:68378271 Keywords : YAG:Ce * single-crystal * simulation * energy level lifetime * white LED * CIE * temperature dependence Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.686, year: 2016

Algebraic Theory of Crystal Vibrations: Localization Properties of Wave Functions in Two-Dimensional Lattices

Czech Academy of Sciences Publication Activity Database

Dietz, B.; Iachello, F.; Macek, Michal

2017-01-01

Roč. 7, č. 8 (2017), č. článku 246. ISSN 2073-4352 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : algebraic models * graphene-like materials * striped structures * photonic crystals Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.566, year: 2016

Crystallization and preliminary crystallographic characterization of the extrinsic PsbP protein of photosystem II from Spinacia oleracea

Czech Academy of Sciences Publication Activity Database

Kohoutová, Jaroslava; Kutá-Smatanová, Ivana; Brynda, Jiří; Lapkouski, Mikalai; Revuelta, J. L.; Arellano, J.B.; Ettrich, Rüdiger

F65, č. 2 (2009), s. 111-115 ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z60870520 Keywords : photosystem protein * crystallization * X-ray analysis Subject RIV: CC - Organic Chemistry Impact factor: 0.551, year: 2009

Crystal structure of Mycobacterium tuberculosis O-6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA

Czech Academy of Sciences Publication Activity Database

Miggiano, R.; Perugino, G.; Ciaramella, M.; Serpe, M.; Rejman, Dominik; Páv, Ondřej; Pohl, Radek; Garavaglia, S.; Lahiri, S.; Rizzi, M.; Rossi, F.

2016-01-01

Roč. 473, č. 2 (2016), s. 123-133 ISSN 0264-6021 EU Projects: European Commission(XE) 241587 - SYSTEMTB Institutional support: RVO:61388963 Keywords : DNA repair * DNA-binding protein * Mycobacterium tuberculosis * O-6-methylguanine-DNA methyltransferase * co-operativity * crystal structure Subject RIV: CE - Biochemistry Impact factor: 3.797, year: 2016

Magnetostriction of a U.sub.2./sub.Fe.sub.13./sub.Si.sub.4./sub. single crystal

Czech Academy of Sciences Publication Activity Database

Andreev, Alexander V.; Tereshina, Evgeniya; Prokleška, J.

2010-01-01

Roč. 491, 1-2 (2010), s. 4-7 ISSN 0925-8388 R&D Projects: GA ČR GA202/09/0339 Institutional research plan: CEZ:AV0Z10100520 Keywords : uranium intermetallics * single crystals * ferromagnetism * magnetostriction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.138, year: 2010

Crystallization and preliminary X-ray diffraction analysis of nepenthesin-1

Czech Academy of Sciences Publication Activity Database

Fejfarová, Karla; Man, Petr; Mrázek, Hynek; Kádek, Alan; Dušková, Jarmila; Skálová, Tereza; Kolenko, Petr; Koval, Tomáš; Stránský, Jan; Hašek, Jindřich; Dohnálek, Jan

2014-01-01

Roč. 21, č. 1 (2014), s. 32 ISSN 1211-5894. [Discussions in Structural Molecular Biology /12./. 13.03.2014-15.03.2014, Nové Hrady] R&D Projects: GA MŠk EE2.3.30.0029; GA MŠk LG14009; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 ; RVO:61388971 ; RVO:86652036 Keywords : plant aspartate protease * crystallization Subject RIV: CE - Biochemistry; EI - Biotechnology ; Bionics (MBU-M); EB - Genetics ; Molecular Biology (BTO-N)

A redetermination from the original data of the crystal structure of 2-amino-4,6-dimethoxy-pyrimidin-1-ium 4-aminobenzoate

Czech Academy of Sciences Publication Activity Database

Fábry, Jan

2016-01-01

Roč. 72, Apr (2016), 512-515 ISSN 2056-9890 R&D Projects: GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : crystal structure redetermination * H-bonding * symmetric H-bonds * refinement constraints * restraints Subject RIV: BM - Solid Matter Physics ; Magnetism

Synthesis, characterization, crystal structure and theoretical studies of new chiral Schiff base (E)-4-hydroxy[(1-phenylethyl)iminomethyl]benzyne

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Gholinejad, M.; Rad, S.M.; Grivani, G.; Fejfarová, Karla; Dušek, Michal

2015-01-01

Roč. 41, č. 3 (2015), 1635-1645 ISSN 0922-6168 R&D Projects: GA ČR(CZ) GC202/07/J007 Institutional support: RVO:68378271 Keywords : Schiff base * crystal structure * DFT calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.833, year: 2015

Design of turn-around-point long-period gratings in a photonic crystal fiber for refractometry of gases

Czech Academy of Sciences Publication Activity Database

Kaňka, Jiří

2013-01-01

Roč. 182, č. 6 (2013), s. 16-24 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) LD11030; GA MŠk(CZ) LF11001 Institutional support: RVO:67985882 Keywords : Fiber design * Photonic crystal fiber * Microstructured optical fiber Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.840, year: 2013

Crystallization and preliminary diffraction analysis of Escherichia coli WrbA in complex with its cofactor flavin mononucleotide

Czech Academy of Sciences Publication Activity Database

Wolfová, Julie; Mesters, J. R.; Brynda, Jiří; Grandori, R.; Natalello, A.; Carey, J.; Kutá-Smatanová, Ivana

2007-01-01

Roč. 63, Pt7 (2007), s. 571-575 ISSN 1744-3091 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z60870520 Keywords : WrbA * flavodoxin * crystal structure Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.645, year: 2007

Li-impurity effect in optical spectra of KTaO.sub.3./sub.:Er.sup.3+./sup. crystals

Czech Academy of Sciences Publication Activity Database

Skvortsov, A. P.; Potůček, Zdeněk; Poletaev, N.K.; Syrnikov, P. P.; Bryknar, Z.; Dejneka, Alexandr; Jastrabík, Lubomír; Trepakov, Vladimír

2016-01-01

Roč. 121, č. 4 (2016), s. 534-537 ISSN 0030-400X Institutional support: RVO:68378271 Keywords : f–f absorption and emission spectra * Er impurities * KTaO 3 and K 1-x Li x TaO 3 * crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.716, year: 2016

Effective extraction of photoluminescence from a diamond layer with a photonic crystal

Czech Academy of Sciences Publication Activity Database

Ondič, Lukáš; Dohnalová, Kateřina; Ledinský, Martin; Kromka, Alexander; Babchenko, Oleg; Rezek, Bohuslav

2011-01-01

Roč. 5, č. 1 (2011), s. 346-350 ISSN 1936-0851 R&D Projects: GA AV ČR KAN400100701; GA MŠk LC510; GA AV ČR KJB100100903 Grant - others:AV ČR(CZ) M100100902 Institutional research plan: CEZ:AV0Z10100521 Keywords : photonic crystals * spontaneous emission * light extraction * diffraction * nanocrystalline diamond films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 10.774, year: 2011

Orientational order parameters of a de Vries-type ferroelectric liquid crystal obtained by polarized Raman spectroscopy and x-ray diffraction

Czech Academy of Sciences Publication Activity Database

Sanchez-Castillo, A.; Osipov, M.A.; Jagiella, S.; Nguyen, Z.H.; Kašpar, Miroslav; Hamplová, Věra; Maclennan, J.; Giesselmann, F.

2012-01-01

Roč. 85, č. 6 (2012), "061703-1"-"061703-18" ISSN 1539-3755 Institutional research plan: CEZ:AV0Z10100520 Keywords : molecular and microscopic models * theories of liquid crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.313, year: 2012

ISSN Exercise & Sport Nutrition Review: Research & Recommendations

Directory of Open Access Journals (Sweden)

Mendel Ron

2004-05-01

Full Text Available Abstract Sport nutrition is a constantly evolving field with literally thousands of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper presents a well-referenced overview of the current state of the science related to how to optimize training through nutrition. More specifically, this article discusses: 1. how to evaluate the scientific merit of nutritional supplements; 2. general nutritional strategies to optimize performance and enhance recovery; and, 3. our current understanding of the available science behind weight gain, weight loss, and performance enhancement supplements. Our hope is that ISSN members find this review useful in their daily practice and consultation with their clients.

A novel type of banana liquid crystals based on 1-substituted naphtalene-2,7-diol cores

Czech Academy of Sciences Publication Activity Database

Svoboda, J.; Novotná, Vladimíra; Kozmík, V.; Glogarová, Milada; Weissflog, W.; Diele, S.; Pelzl, G.

2003-01-01

Roč. 13, - (2003), s. 2104-2110 ISSN 0959-9428 R&D Projects: GA ČR(CZ) GA202/02/0840 Grant - others:COST(XE) D14 WG 00015 Institutional research plan: CEZ:AV0Z1010914 Keywords : liquid crystals * banana -shaped mesogens * substituted naphthalene diols Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.659, year: 2003

Silicon nanocrystal-based photonic crystal slabs with broadband and efficient directional light emission

Czech Academy of Sciences Publication Activity Database

Ondič, Lukáš; Varga, Marián; Pelant, Ivan; Valenta, J.; Kromka, Alexander; Elliman, R. G.

2017-01-01

Roč. 7, č. 1 (2017), s. 1-8, č. článku 5763. ISSN 2045-2322 R&D Projects: GA ČR GJ16-09692Y; GA MŠk(CZ) LD15003 Institutional support: RVO:68378271 Keywords : photonic crystal slab * silicon nanocrystals * light emission Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

Stress-induced martensite variant reorientation in magnetic shape memory Ni–Mn–Ga single crystal studied by neutron diffraction

Czech Academy of Sciences Publication Activity Database

Molnár, Peter; Šittner, Petr; Lukáš, Petr; Hannula, S.-P.; Heczko, Oleg

2008-01-01

Roč. 17, č. 3 (2008), 035014/1-035014/4 ISSN 0964-1726 Institutional research plan: CEZ:AV0Z10100520; CEZ:AV0Z10480505 Keywords : NiMnGa single crystal * neutron diffraction * stress induced martensite reorientation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.743, year: 2008

Atomic resolution crystal structure of Sapp2p, a secreted aspartic protease from Candida parapsilosis

Czech Academy of Sciences Publication Activity Database

Dostál, Jiří; Pecina, Adam; Hrušková-Heidingsfeldová, Olga; Marečková, L.; Pichová, Iva; Řezáčová, Pavlína; Lepšík, Martin; Brynda, Jiří

2015-01-01

Roč. 71, č. 12 (2015), s. 2494-2504 ISSN 1399-0047 R&D Projects: GA ČR(CZ) GA14-23022S Institutional support: RVO:61388963 ; RVO:68378050 Keywords : aspartic protease * Candida parapsilosis * Sapp2p * crystal structure * ultrahigh resolution * interaction energy * quantum mechanics Subject RIV: CE - Biochemistry; EB - Genetics ; Molecular Biology (UMG-J) Impact factor: 2.674, year: 2014

Evolution of non-isothermal Landau-De Gennes nematic liquid crystals flows with singular potential

Czech Academy of Sciences Publication Activity Database

Feireisl, Eduard; Rocca, E.; Schimperna, G.; Zarnescu, A.

2014-01-01

Roč. 12, č. 2 (2014), s. 317-343 ISSN 1539-6746 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : liquid crystals * global existence of weak solutions * Navier-Stokes equations Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://intlpress.com/site/pub/pages/journals/items/cms/content/vols/0012/0002/a006/index.html

Studies on the crystal structure and arrangement of water in sitagliptin L-tartrate hydrates

Czech Academy of Sciences Publication Activity Database

Tieger, E.; Kiss, V.; Pokol, G.; Finta, Z.; Dušek, Michal; Rohlíček, Jan; Skořepová, E.; Brázda, Petr

2016-01-01

Roč. 18, č. 21 (2016), s. 3819-3831 ISSN 1466-8033 R&D Projects: GA MŠk LO1603; GA ČR GA16-10035S EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : sitagliptin tartarate * crystal structure * channel hydrates * hydration * dehydration Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.474, year: 2016

Towards a more effective and reliable salt crystallization test for porous building materials: state of the art

Czech Academy of Sciences Publication Activity Database

Lubelli, B.; Cnudde, V.; Diaz-Goncalves, T.; Franzoni, E.; van Hees, R.; Ioannou, I.; Menéndez, B.; Nunes, Cristiana Lara; Siedel, H.; Stefanidou, M.; Verges-Belmin, V.; Viles, H.

2018-01-01

Roč. 51, č. 2 (2018), č. článku 55. ISSN 1359-5997 Keywords : literature review * salt damage * salt crystallization test * porous materials * RILEM Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Materials engineering Impact factor: 2.607, year: 2016 https://link.springer.com/article/10.1617/s11527-018-1180-5

Long-period gratings in photonic crystal fibers operating near the phase-matching turning point for evanescent chemical and biochemical sensing

Czech Academy of Sciences Publication Activity Database

Tian, F.; Kaňka, Jiří; Du, H.

2012-01-01

Roč. 20, č. 19 (2012), s. 20952-20961 ISSN 1094-4087 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Photonic crystal fiber * Long-period grating * Optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.546, year: 2012

On the nature of γ′ phase cutting and its effect on high temperature and low stress creep anisotropy of Ni-base single crystal superalloys

Czech Academy of Sciences Publication Activity Database

Jácome, L. A.; Nörtershäuser, P.; Somsen, C.; Dlouhý, Antonín; Eggeler, G.

2014-01-01

Roč. 69, MAY (2014), s. 246-264 ISSN 1359-6454 Institutional support: RVO:68081723 Keywords : Ni-base single crystal superalloys * Creep * Anisotropy * Dislocation * Rafting Subject RIV: JG - Metallurgy Impact factor: 4.465, year: 2014

Experimental studies of dispersive double reflections excited in cylindrically bent perfect-crystal slabs at a constant neutron wavelength

Czech Academy of Sciences Publication Activity Database

Mikula, Pavol; Vrána, Miroslav; Šaroun, Jan; Davydov, Vadim; Em, V.; Seong, B. S.

2012-01-01

Roč. 45, č. 1 (2012), s. 98-105 ISSN 0021-8898 R&D Projects: GA ČR GAP204/10/0654 Institutional research plan: CEZ:AV0Z10480505 Keywords : RESIDUAL STRAIN-STRESS INSTRUMENT * MULTIPLE BRAGG-REFLECTIONS * SINGLE-CRYSTAL Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.343, year: 2012

First crystal structures of pharmaceutical ibrutinib: systematic solvate screening and characterization

Czech Academy of Sciences Publication Activity Database

Zvoníček, V.; Skořepová, E.; Dušek, Michal; Babor, M.; Zvatora, P.; Šoós, M.

2017-01-01

Roč. 17, č. 6 (2017), s. 3116-3127 ISSN 1528-7483 R&D Projects: GA MŠk LO1603; GA ČR GA17-23196S EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : Ibrutinib solvates * anticancer drug * Raman spectroscopy * powder X-ray diffraction * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.055, year: 2016

Synthesis, crystal structure and conformational studies of Schiff-base compound 2-{[4-(Phenyldiazenyl)phenyl] iminomethyl}-5-bromophenolc

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Fejfarová, Karla; Dušek, Michal; Chermahini, A.N.

2012-01-01

Roč. 42, č. 2 (2012), s. 136-140 ISSN 1074-1542 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : Shiff bases * crystal structure * X-ray diffraction * Jana2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.513, year: 2012

Synthesis, characterization, crystal structure and theoretical studies on 4-bromo-2-[(E)-6-methyl-2-pyridyliminomethyl]phenol

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Mighani, H.; Kazemnejadi, M.; Gotoh, K.; Ishida, H.; Fejfarová, Karla; Dušek, Michal

2017-01-01

Roč. 10, May (2017), s. 1808-1813 ISSN 1878-5352 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : Schiff base * single-crystal * spectroscopy * DFT * hydrogen bond Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.553, year: 2016

Luminescence and photo-thermally stimulated defect-creation processes in Bi.sup.3+./sup.-doped single crystals of lead tungstate

Czech Academy of Sciences Publication Activity Database

Buryi, Maksym; Boháček, Pavel; Chernenko, K.; Krasnikov, A.; Laguta, Valentyn; Mihóková, Eva; Nikl, Martin; Zazubovich, S.

2016-01-01

Roč. 123, č. 5 (2016), 895-910 ISSN 0370-1972 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : defects * EPR * excitons * PbWO 4 :Bi single crystals * photoluminescence * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.674, year: 2016

The Effect of Type and Concentration of Modifier in Supercritical Carbon Dioxide on Crystallization of Nanocrystalline Titania Thin Films.

Czech Academy of Sciences Publication Activity Database

Sajfrtová, Marie; Cerhová, Marie; Jandová, Věra; Dřínek, Vladislav; Daniš, E.; Matějová, L.

2018-01-01

Roč. 133, MAR 2018 (2018), s. 211-217 ISSN 0896-8446 R&D Projects: GA ČR GA14-23274S Institutional support: RVO:67985858 Keywords : titania thin film * supercritical carbon dioxide * crystallization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.991, year: 2016

Photoinduced centers in PbZr.sub.1-x./sub.Ti.sub.x./sub.O.sub.3./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Bykov, I. P.; Glinchuk, M. D.; Laguta, V. V.; Nokhrin, S. N.; Jastrabík, Lubomír; Smotrakov, V.; Hrabovský, Miroslav; Eremkin, V.

2002-01-01

Roč. 272, - (2002), s. 167-172 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z1010914 Keywords : sinle-crystal * g-tensor * paramagnetic ions * UV illumination Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.408, year: 2002

Optimization of decay kinetics of YAG:Ce single crystal scintillators for S(T)EM electron detectors

Czech Academy of Sciences Publication Activity Database

Schauer, Petr

2011-01-01

Roč. 269, č. 21 (2011), s. 2572-2577 ISSN 0168-583X R&D Projects: GA ČR GAP102/10/1410 Institutional research plan: CEZ:AV0Z20650511 Keywords : scintillation detector * electron microscope * cathodoluminescence * YAG:Ce single crystal scintillator * decay time * afterglow * kinetic model * SEM * STEM Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.211, year: 2011

Studies of Double-Layer Effects at Single-Crystal Gold Electrodes. 3. Reduction Kinetics of Fluoropentaamminecobalt(III) Cation in Aqueous Solutions

Czech Academy of Sciences Publication Activity Database

Hromadová, Magdaléna; Fawcett, W. R.

2004-01-01

Roč. 108, - (2004), s. 3277-3282 ISSN 1089-5647 R&D Projects: GA ČR GP203/02/P082 Institutional research plan: CEZ:AV0Z4040901 Keywords : double - layer * single crystal * reduction kinetics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.679, year: 2003

Dielectric permittivity in weakly concentrated SrTiO.sub.3./sub.:Mn crystals and ceramics

Czech Academy of Sciences Publication Activity Database

Trepakov, Vladimír; Savinov, Maxim; Železný, Vladimír; Pokorný, Jan; Syrnikov, P.; Azzoni, C. B.; Galinetto, P.; Mozzati, M. C.; Badalyan, A.; Deyneka, Alexander; Jastrabík, Lubomír

2007-01-01

Roč. 93, č. 1 (2007), 012017/1-012017/6 ISSN 1742-6588 R&D Projects: GA AV ČR KAN301370701; GA AV ČR 1QS100100563; GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z10100522 Keywords : dielectric permittivity * SrTiO 3 :Mn * crystals and ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism

Some properties of the neutron monochromatic beams obtained by multiple Bragg reflections realized in bent perfect single crystals

Czech Academy of Sciences Publication Activity Database

Mikula, Pavol; Vrána, Miroslav; Šaroun, Jan; Krejčí, F.; Seong, B. S.; Woo, W.; Furusaka, M.

2013-01-01

Roč. 46, č. 1 (2013), s. 128-134 ISSN 0021-8898 R&D Projects: GA ČR GAP204/10/0654; GA MŠk LM2010011 Institutional support: RVO:61389005 Keywords : multiple reflections * bent perfect crystals * neutron diffraction Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.950, year: 2013

Low-dimensional compounds containing cyanido groups. XXVIII. Crystal structure, spectroscopic and magnetic properties of two copper(II) tetracyanidoplatinate complexes with 1,2-diaminopropane

Czech Academy of Sciences Publication Activity Database

Vavra, M.; Potočňák, I.; Dušek, Michal; Čižmár, E.; Ozerov, M.; Zvyagin, S.A.

2015-01-01

Roč. 225, May (2015), s. 202-208 ISSN 0022-4596 Institutional support: RVO:68378271 Keywords : spectroscopic studies * magnetic properties * crystal structure * [Pt(CN) ]2- anion * 1,2-diaminopropane Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.265, year: 2015

Synthesis and characterization of single crystals of the layered copper hydroxide acetate Cu2(OH)3(CH3COO)·H2O

Czech Academy of Sciences Publication Activity Database

Švarcová, Silvie; Klementová, Mariana; Bezdička, Petr; Lasocha, W.; Dušek, Michal; Hradil, David

2011-01-01

Roč. 46, č. 10 (2011), s. 1051-1057 ISSN 0232-1300 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z10100521 Keywords : copper hydroxide acetate * crystal structure * pigment Subject RIV: CA - Inorganic Chemistry Impact factor: 0.946, year: 2011

Magnetism of UCo.sub.2./sub.Si.sub.2./sub. single crystal studied under applied magnetic field and hydrostatic pressure

Czech Academy of Sciences Publication Activity Database

Mihalik, M.; Kolomiyets, O.; Griveau, J.C.; Andreev, Alexander V.; Sechovský, V.

2007-01-01

Roč. 76, Suppl. A (2007), s. 54-55 ISSN 0031-9015 R&D Projects: GA ČR GA202/06/0178 Institutional research plan: CEZ:AV0Z10100520 Keywords : uranium intermetallics * single crystals * antiferromagnetism * high pressure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2007

Effects of Na and K co-doping on growth and scintillation properties of Eu:SrI.sub.2./sub. crystals\

Czech Academy of Sciences Publication Activity Database

Ito, T.; Yokota, Y.; Kurosawa, S.; Král, Robert; Pejchal, Jan; Ohashi, Y.; Kamada, K.; Nikl, Martin; Yoshikawa, A.

2016-01-01

Roč. 90, Jul (2016), 157-161 ISSN 1350-4487 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : Eu:SrI 2 * scintillator * single crystal * alkali metal * light yield * non-proportionality Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

Growth of LiF/LiBaF.sub.3./sub. eutectic scintillator crystals and their optical properties

Czech Academy of Sciences Publication Activity Database

Kurosawa, S.; Yamaji, A.; Pejchal, Jan; Yokota, Y.; Ohashi, Y.; Kamada, K.; Yoshikawa, A.

2017-01-01

Roč. 52, č. 10 (2017), s. 5531-5536 ISSN 0022-2461 Grant - others:AV ČR(CZ) JSPS-17-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : scintillators * eutectics * crystal growth Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.599, year: 2016

Crystal growth and luminescence properties of Yb.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. infra-red emission scintillator

Czech Academy of Sciences Publication Activity Database

Horiai, T.; Kurosawa, S.; Murakami, R.; Pejchal, Jan; Yamaji, A.; Shoji, Y.; Chani, V.I.; Ohashi, Y.; Kamada, K.; Yokota, Y.; Yoshikawa, A.

2016-01-01

Roč. 58, Aug (2016), s. 14-17 ISSN 0925-3467 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : scintillator * pyrosilicate * charge transfer * infra-red * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

Crystallization of the novel flavodoxine-like protein, WrbA, - on the way to three-dimensional structure

Czech Academy of Sciences Publication Activity Database

Kutá-Smatanová, Ivana; Wolfová, J.; Grandori, R.; Chatterjee, N.; Carey, J.

A 60, - (2004), s. 159 ISSN 0108-7673. [European Crystallographic Meeting /22./. Budapešť, 26.08.2004-31.08.2004] R&D Projects: GA MŠk ME 640; GA MŠk LN00A141 Grant - others:GA ÚV1 INT-03-09049 Keywords : Flavodoxine-like protein * WebA apoprotein * Standard and advanced crystallization techniques Subject RIV: BO - Biophysics Impact factor: 1.829, year: 2004

Optical and scintillation properties of Sr7%:Ce15%:GdF.sub.3./sub. single crystal

Czech Academy of Sciences Publication Activity Database

Fukabori, A.; Kamada, K.; Yanagida, T.; Chani, V.; Aoki, K.; Yokota, Y.; Maeo, S.; Nikl, Martin; Yoshikawa, A.

2011-01-01

Roč. 318, č. 1 (2011), s. 1175-1178 ISSN 0022-0248. [International Conference on Crystal Growth (ICCG16) /16./ and International Conference on Vapor Growth and Epitaxy (ICVGE14) /14./. Beijing, 08.08.2010-13.08.2010] Institutional research plan: CEZ:AV0Z10100521 Keywords : radiation * inorganic compounds * scintillator materials * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.726, year: 2011

Luminescence and photo-thermally stimulated defect creation processes in PbWO.sub.4./sub.:Mo,La,Y (PWO III) crystals

Czech Academy of Sciences Publication Activity Database

Auffray, E.; Korjik, M.; Laguta, Valentyn; Zazubovich, S.

2015-01-01

Roč. 252, č. 10 (2015), s. 2259-2267 ISSN 0370-1972 Institutional support: RVO:68378271 Keywords : defects * ESR * PbWO4:Mo * La * Y crystals * photoluminescence * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.522, year: 2015

Structure determination of KScS.sub.2./sub., RbScS.sub.2./sub. and KLnS.sub.2./sub. (Ln = Nd, Sm, Tb, Dy, Ho, Er, Tm and Yb) and crystal-chemical discussion

Czech Academy of Sciences Publication Activity Database

Havlák, Lubomír; Fábry, Jan; Henriques, Margarida Isabel Sousa; Dušek, Michal

2015-01-01

Roč. 71, Jul (2015), 623-630 ISSN 2053-2296 R&D Projects: GA ČR(CZ) GAP204/11/0809; GA TA ČR TA04010135 Institutional support: RVO:68378271 Keywords : alkali rare earth sulfides * X-ray single-crystal structure determination * crystal chemistry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.479, year: 2015

Synthesis and crystal structures of Pd.sub.3./sub.Pb.sub.2./sub.Te.sub.2./sub. and Pd.sub.3./sub.AgSe

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, M.; Drahokoupil, Jan; Chareev, D.A.; Kristavchuk, A.V.

2010-01-01

Roč. 17, 2a (2010), k76-k77 ISSN 1211-5894 Institutional research plan: CEZ:AV0Z10100520 Keywords : x-ray * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism http://www.xray.cz/ms/bul2010-2a/laufek.pdf

Crystal structure, spectroscopic and theoretical studies on two Schiff base compounds of 2,6-dichlorobenzylidene-2,4-dichloroaniline and 2,4-dichlorobenzylidene-2,4-dichloroaniline

Czech Academy of Sciences Publication Activity Database

Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.

2015-01-01

Roč. 139, Mar (2015), s. 271-278 ISSN 1386-1425 Grant - others:AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.653, year: 2015

Timing capabilities of garnet crystals for detection of high energy charged particles

Czech Academy of Sciences Publication Activity Database

Lucchini, M.T.; Gundacker, S.; Lecoq, P.; Benaglia, A.; Nikl, Martin; Kamada, K.; Yoshikawa, A.; Auffray, E.

2017-01-01

Roč. 852, Apr (2017), s. 1-9 ISSN 0168-9002 R&D Projects: GA ČR GA16-15569S EU Projects: European Commission(XE) 690599 - ASCIMAT; European Commission(XE) 644260 - INTELUM Grant - others:COST(XE) TD1401 Institutional support: RVO:68378271 Keywords : precision timing * calorimeters * time-of-flight * YAG:Ce * LuAG:Ce * GAGG:Ce * LSO:Ce * crystals * SiPM Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.362, year: 2016

Core-cladding mode coupling and recoupling in photonic crystal fiber for enhanced overlap of evanescent field using long-period gratings

Czech Academy of Sciences Publication Activity Database

He, Z.; Zhu, Y.; Kaňka, Jiří; Du, H.

2010-01-01

Roč. 18, č. 2 (2010), s. 507-512 ISSN 1094-4087 R&D Projects: GA ČR GA102/08/1719 Institutional research plan: CEZ:AV0Z20670512 Keywords : Photonic crystal fiber * Long-period grating * Fiber-optic evanescent sensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.749, year: 2010

Growth and luminescence properties of Eu:SrI.sub.2./sub. single crystals prepared by modified micro-pulling-down method

Czech Academy of Sciences Publication Activity Database

Král, Robert; Jarý, Vítězslav; Pejchal, Jan; Kurosawa, S.; Nitsch, Karel; Yokota, Y.; Nikl, Martin; Yoshikawa, A.

2016-01-01

Roč. 63, č. 2 (2016), s. 453-458 ISSN 0018-9499 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : Eu 2+ and Eu 3+ doping * crystal growth * luminescence * micro-pulling-down method * strontium iodide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.171, year: 2016

NaCo(H.sub.2./sub.PO.sub.2./sub.).sub.3./sub.: crystal structure and physical study

Czech Academy of Sciences Publication Activity Database

El Bali, B.; Lachkar, M.; Essehli, R.; Dušek, Michal; Rohlíček, Jan; Mircescu, N.; Haisch, Ch.

2016-01-01

Roč. 1123, Nov (2016), s. 30-34 ISSN 0022-2860 R&D Projects: GA ČR GA15-12653S; GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : hypophosphite * crystal structure * Raman spectroscopy * batterie- test Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.753, year: 2016

Crystal field and magnetism of Pr.sup.3+./sup. and Nd.sup.3+./sup. ions in orthorhombic perovskites

Czech Academy of Sciences Publication Activity Database

Novák, Pavel; Knížek, Karel; Maryško, Miroslav; Jirák, Zdeněk; Kuneš, Jan

2013-01-01

Roč. 25, č. 44 (2013), s. 1-8 ISSN 0953-8984 R&D Projects: GA ČR GA13-25251S; GA ČR GAP204/10/0284; GA ČR(CZ) GAP204/11/0713 Institutional support: RVO:68378271 Keywords : crystal field * rare earth * ab initio method Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.223, year: 2013

Crystal growth and luminescence properties of Yb-doped Gd.sub.3./sub.Al.sub.2./sub.Ga.sub.3./sub.O.sub.12./sub. infra-red scintillator

Czech Academy of Sciences Publication Activity Database

Suzuki, A.; Kurosawa, S.; Nagata, S.; Yamamura, T.; Pejchal, Jan; Yamaji, A.; Yokota, Y.; Shirasaki, K.; Homma, Y.; Aoki, D.; Shikama, T.; Yoshikawa, A.

2014-01-01

Roč. 36, č. 9 (2014), s. 1484-1487 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : infra-red scintillator * radiation therapy * Yb:GAGG * bulk crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

Direct transmission electron microscopy observations of martensitic transformations in Ni-rich NiTi single crystals during in situ cooling and straining

Czech Academy of Sciences Publication Activity Database

Kröger, A.; Dziaszyk, S.; Frenzel, J.; Somsen, Ch.; Dlouhý, Antonín; Eggeler, G.

2008-01-01

Roč. 481, Sp. Iss. (2008), s. 452-456 ISSN 0921-5093. [ESOMAT 2006. Bochum, 10.09.2006-15.09.2006] Institutional research plan: CEZ:AV0Z20410507 Keywords : In situ TEM * NiTi single crystal * Martensitic transformations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.806, year: 2008

Self-assembly of gold nanoparticles as colloidal crystals induced by polymerization of amphiphilic monomers

Czech Academy of Sciences Publication Activity Database

Zucchi, I. A.; Hoppe, C. E.; Galante, M. J.; Williams, R. J. J.; López-Quintela, M. A.; Matějka, Libor; Šlouf, Miroslav; Pleštil, Josef

2008-01-01

Roč. 41, č. 13 (2008), s. 4895-4903 ISSN 0024-9297 R&D Projects: GA AV ČR IAA400500701 Grant - others:National Agency for the Promotion of Science and Technology(AR) PICT03-14738; Ministry of Science and Technology(ES) MAT2005-07554-C02-01 Institutional research plan: CEZ:AV0Z40500505 Keywords : self -assembly * gold nanoparticles * hierarchical structure * colloidal crystals Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.407, year: 2008

Infrared transmission study of Pr.sub.2./sub.CuO.sub.4./sub. crystal-field excitations

Czech Academy of Sciences Publication Activity Database

Riou, G.; Jandl, S.; Poirier, M.; Nekvasil, Vladimír; Diviš, M.; Fournier, P.; Greene, R. L.; Zhigunov, D. I.; Barilo, S. N.

2001-01-01

Roč. 23, - (2001), s. 179-182 ISSN 1434-6028 R&D Projects: GA ČR GA202/00/1602; GA ČR GA202/99/0184 Grant - others:GA UK(XC) 145/2000/B-FYZ; DMR(XX) 9732796 Institutional research plan: CEZ:AV0Z1010914 Keywords : optical properties * crystal and ligand fields * other cuprates Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.811, year: 2001

Characterization of Schiff bases derived from 3,4-dimethoxybenzaldehyde: the crystal structure of n,n′-bis(3,4-dimethoxybenzylidene)-2,2-dimethylpropane-1,3-diamine hydrate

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Foroghnia, A.; Fejfarová, Karla; Dušek, Michal

2013-01-01

Roč. 54, č. 4 (2013), s. 774-778 ISSN 0022-4766 Institutional research plan: CEZ:AV0Z10100521 Keywords : diimine * Schiff base * spectroscopy * single crystal X-ray diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.501, year: 2013

Synthesis and crystal structure of a new N-(2,6-dichlorobenzoyl)-N',N''-bis(pyrrolidinyl)-phosphoric triamide as a carrier and competitive bulk liquid membrane transport of six metal cations

Czech Academy of Sciences Publication Activity Database

Khoshnood, R.S.; Pourayoubi, M.; Kasraee, F.; Toghraee, M.; Dušek, Michal; Bereciartua, P.J.

2014-01-01

Roč. 88, č. 12 (2014), s. 2146-2156 ISSN 0036-0244 Institutional support: RVO:68378271 Keywords : organic membrane * ionic transport * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.562, year: 2014

Impact of particle morphology on structure, crystallization kinetics, and properties of PCL composites with TiO2-based particles

Czech Academy of Sciences Publication Activity Database

Vacková, Taťana; Kratochvíl, Jaroslav; Ostafinska, Aleksandra; Krejčíková, Sabina; Nevoralová, Martina; Šlouf, Miroslav

2017-01-01

Roč. 74, č. 2 (2017), s. 445-464 ISSN 0170-0839 R&D Projects: GA ČR(CZ) GA14-17921S; GA TA ČR(CZ) TE01020118; GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : polycaprolactone composites * crystallization kinetics * matrix degradation Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.430, year: 2016

Forced-ferromagnetic state in a Tm.sub.2./sub.Fe.sub.17./sub.H.sub.5./sub. single crystal

Czech Academy of Sciences Publication Activity Database

Tereshina, Evgeniya; Kuz'min, M.D.; Skourski, Y.; Doerr, M.; Iwasieczko, W.; Wosnitza, J.; Tereshina, I. S.

2017-01-01

Roč. 29, č. 24 (2017), s. 1-6, č. článku 24LT01. ISSN 0953-8984 Institutional support: RVO:68378271 Keywords : single crystal * hydride * forced-ferromagnetic state * rare- earth -iron intermetallic compound Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.649, year: 2016

Fabrication and characterization of solid-core photonic crystal fiber with steering-wheel air-cladding for strong evanescent field overlap

Czech Academy of Sciences Publication Activity Database

Zhu, Y.; Bise, R. T.; Kaňka, Jiří; Peterka, Pavel; Du, H.

Vol. 281, No. 1 (2008), s. 55-60 ISSN 0030-4018 R&D Projects: GA ČR GA102/05/0995 Grant - others:US National Science Foundation(US) ECS-0404002 Institutional research plan: CEZ:AV0Z20670512 Keywords : photonic crystals * fibre optic sensors * optic al fibres Subject RIV: BH - Optic s, Masers, Lasers Impact factor: 1.552, year: 2008

Mesomorphic and structural properties of liquid crystal possessing a chiral lactate unit

Czech Academy of Sciences Publication Activity Database

Das, B.; Pramanik, A.; Das, M.K.; Bubnov, Alexej; Hamplová, Věra; Kašpar, Miroslav

2012-01-01

Roč. 1013, APR (2012), s. 119-125 ISSN 0022-2860 R&D Projects: GA AV ČR IAA100100911; GA AV ČR(CZ) GA202/09/0047; GA ČR(CZ) GAP204/11/0723 Grant - others:RFASI(RU) 02.740.11.5166 Institutional research plan: CEZ:AV0Z10100520 Keywords : liquid crystals * phase transition * N*-TGB A * x-ray diffraction * differential scanning calorimetry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.404, year: 2012 http://www.sciencedirect.com/science/article/pii/S0022286012000440

Single crystal study of layered U.sub.n./sub.RhIn.sub.3n+2./sub. materials: case of the novel U.sub.2./sub.RhIn.sub.8./sub. compound

Czech Academy of Sciences Publication Activity Database

Bartha, A.; Kratochvílová, M.; Dušek, Michal; Diviš, M.; Custers, J.; Sechovský, V.

2015-01-01

Roč. 381, May (2015), s. 310-315 ISSN 0304-8853 Institutional support: RVO:68378271 Keywords : single crystal growth * antiferromagnetism * magnetocrystalline anisotropy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.357, year: 2015

The crystal structure of sopcheite, Ag.sub.4./sub.Pd.sub.3./sub.Te.sub.4./sub., from the Lukkulaisvaara intrusion, Karelia, Russia

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Grokhovskaya, T.L.; Plášil, Jakub; Dušek, Michal; Orsoev, D.A.; Kozlov, V.V.

2017-01-01

Roč. 29, Jun (2017), s. 603-612 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : sopcheite * crystal structure * Ag4Pd3Te4 * platinum-group mineral * silver palladium telluride * X-ray diffraction data * Lukkulaisvaara intrusion Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.362, year: 2016

First Crystal Structures of Mycobacterium tuberculosis 6-Oxopurine Phosphoribosyltransferase: Complexes with GMP and Pyrophosphate and with Acyclic Nucleoside Phosphonates Whose Prodrugs Have Antituberculosis Activity

Czech Academy of Sciences Publication Activity Database

Eng, W. S.; Hocková, Dana; Špaček, Petr; Janeba, Zlatko; West, N. P.; Woods, K.; Naesens, L. M. J.; Keough, D. T.; Guddat, L. W.

2015-01-01

Roč. 58, č. 11 (2015), s. 4822-4838 ISSN 0022-2623 R&D Projects: GA ČR GAP207/11/0108; GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : enzyme inhibitors * nucleotide analogues * tuberculosis * crystal structures Subject RIV: CC - Organic Chemistry Impact factor: 5.589, year: 2015

Complexation of 1,3-dimorpholinopropane with Hg(II) and Zn(II) salts: Synthese, crystal structures and antibacterial studies

Czech Academy of Sciences Publication Activity Database

Goudarziafshar, H.; Yousefi, S.; Abbasityula, Y.; Dušek, Michal; Eigner, Václav; Rezaeivala, M.; Özbek, N.

2015-01-01

Roč. 31, č. 6 (2015), s. 1076-1084 ISSN 1001-4861 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : crystal structure * 1,3-dimorpholinopropane * antibacterial activity * Hg(II) complex * Zn(II) complex Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.488, year: 2015

A new oxidovanadium(IV) Schiff base complex containing asymmetric tetradentate ONN′O′ Schiff base ligand: synthesis, characterization, crystal structure determination, thermal study and catalytic activity

Czech Academy of Sciences Publication Activity Database

Grivani, G.; Ghavami, A.; Eigner, Václav; Dušek, Michal; Khalaji, A.D.

2015-01-01

Roč. 26, č. 6 (2015), s. 779-784 ISSN 1001-8417 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : oxidovanadium(IV) * Schiff base * crystal structure * nanoparticle * epoxidation Subject RIV: CC - Organic Chemistry Impact factor: 1.947, year: 2015

Electro-optic switching and dielectric spectroscopy studies of ferroelectric liquid crystals with low and high spontaneous polarization

Czech Academy of Sciences Publication Activity Database

Malik, P.; Raina, K.K.; Bubnov, Alexej; Choudhary, A.; Singh, R.

Roč. 519, č. 3 ( 2010 ), 1052-1055 ISSN 0040-6090 R&D Projects: GA AV ČR IAA100100911; GA AV ČR(CZ) GA202/09/0047 Grant - others:RFASI(RU) 02.740.11.5166 Institutional research plan: CEZ:AV0Z10100520 Keywords : spontaneous polarization * ferroelectric liquid crystal * relaxation frequency * Goldstone mode Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.909, year: 2010

Numerical analysis and experimental investigation of highly sensitive photonic crystal fiber long-period grating refractive index sensor

Czech Academy of Sciences Publication Activity Database

Zhu, Y.; He, Z.; Kaňka, Jiří; Du, H.

2008-01-01

Roč. 129, č. 1 (2008), s. 99-105 ISSN 0925-4005 R&D Projects: GA MŠk 1P05OC002 Grant - others:National Science Foundation(US) ECS-0404002 Institutional research plan: CEZ:AV0Z20670512 Source of funding: V - iné verejné zdroje Keywords : photonic crystals * Bragg gratings * optical fibres * fibre optic sensors * refractometers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.122, year: 2008

Ductile–brittle behavior at blunted cavities in 3D iron crystals uncovered and covered by copper atoms

Czech Academy of Sciences Publication Activity Database

Pelikán, Vladimír; Hora, Petr; Červená, Olga; Spielmannová, Alena; Machová, Anna

2010-01-01

Roč. 4, č. 2 (2010), s. 191-200 ISSN 1802-680X R&D Projects: GA ČR(CZ) GA101/07/0789; GA AV ČR KJB200760802 Institutional research plan: CEZ:AV0Z20760514 Keywords : molecular dynamics * bcc iron crystal * blunted cavity * copper cover * ductile –brittle behavior Subject RIV: JG - Metallurgy http://www.kme.zcu.cz/acm/index.php/acm/article/view/48

Influence of silver concentration in Ag-x(Sb0.40S0.60)(100-x) thin amorphous films on photoinduced crystallization

Czech Academy of Sciences Publication Activity Database

Gutwirth, J.; Wágner, T.; Bezdička, Petr; Kotulanová, Eva; Vlček, Milan; Kasap, S. O.; Frumar, M.

2007-01-01

Roč. 9, č. 10 (2007), s. 3064-3071 ISSN 1454-4164 R&D Projects: GA MŠk LC523; GA ČR GA203/06/1368 Institutional research plan: CEZ:AV0Z40320502; CEZ:AV0Z40500505 Keywords : Ag-Sb-S films * amorphous * photoinduced crystallization Subject RIV: CA - Inorganic Chemistry Impact factor: 0.827, year: 2007

Effects of Na co-doping on optical and scintillation properties of Eu:LiCaAlF.sub.6./sub. scintillator single crystals

Czech Academy of Sciences Publication Activity Database

Tanaka, Ch.; Yokota, Y.; Kurosawa, S.; Yamaji, A.; Ohashi, Y.; Kamada, K.; Nikl, Martin; Yoshikawa, A.

2017-01-01

Roč. 468, Jun (2017), s. 399-402 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : doping * single crystal growth * lithium compounds * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.751, year: 2016

Ductile-brittle behavior at the (110)[001] crack in bcc iron crystals loaded in mode I

Czech Academy of Sciences Publication Activity Database

Prahl, Jakub; Machová, Anna; Spielmannová, Alena; Karlík, M.; Landa, Michal; Haušild, P.; Lejček, Pavel

2010-01-01

Roč. 77, č. 2 (2010), s. 184-192 ISSN 0013-7944 R&D Projects: GA ČR(CZ) GA101/07/0789; GA AV ČR IAA1010414 Institutional research plan: CEZ:AV0Z20760514; CEZ:AV0Z10100520 Keywords : Fe–3wt.%Si single crystals * crack * dislocation emission * twinning Subject RIV: JG - Metallurgy Impact factor: 1.571, year: 2010 http://journals1.scholarsportal.info/details.xqy?uri=/00137944/v77i0002/184_dbatciiclimi.xml

Crystallization mechanisms of acicular crystals

Science.gov (United States)

Puel, François; Verdurand, Elodie; Taulelle, Pascal; Bebon, Christine; Colson, Didier; Klein, Jean-Paul; Veesler, Stéphane

2008-01-01

In this contribution, we present an experimental investigation of the growth of four different organic molecules produced at industrial scale with a view to understand the crystallization mechanism of acicular or needle-like crystals. For all organic crystals studied in this article, layer-by-layer growth of the lateral faces is very slow and clear, as soon as the supersaturation is high enough, there is competition between growth and surface-activated secondary nucleation. This gives rise to pseudo-twinned crystals composed of several needle individuals aligned along a crystallographic axis; this is explained by regular over- and inter-growths as in the case of twinning. And when supersaturation is even higher, nucleation is fast and random. In an industrial continuous crystallization, the rapid growth of needle-like crystals is to be avoided as it leads to fragile crystals or needles, which can be partly broken or totally detached from the parent crystals especially along structural anisotropic axis corresponding to weaker chemical bonds, thus leading to slower growing faces. When an activated mechanism is involved such as a secondary surface nucleation, it is no longer possible to obtain a steady state. Therefore, the crystal number, size and habit vary significantly with time, leading to troubles in the downstream processing operations and to modifications of the final solid-specific properties. These results provide valuable information on the unique crystallization mechanisms of acicular crystals, and show that it is important to know these threshold and critical values when running a crystallizer in order to obtain easy-to-handle crystals.

ISSN exercise & sport nutrition review: research & recommendations

Science.gov (United States)

2010-01-01

Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1.) The definitional category of ergogenic aids and dietary supplements; 2.) How dietary supplements are legally regulated; 3.) How to evaluate the scientific merit of nutritional supplements; 4.) General nutritional strategies to optimize performance and enhance recovery; and, 5.) An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.

ISSN exercise & sport nutrition review: research & recommendations

Directory of Open Access Journals (Sweden)

Mendel Ron

2010-02-01

Full Text Available Abstract Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1. The definitional category of ergogenic aids and dietary supplements; 2. How dietary supplements are legally regulated; 3. How to evaluate the scientific merit of nutritional supplements; 4. General nutritional strategies to optimize performance and enhance recovery; and, 5. An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.

Transition from ferromagnetism to metamagnetism under pressure in a U.sub.0.94./sub.Y.sub.0.06./sub.CoAl single crystal

Czech Academy of Sciences Publication Activity Database

Andreev, Alexander V.; Koyama, K.; Mushnikov, N. V.; Sechovský, V.; Shiokawa, Y.; Satoh, I.; Watanabe, K.

2007-01-01

Roč. 76, Suppl. A (2007), s. 43-44 ISSN 0031-9015 R&D Projects: GA ČR GA202/06/0178; GA AV ČR(CZ) IAA100100530 Institutional research plan: CEZ:AV0Z10100520 Keywords : uranium intermetallics * single crystals * ferromagnetism * metamagnetism * high pressure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.212, year: 2007

Crystal structure of Fe.sub.2./sub.(AsO.sub.4./sub.)(HAsO.sub.4./sub.)(OH)(H.sub.2./sub.O).sub.3./sub., a dehydration product of kaňkite

Czech Academy of Sciences Publication Activity Database

Majzlan, J.; Palatinus, Lukáš; Plášil, Jakub

2016-01-01

Roč. 28, č. 1 (2016), s. 63-70 ISSN 0935-1221 Institutional support: RVO:68378271 Keywords : arsenate minerals * crystal structure * kaňkite * precession electron diffraction Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.362, year: 2016

Tuning of magnetocaloric effect in a La.sub.0.69./sub.Ca.sub.0.31./sub.MnO.sub.3./sub. single crystal by pressure,

Czech Academy of Sciences Publication Activity Database

Sun, Y.; Kamarád, Jiří; Arnold, Zdeněk; Kou, Z.; Cheng, Z.

2006-01-01

Roč. 88, č. 10 (2006), 102505/1-102505/3 ISSN 0003-6951 R&D Projects: GA ČR(CZ) GA106/06/0368 Institutional research plan: CEZ:AV0Z10100521 Keywords : magnetocaloric effect * pressure effect * manganites * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.977, year: 2006

Synthesis, crystal structure, and spectroscopic characterization of two new binuclear complexes of manganese(II) and vanadium(V) with dipicolinate ligands containing 2-aminopyrimidinium as a counter cation

Czech Academy of Sciences Publication Activity Database

Tabatabaee, M.; Mahmoodikhah, H.; Ahadiat, G.; Dušek, Michal; Pojarová, Michaela

2013-01-01

Roč. 144, č. 5 (2013), s. 621-626 ISSN 0026-9247 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : manganese complex * vanadium complex * dipicolinic ligand * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.347, year: 2013

Temperature dependence of twinning stress – analogy between Cu–Ni–Al and Ni–Mn–Ga shape memory single crystals

Czech Academy of Sciences Publication Activity Database

Vronka, Marek; Seiner, Hanuš; Heczko, Oleg

2017-01-01

Roč. 97, č. 18 (2017), s. 1479-1497 ISSN 1478-6435 R&D Projects: GA ČR GB14-36566G; GA ČR GA15-00262S Institutional support: RVO:68378271 ; RVO:61388998 Keywords : SMA * single crystal * twinning * martensite * twinning stress * temperature dependence Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.505, year: 2016

Growth and radioluminescence of metal elements doped LiCaAlF.sub.6./sub. single crystals for neutron scintillator

Czech Academy of Sciences Publication Activity Database

Tanaka, Ch.; Yokota, Y.; Kurosawa, S.; Yamaji, A.; Jarý, Vítězslav; Babin, Vladimir; Pejchal, Jan; Ohashi, Y.; Kamada, K.; Nikl, Martin; Yoshikawa, A.

2016-01-01

Roč. 90, Jul (2016), s. 170-173 ISSN 1350-4487. [International Conference on Luminescent Detectors and Transformers of Ionizing Radiation (LUMDETR). Tartu (Estonsko), 20.09.2015-25.09.2015] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : neutron scintillator * LiCaAlF 6 * Pb2+ * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

Six-coordinate oxo-vanadium(V) dimer complex with methoxy bridging: synthesis, crystal structure, biological activity and molecular docking

Czech Academy of Sciences Publication Activity Database

Heidari, F.; Fatemi, S.J.A.; Yousef Ebrahimipour, S.; Ebrahimnejad, H.; Castro, J.; Dušek, Michal; Eigner, Václav

2017-01-01

Roč. 76, Feb (2017), s. 1-4 ISSN 1387-7003 R&D Projects: GA MŠk(CZ) LO1603; GA ČR(CZ) GA14-03276S EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : oxo-vanadium(V) * Schiff base complex * antimicrobial activity * X-ray crystal structure Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.640, year: 2016

Gene : CBRC-CJAC-01-0267 [SEVENS

Lifescience Database Archive (English)

Full Text Available ein [Strongylocentrotus purpuratus] 6e-23 26% MRHRDAAGDRRHKLQPGAGRAIGQSACVGPGPSTTPHADSPILLCPSTTPHADCPILLRLSTTPNADCPILLLCPSTTPHADCP...ILLYPSNTPHADCPILLCPSTTPNADCPILLCPSTTPHADCPILLCPSTTPHADCPILFLCPSTTPHADCPSLLYPSNTPHADC...PILLCPSTTPSADCPILLCPSTTPHGDCPILCPSTTPHADCPILLCPCTTPHADCPILLCPSTTSHADCPVLLCPSTXXXXXX

Crystal structure of 2-tert-butyl-2,3-dihydro-1H-benzo[c]pyrrol-1-one

Czech Academy of Sciences Publication Activity Database

Donkeng Dazie, Joel; Ludvík, Jiří; Fábry, Jan; Eigner, Václav

2017-01-01

Roč. 73, č. 8 (2017), s. 1184-1188 ISSN 2056-9890 R&D Projects: GA ČR GA13-21704S; GA MŠk(CZ) LO1603 EU Projects: European Commission(CZ) CZ.2.16/3.1.00/24510 Institutional support: RVO:61388955 ; RVO:68378271 Keywords : crystal structure * aromaticity * heterocyclic compounds Subject RIV: CF - Physical ; Theoretical Chemistry; BM - Solid Matter Physics ; Magnetism (FZU-D) OBOR OECD: Physical chemistry; Condensed matter physics (including formerly solid state physics, supercond.) (FZU-D)

Crystal structure of vanuralite, Al[(UO.sub.2./sub.).sub.2./sub.(VO.sub.4./sub.).sub.2./sub.](OH)• 8.5H.sub.2./sub.O

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub

2017-01-01

Roč. 232, č. 12 (2017), s. 807-814 ISSN 2194-4946 R&D Projects: GA MŠk(CZ) LO1603 Institutional support: RVO:68378271 Keywords : complexity * crystal structure * francevillite topology * uranyl vanadate * vanuralite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.179, year: 2016

A new copper(II) Schiff base complex containing asymmetrical tetradentate N.sub.2./sub.O.sub.2./sub. Schiff base ligand: Synthesis, characterization, crystal structure and DFT study

Czech Academy of Sciences Publication Activity Database

Grivani, G.; Baghan, S.H.; Vakili, M.; Khalaji, A.D.; Tahmasebi, V.; Eigner, Václav; Dušek, Michal

2015-01-01

Roč. 1082, Feb (2015), 91-96 ISSN 0022-2860 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : Schiff-base * copper (II) * complex * single-crystal * thermal decomposition * DFT Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.780, year: 2015

New zinc-glycine-iodide complexes as a product of equilibrium and non-equilibrium crystallization in the Gly – ZnI2 – H2O system

Czech Academy of Sciences Publication Activity Database

Tepavitcharova, S.; Havlíček, D.; Matulková, I.; Rabadjieva, D.; Gergulova, R.; Plocek, Jiří; Němec, I.; Císařová, I.

2016-01-01

Roč. 1120, SEP (2016), s. 42-49 ISSN 0022-2860 Institutional support: RVO:61388980 Keywords : [Zn(gly)I2], [Zn(gly)2I2] * [Zn3(H2O)4(μ-gly)2I6] * Crystal structure * Vibrational spectra * Thermal behaviour Subject RIV: CA - Inorganic Chemistry Impact factor: 1.753, year: 2016

Diamond photonic crystal slab: leaky modes and modified photoluminescence emission of surface-deposited quantum dots

Czech Academy of Sciences Publication Activity Database

Ondič, Lukáš; Babchenko, Oleg; Varga, Marián; Kromka, Alexander; Čtyroký, Jiří; Pelant, Ivan

2012-01-01

Roč. 2, Dec (2012), s. 1-6 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP108/11/0794; GA AV ČR(CZ) IAA101120804; GA AV ČR KJB100100903; GA ČR(CZ) GAP205/10/0046 Grant - others:AVČR(CZ) M100100902 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z20670512 Keywords : photonic crystal * diamond * photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.927, year: 2012 http://www.nature.com/srep/2012/121203/srep00914/full/srep00914.html

Enhanced extraction of silicon-vacancy centers light emission using bottom-up engineered polycrystalline diamond photonic crystal slabs

Czech Academy of Sciences Publication Activity Database

Ondič, Lukáš; Varga, Marián; Hruška, Karel; Fait, J.; Kapusta, Peter

2017-01-01

Roč. 11, č. 3 (2017), s. 2972-2981 ISSN 1936-0851 R&D Projects: GA ČR GJ16-09692Y; GA MŠk LD15003; GA ČR(CZ) GBP208/12/G016 Institutional support: RVO:68378271 ; RVO:61388955 Keywords : photonic crystal * diamond * silicon vacancy center Subject RIV: BM - Solid Matter Physics ; Magnetism; CF - Physical ; Theoretical Chemistry (UFCH-W) OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.); Physical chemistry (UFCH-W) Impact factor: 13.942, year: 2016

Synthesis, characterization and crystal structure determination of a new vanadium(IV) Schiff base complex (VOL.sub.2./sub.) and investigation of its catalytic activity in the epoxidation of cyclooctene

Czech Academy of Sciences Publication Activity Database

Grivani, G.; Tahmasebi, V.; Khalaji, A.D.; Fejfarová, Karla; Dušek, Michal

2013-01-01

Roč. 51, č. 1 (2013), s. 54-60 ISSN 0277-5387 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : vanadium (IV) * Schiff base * single crystal * structure determination * catalysis * epoxidation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.047, year: 2013

Growth and scintillation properties of 3 in. diameter Ce doped Gd.sub.3./sub.Ga.sub.3./sub.Al.sub.2./sub.O.sub.12./sub. scintillation single crystal

Czech Academy of Sciences Publication Activity Database

Kamada, K.; Shoji, Y.; Kochurikhin, V.V.; Okumura, S.; Yamamoto, S.; Nagura, A.; Yeom, J.Y.; Kurosawa, S.; Yokota, Y.; Ohashi, Y.; Nikl, Martin; Yoshikawa, A.

2016-01-01

Roč. 452, Oct (2016), s. 81-84 ISSN 0022-0248. [American Conference on Crystal Growth and Epitaxy /20./ (ACCGE) / 17th Biennial Workshop on Organometallic Vapor Phase Epitaxy (OMVPE) / 2nd 2D Electronic Materials Symposium. Big Sky, MT, 02.08.2015-07.08.2015] R&D Projects: GA MŠk(CZ) LH14266; GA ČR GJ15-18300Y EU Projects: European Commission(XE) 644260 - INTELUM Institutional support: RVO:68378271 Keywords : single crystal growth * oxides * scintillator materials * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.751, year: 2016

Brodtkorbite, Cu.sub.2./sub.HgSe.sub.2./sub., from Příbram, Czech Republic: crystal structure and description

Czech Academy of Sciences Publication Activity Database

Sejkora, J.; Škácha, P.; Laufek, F.; Plášil, Jakub

2017-01-01

Roč. 29, May (2017), s. 663-672 ISSN 0935-1221 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : brodtkorbite * silver mercury selenide * selenide minerals * crystal structure * uranium deposit * Příbram * Czech Republic Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.362, year: 2016

Crystal structures of a yeast 14-3-3 protein from Lachancea thermotolerans in the unliganded form and bound to a human lipid kinase PI4KB-derived peptide reveal high evolutionary conservation

Czech Academy of Sciences Publication Activity Database

Eisenreichová, Andrea; Klíma, Martin; Bouřa, Evžen

2016-01-01

Roč. 72, č. 11 (2016), s. 799-803 ISSN 2053-230X R&D Projects: GA MŠk LO1302 Institutional support: RVO:61388963 Keywords : 14-3-3 proteins * Bmh1 * Bmh2 * crystal structure * phosphopeptide Subject RIV: CE - Biochemistry Impact factor: 0.799, year: 2016

Scintillation properties of Ce doped Gd.sub.2./sub.Lu.sub.1./sub.(Ga,Al).sub.5./sub.O.sub.12./sub. single crystal grown by the micro-pulling-down method

Czech Academy of Sciences Publication Activity Database

Kamada, K.; Yanagida, T.; Pejchal, Jan; Nikl, Martin; Endo, T.; Tsutumi, K.; Usuki, Y.; Fujimoto, Y.; Fukabori, A.; Yoshikawa, A.

2012-01-01

Roč. 352, č. 1 (2012), s. 35-38 ISSN 0022-0248 Grant - others:AV ČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : single crystal growth * oxides * scintillator materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

Computer simulations of X-ray six-beam diffraction in a perfect silicon crystal. I

Czech Academy of Sciences Publication Activity Database

Kohn, V.G.; Khikhlukha, Danila

2016-01-01

Roč. 72, May (2016), s. 349-356 ISSN 2053-2733 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : X-ray diffraction * silicon crystal * six-beam diffraction * section topography * computer simulations Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 5.725, year: 2016

NCBI nr-aa BLAST: CBRC-TTRU-01-0617 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0617 ref|YP_002939996.1| hypothetical protein Kole_0267 [Kosmotoga olea...ria TBF 19.5.1] gb|ACR78992.1| hypothetical protein Kole_0267 [Kosmotoga olearia TBF 19.5.1] YP_002939996.1 0.24 31% ...

Pharmacy (ISSN 2226-4787) — A Journal of Pharmacy Education and Practice

OpenAIRE

Keith A. Wilson; Yvonne Perrie

2013-01-01

Pharmacy (ISSN 2226-4787) — A journal of pharmacy education and practice is an international scientific open access journal on pharmacy education and practice, and is published by MDPI online quarterly. The practice of pharmacy is changing at an unprecedented rate as the profession moves from a focus upon preparation and supply of medicines to a clinical patient-facing role. While an understanding of the science related to medicines remains core to pharmacy education, the changes in practice ...

Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

2014-01-01

Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

The Dominant Role of Chalcogen Bonding in the Crystal Packing of 2D/3D Aromatics

Czech Academy of Sciences Publication Activity Database

Fanfrlík, Jindřich; Přáda, A.; Padělková, Z.; Pecina, Adam; Macháček, Jan; Lepšík, Martin; Holub, Josef; Růžička, A.; Hnyk, Drahomír; Hobza, Pavel

2014-01-01

Roč. 53, č. 38 (2014), s. 10139-10142 ISSN 1433-7851 R&D Projects: GA ČR GBP208/12/G016; GA ČR GAP208/10/2269 Grant - others:GA MŠk(CZ) ED2.1.00/03.0058; GA MŠk(CZ) ED1.1.00/02.0070; GA MŠk(CZ) LM2011033 Program:ED; ED Institutional support: RVO:61388963 ; RVO:61388980 Keywords : boranes * chalcogen bonds * crystal structures * sulfur * X-ray diffraction Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 11.261, year: 2014

Luminescence and charge trapping in Cs.sub.2./sub.HfCl.sub.6./sub. single crystals: optical and magnetic resonance spectroscopy study

Czech Academy of Sciences Publication Activity Database

Král, Robert; Babin, Vladimir; Mihóková, Eva; Buryi, Maksym; Laguta, Valentyn; Nitsch, Karel; Nikl, Martin

2017-01-01

Roč. 121, č. 22 (2017), s. 12375-12382 ISSN 1932-7447 R&D Projects: GA MŠk LO1409; GA ČR GA17-09933S Institutional support: RVO:68378271 Keywords : Cs2HfCl6 * single crystal * luminescence * temperature dependence * EPR spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.536, year: 2016

Electron spin dynamics of Ce.sup.3+./sup. ions in YAG crystals studied by pulse-EPR and pump-probe Faraday rotation

Czech Academy of Sciences Publication Activity Database

Azamat, Dmitry; Belykh, V.V.; Yakovlev, D.R.; Fobbe, F.; Feng, D.H.; Evers, E.; Jastrabík, Lubomír; Dejneka, Alexandr; Bayer, M.

2017-01-01

Roč. 96, č. 7 (2017), s. 1-10, č. článku 075160. ISSN 2469-9950 R&D Projects: GA MŠk LO1409; GA ČR GA16-22092S Institutional support: RVO:68378271 Keywords : electron spin dynamics * Ce 3+ ions * YAG crystals * pulse-EPR * Faraday rotation Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 3.836, year: 2016

Pr.sup.3 +./sup. crystal-field excitation study of apical oxygen and reduction processes in Pr.sub.2 - x./sub.Ce.sub.x./sub.CuO.sub.4±.delta./sub

Czech Academy of Sciences Publication Activity Database

Riou, G.; Richard, P.; Jandl, S.; Poirier, M.; Fournier, P.; Nekvasil, Vladimír; Barilo, S. N.; Kurnevich, L. A.

2004-01-01

Roč. 69, č. 2 (2004), 024511/1-024511/8 ISSN 0163-1829 R&D Projects: GA ČR GA202/03/0552 Institutional research plan: CEZ:AV0Z1010914 Keywords : cuprate superconductors * crystal field * infrared spectra Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.075, year: 2004

Preventing Crystal Agglomeration of Pharmaceutical Crystals Using Temperature Cycling and a Novel Membrane Crystallization Procedure for Seed Crystal Generation

Directory of Open Access Journals (Sweden)

Elena Simone

2018-01-01

Full Text Available In this work, a novel membrane crystallization system was used to crystallize micro-sized seeds of piroxicam monohydrate by reverse antisolvent addition. Membrane crystallization seeds were compared with seeds produced by conventional antisolvent addition and polymorphic transformation of a fine powdered sample of piroxicam form I in water. The membrane crystallization process allowed for a consistent production of pure monohydrate crystals with narrow size distribution and without significant agglomeration. The seeds were grown in 350 g of 20:80 w/w acetone-water mixture. Different seeding loads were tested and temperature cycling was applied in order to avoid agglomeration of the growing crystals during the process. Focused beam reflectance measurement (FBRM; and particle vision and measurement (PVM were used to monitor crystal growth; nucleation and agglomeration during the seeded experiments. Furthermore; Raman spectroscopy was used to monitor solute concentration and estimate the overall yield of the process. Membrane crystallization was proved to be the most convenient and consistent method to produce seeds of highly agglomerating compounds; which can be grown via cooling crystallization and temperature cycling.

Growth and scintillation properties of praseodymium doped (Lu,Gd).sub.3./sub.(Ga,Al).sub.5./sub.O.sub.12./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Kamada, K.; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Yoshikawa, A.

2016-01-01

Roč. 169, Jan (2016), s. 811-815 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : single crystal growth * oxides * scintillators * praseodymium * garnet Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

Monomial Crystals and Partition Crystals

Science.gov (United States)

Tingley, Peter

2010-04-01

Recently Fayers introduced a large family of combinatorial realizations of the fundamental crystal B(Λ0) for ^sln, where the vertices are indexed by certain partitions. He showed that special cases of this construction agree with the Misra-Miwa realization and with Berg's ladder crystal. Here we show that another special case is naturally isomorphic to a realization using Nakajima's monomial crystal.

Thermodynamics, stability, crystal structure, and phase relations among euchroite, Cu.sub.2./sub.(AsO.sub.4./sub.)(OH)ˑ3H.sub.2./sub.O, and related minerals

Czech Academy of Sciences Publication Activity Database

Majzlan, J.; Števko, M.; Dachs, E.; Benisek, A.; Plášil, Jakub; Sejkora, J.

2017-01-01

Roč. 29, č. 1 (2017), s. 5-16 ISSN 0935-1221 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : euchroite * paragenesis * oxidation zone * thermodynamics * crystal chemistry Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 1.362, year: 2016

Infrared transmission study of crystal-field excitation in La.sub.2-x-y./sub.Nd.sub.x./sub.Sr.sub.y./sub.CuO.sub.4./sub..

Czech Academy of Sciences Publication Activity Database

Riou, G.; Jandl, S.; Poirier, M.; Nekvasil, Vladimír; Maryško, Miroslav; Fábry, Jan; Jurek, Karel; Diviš, M.; Hölsä, J.; Sutjahja, I. M.; Menovsky, A. A.; Barilo, S. N.; Shiryaev, S. V.; Kurnevich, L. N.

2002-01-01

Roč. 66, - (2002), s. 224508-1 - 221508-7 ISSN 0163-1829 R&D Projects: GA ČR GA202/00/1602; GA ČR GA203/02/0436 Institutional research plan: CEZ:AV0Z1010914 Keywords : cuprate superconductors * level splitting * interactions * crystal-field theory * rare-earth magnetism Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.327, year: 2002

Unifying the crystallization behavior of hexagonal and square crystals with the phase-field-crystal model

International Nuclear Information System (INIS)

Yang Tao; Chen Zheng; Zhang Jing; Wang Yongxin; Lu Yanli

2016-01-01

By employing the phase-field-crystal models, the atomic crystallization process of hexagonal and square crystals is investigated with the emphasis on the growth mechanism and morphological change. A unified regime describing the crystallization behavior of both crystals is obtained with the thermodynamic driving force varying. By increasing the driving force, both crystals (in the steady-state) transform from a faceted polygon to an apex-bulged polygon, and then into a symmetric dendrite. For the faceted polygon, the interface advances by a layer-by-layer (LL) mode while for the apex-bulged polygonal and the dendritic crystals, it first adopts the LL mode and then transits into the multi-layer (ML) mode in the later stage. In particular, a shift of the nucleation sites from the face center to the area around the crystal tips is detected in the early growth stage of both crystals and is rationalized in terms of the relation between the crystal size and the driving force distribution. Finally, a parameter characterizing the complex shape change of square crystal is introduced. (paper)

Synthesis, characterization and computational studies of zinc(ii)-halide complexes with a bidentate Schiff base ligand (2,5-MeO-ba).sub.2./sub.En: the crystal structure of (2,5-MeO-ba).sub.2./sub.En

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Mighani, H.; Gholinejad, M.; Grivani, G.; Jalali Akerdi, S.; Fejfarová, Karla; Dušek, Michal

2013-01-01

Roč. 54, č. 4 (2013), s. 766-773 ISSN 0022-4766 Institutional research plan: CEZ:AV0Z10100521 Keywords : zinc(II) halides * Schiff base * crystal structure * density functional theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.501, year: 2013

Effect of alkyl chains length on properties of ferroelectric liquid crystals with the keto group attached to the molecule core

Czech Academy of Sciences Publication Activity Database

Bubnov, Alexej; Novotná, Vladimíra; Pociecha, D.; Hamplová, Věra; Kašpar, Miroslav

2012-01-01

Roč. 85, č. 10 (2012), s. 849-860 ISSN 0141-1594 R&D Projects: GA ČR(CZ) GAP204/11/0723 Grant - others:AV ČR(CZ) M100101211; AV ČR(CZ) M100101204 Institutional research plan: CEZ:AV0Z10100520 Keywords : ferroelectric liquid crystal * keto group * lactic acid derivative * spontaneous quantities * SAXS * helix pitch Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.863, year: 2012 http://www.tandf.co.uk/journals/titles/01411594.asp

The effect of athermal and isothermal omega phase particles on elasticity of beta-Ti single crystals

Czech Academy of Sciences Publication Activity Database

Nejezchlebová, J.; Janovská, Michaela; Seiner, Hanuš; Sedlák, Petr; Landa, Michal; Šmilauerová, J.; Stráský, J.; Harcuba, P.; Janeček, M.

2016-01-01

Roč. 110, May (2016), s. 185-191 ISSN 1359-6454 R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61388998 Keywords : titanium alloys * omega phase * elastic constants * single crystals * resonant ultrasound spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.301, year: 2016 http://ac.els-cdn.com/S1359645416301860/1-s2.0-S1359645416301860-main.pdf?_tid=dca8c8e6-017d-11e6-8121-00000aab0f27&acdnat=1460555256_4439abe9d4826c07f29d02804351d7be

Crystal field effect on the f-levels of R.sub.1+x./sub.Ba.sub.2-x./sub.Cu.sub.3./sub.O.sub.6+ë./sub..

Czech Academy of Sciences Publication Activity Database

Nekvasil, Vladimír; Jandl, S.; Barba, D.; Martin, A. A.; Cardona, M.; Diviš, E.; Maryško, Miroslav; Wolf, T.

226-230, - (2001), s. 985-987 ISSN 0304-8853 R&D Projects: GA ČR GA202/99/0184; GA ČR GA202/00/1602 Grant - others:FAPESP(BR) 98/14624-4 Institutional research plan: CEZ:A02/98:Z1-010-914 Keywords : crystal field * magnetic susceptibility * high Tc superconductivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.329, year: 2001

Luminescent properties of Cr-doped (Gd.sub.x./sub., Y.sub.1-x./sub.).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. infra-red scintillator crystals

Czech Academy of Sciences Publication Activity Database

Suzuki, A.; Kurosawa, S.; Yamaji, A.; Shoji, Y.; Pejchal, Jan; Kamada, K.; Yokota, Y.; Yoshikawa, A.

2014-01-01

Roč. 36, č. 12 (2014), s. 1938-1941 ISSN 0925-3467. [International Symposium on Laser, Scintillator and Non Linear Optical Materials (ISLNOM) /6./. Shanghai, 20.10.2013-23.10.2013] Institutional support: RVO:68378271 Keywords : infra-red scintillator * patient dosimetry * Cr-doped oxide garnet * bulk crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

Photonic time crystals.

Science.gov (United States)

Zeng, Lunwu; Xu, Jin; Wang, Chengen; Zhang, Jianhua; Zhao, Yuting; Zeng, Jing; Song, Runxia

2017-12-07

When space (time) translation symmetry is spontaneously broken, the space crystal (time crystal) forms; when permittivity and permeability periodically vary with space (time), the photonic crystal (photonic time crystal) forms. We proposed the concept of photonic time crystal and rewritten the Maxwell's equations. Utilizing Finite Difference Time Domain (FDTD) method, we simulated electromagnetic wave propagation in photonic time crystal and photonic space-time crystal, the simulation results show that more intensive scatter fields can obtained in photonic time crystal and photonic space-time crystal.

Virtual Crystallizer

Energy Technology Data Exchange (ETDEWEB)

Land, T A; Dylla-Spears, R; Thorsness, C B

2006-08-29

Large dihydrogen phosphate (KDP) crystals are grown in large crystallizers to provide raw material for the manufacture of optical components for large laser systems. It is a challenge to grow crystal with sufficient mass and geometric properties to allow large optical plates to be cut from them. In addition, KDP has long been the canonical solution crystal for study of growth processes. To assist in the production of the crystals and the understanding of crystal growth phenomena, analysis of growth habits of large KDP crystals has been studied, small scale kinetic experiments have been performed, mass transfer rates in model systems have been measured, and computational-fluid-mechanics tools have been used to develop an engineering model of the crystal growth process. The model has been tested by looking at its ability to simulate the growth of nine KDP boules that all weighed more than 200 kg.

Reinvestigation of the crystal structure of kasolite, Pb[(UO.sub.2./sub.)(SiO.sub.4./sub.)](H.sub.2./sub.O), an important alteration product of uraninite, UO.sub.2-x./sub..

Czech Academy of Sciences Publication Activity Database

Fejfarová, Karla; Dušek, Michal; Plášil, J.; Čejka, J.; Sejkora, J.; Škoda, R.

2013-01-01

Roč. 434, 1-3 (2013), s. 461-467 ISSN 0022-3115 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : uranyl silicate * kasolite * crystal structure * spent nuclear fuel Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.016, year: 2013

Amine free crystal structure: The crystal structure of d(CGCGCG)2 and methylamine complex crystal

International Nuclear Information System (INIS)

Ohishi, Hirofumi; Tsukamoto, Koji; Hiyama, Yoichi; Maezaki, Naoyoshi; Tanaka, Tetsuaki; Ishida, Toshimasa

2006-01-01

We succeeded in the crystallization of d(CGCGCG) 2 and methylamine Complex. The crystal was clear and of sufficient size to collect the X-ray crystallographic data up to 1.0 A resolution using synchrotron radiation. As a result of X-ray crystallographic analysis of 2F o - F c map was much clear and easily traced. It is First time monoamine co-crystallizes with d(CGCGCG) 2 . However, methylamine was not found from the complex crystal of d(CGCGCG) 2 and methylamine. Five Mg ions were found around d(CGCGCG) 2 molecules. These Mg ions neutralized the anion of 10 values of the phosphate group of DNA with five Mg 2+ . DNA stabilized only by a metallic ion and there is no example of analyzing the X-ray crystal structure like this. Mg ion stabilizes the conformation of Z-DNA. To use monoamine for crystallization of DNA, we found that we can get only d(CGCGCG) 2 and Mg cation crystal. Only Mg cation can stabilize the conformation of Z-DNA. The method of using the monoamine for the crystallization of DNA can be applied to the crystallization of DNA of long chain of length in the future like this

Crystal Growth Technology

Science.gov (United States)

Scheel, Hans J.; Fukuda, Tsuguo

2004-06-01

This volume deals with the technologies of crystal fabrication, of crystal machining, and of epilayer production and is the first book on industrial and scientific aspects of crystal and layer production. The major industrial crystals are treated: Si, GaAs, GaP, InP, CdTe, sapphire, oxide and halide scintillator crystals, crystals for optical, piezoelectric and microwave applications and more. Contains 29 contributions from leading crystal technologists covering the following topics: General aspects of crystal growth technology Silicon Compound semiconductors Oxides and halides Crystal machining Epitaxy and layer deposition Scientific and technological problems of production and machining of industrial crystals are discussed by top experts, most of them from the major growth industries and crystal growth centers. In addition, it will be useful for the users of crystals, for teachers and graduate students in materials sciences, in electronic and other functional materials, chemical and metallurgical engineering, micro-and optoelectronics including nanotechnology, mechanical engineering and precision-machining, microtechnology, and in solid-state sciences.

Principles of crystallization, and methods of single crystal growth

International Nuclear Information System (INIS)

Chacra, T.

2010-01-01

Most of single crystals (monocrystals), have distinguished optical, electrical, or magnetic properties, which make from single crystals, key elements in most of technical modern devices, as they may be used as lenses, Prisms, or grating sin optical devises, or Filters in X-Ray and spectrographic devices, or conductors and semiconductors in electronic, and computer industries. Furthermore, Single crystals are used in transducer devices. Moreover, they are indispensable elements in Laser and Maser emission technology.Crystal Growth Technology (CGT), has started, and developed in the international Universities and scientific institutions, aiming at some of single crystals, which may have significant properties and industrial applications, that can attract the attention of international crystal growth centers, to adopt the industrial production and marketing of such crystals. Unfortunately, Arab universities generally, and Syrian universities specifically, do not give even the minimum interest, to this field of Science.The purpose of this work is to attract the attention of Crystallographers, Physicists and Chemists in the Arab universities and research centers to the importance of crystal growth, and to work on, in the first stage to establish simple, uncomplicated laboratories for the growth of single crystal. Such laboratories can be supplied with equipment, which are partly available or can be manufactured in the local market. Many references (Articles, Papers, Diagrams, etc..) has been studied, to conclude the most important theoretical principles of Phase transitions,especially of crystallization. The conclusions of this study, are summarized in three Principles; Thermodynamic-, Morphologic-, and Kinetic-Principles. The study is completed by a brief description of the main single crystal growth methods with sketches, of equipment used in each method, which can be considered as primary designs for the equipment, of a new crystal growth laboratory. (author)

Crystal structure of chlorido{[3-(eta(5)-cyclopenta-dienyl)-2,2,3-trimethyl-1-phenylbutylidene]azanido-kappa N}[eta(2)(N,O)-N,N-dimethylhydroxyl-aminato]titanium(IV), C20H27ClN2OTi

Czech Academy of Sciences Publication Activity Database

Večeřa, M.; Gyepes, R.; Lamač, Martin

2017-01-01

Roč. 232, č. 3 (2017), s. 457-459 ISSN 1433-7266 R&D Projects: GA ČR(CZ) GA14-08531S Institutional support: RVO:61388955 Keywords : crystal structure * C20H27ClN2OTi * physical chemistry Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 0.152, year: 2016

Hydroniumjarosite, (H.sub.3./sub.O).sup.+./sup.Fe.sub.3./sub.(SO.sub.4./sub.).sub.2./sub.(OH).sub.6./sub., from Cerros Pintados, Chile: single-crystal X-ray diffraction and vibrational spectroscopic study

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Škoda, R.; Fejfarová, Karla; Čejka, J.; Kasatkin, A.V.; Dušek, Michal; Talla, D.; Lapčák, L.; Machovič, V.; Dini, M.

2014-01-01

Roč. 78, č. 3 (2014), s. 535-547 ISSN 0026-461X R&D Projects: GA ČR GP13-31276P Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : hydroniumjarosite * H3O + * crystal structure * vibrational spectroscopy * X-ray diffraction Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.026, year: 2014

The Crystal Hotel: A Microfluidic Approach to Biomimetic Crystallization.

Science.gov (United States)

Gong, Xiuqing; Wang, Yun-Wei; Ihli, Johannes; Kim, Yi-Yeoun; Li, Shunbo; Walshaw, Richard; Chen, Li; Meldrum, Fiona C

2015-12-02

A "crystal hotel" microfluidic device that allows crystal growth in confined volumes to be studied in situ is used to produce large calcite single crystals with predefined crystallographic orientation, microstructure, and shape by control of the detailed physical environment, flow, and surface chemistry. This general approach can be extended to form technologically important, nanopatterned single crystals. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Carboxylic acids in crystallization of macromolecules: learning from successful crystallization experiments.

Science.gov (United States)

Offermann, Lesa R; He, John Z; Mank, Nicholas J; Booth, William T; Chruszcz, Maksymilian

2014-03-01

The production of macromolecular crystals suitable for structural analysis is one of the most important and limiting steps in the structure determination process. Often, preliminary crystallization trials are performed using hundreds of empirically selected conditions. Carboxylic acids and/or their salts are one of the most popular components of these empirically derived crystallization conditions. Our findings indicate that almost 40 % of entries deposited to the Protein Data Bank (PDB) reporting crystallization conditions contain at least one carboxylic acid. In order to analyze the role of carboxylic acids in macromolecular crystallization, a large-scale analysis of the successful crystallization experiments reported to the PDB was performed. The PDB is currently the largest source of crystallization data, however it is not easily searchable. These complications are due to a combination of a free text format, which is used to capture information on the crystallization experiments, and the inconsistent naming of chemicals used in crystallization experiments. Despite these difficulties, our approach allows for the extraction of over 47,000 crystallization conditions from the PDB. Initially, the selected conditions were investigated to determine which carboxylic acids or their salts are most often present in crystallization solutions. From this group, selected sets of crystallization conditions were analyzed in detail, assessing parameters such as concentration, pH, and precipitant used. Our findings will lead to the design of new crystallization screens focused around carboxylic acids.

On dewetting of thin films due to crystallization (crystallization dewetting).

Science.gov (United States)

Habibi, Mehran; Rahimzadeh, Amin; Eslamian, Morteza

2016-03-01

Drying and crystallization of a thin liquid film of an ionic or a similar solution can cause dewetting in the resulting thin solid film. This paper aims at investigating this type of dewetting, herein termed "crystallization dewetting", using PbI2 dissolved in organic solvents as the model solution. PbI2 solid films are usually used in X-ray detection and lead halide perovskite solar cells. In this work, PbI2 films are fabricated using spin coating and the effect of major parameters influencing the crystallization dewetting, including the type of the solvent, solution concentration, drying temperature, spin speed, as well as imposed vibration on the substrate are studied on dewetting, surface profile and coverage, using confocal scanning laser microscopy. Simplified hydrodynamic governing equations of crystallization in thin films are presented and using a mathematical representation of the process, it is phenomenologically demonstrated that crystallization dewetting occurs due to the absorption and consumption of the solution surrounding a growing crystal. Among the results, it is found that a low spin speed (high thickness), a high solution concentration and a low drying temperature promote crystal growth, and therefore crystallization dewetting. It is also shown that imposed vibration on the substrate can affect the crystal size and crystallization dewetting.

The Morse code effect: A crystal-crystal transformation observed in gel-grown lead (II) oxalate crystals

Science.gov (United States)

Lisgarten, J. N.; Marks, J. A.

2018-05-01

This paper reports on an unusual crystal-crystal transformation phenomenon, which we have called the Morse Code Effect, based on the change in appearance of lead(II) oxalate crystals grown in agarose gels.

Pinning performance of (Nd.sub.0.33./sub.Eu.sub.0.2./sub.Gd.sub.0.47./sub.)Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. single crystal

Czech Academy of Sciences Publication Activity Database

Jirsa, Miloš; Rameš, Michal; Das, P.; Koblischka, M.R.; Wolf, T.; Hartmann, U.

-, č. 3 (2008), s. 1-6 ISSN N. [European Conference on Applied Superconductivity /8./ - EUCAS 2007. Brussels, 16.09.2007-20.09.2007] R&D Projects: GA ČR GA202/05/0173; GA MŠk 1P05ME728 Institutional research plan: CEZ:AV0Z10100520 Keywords : vortex pinning * high-Tc superconductors * ternary superconductors * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism

crystal

Science.gov (United States)

Yu, Yi; Huang, Yisheng; Zhang, Lizhen; Lin, Zhoubin; Sun, Shijia; Wang, Guofu

2014-07-01

A Nd3+:Na2La4(WO4)7 crystal with dimensions of ϕ 17 × 30 mm3 was grown by the Czochralski method. The thermal expansion coefficients of Nd3+:Na2La4(WO4)7 crystal are 1.32 × 10-5 K-1 along c-axis and 1.23 × 10-5 K-1 along a-axis, respectively. The spectroscopic characteristics of Nd3+:Na2La4(WO4)7 crystal were investigated. The Judd-Ofelt theory was applied to calculate the spectral parameters. The absorption cross sections at 805 nm are 2.17 × 10-20 cm2 with a full width at half maximum (FWHM) of 15 nm for π-polarization, and 2.29 × 10-20 cm2 with a FWHM of 14 nm for σ-polarization. The emission cross sections are 3.19 × 10-20 cm2 for σ-polarization and 2.67 × 10-20 cm2 for π-polarization at 1,064 nm. The fluorescence quantum efficiency is 67 %. The quasi-cw laser of Nd3+:Na2La4(WO4)7 crystal was performed. The maximum output power is 80 mW. The slope efficiency is 7.12 %. The results suggest Nd3+:Na2La4(WO4)7 crystal as a promising laser crystal fit for laser diode pumping.

The crystal structure of franckeite, Pb.sub.21.7./sub.Sn.sub.9.3./sub.Fe.sub.4.0./sub.Sb.sub.8.1./sub.S.sub.56.9./sub..

Czech Academy of Sciences Publication Activity Database

Makovicky, E.; Petříček, Václav; Dušek, Michal; Topa, D.

2011-01-01

Roč. 96, 11-12 (2011), s. 1686-1702 ISSN 0003-004X Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : franckeite * Pb-Sn-Sb-Fe sulfide * modulated layer-misfit crystal structure * 2D–non-commensurate layer structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2011

Crystal growth and characterization of new semiorganic nonlinear optical single crystals

Energy Technology Data Exchange (ETDEWEB)

Kulshrestha, Shobha, E-mail: shobha011986@gmail.com; Shrivastava, A. K., E-mail: ashwaniaks@rediffmail.com [School of Studies in Physics, Jiwaji University Gwalior (M.P.) – 474 011 (India)

2016-05-06

An organic material of a L-histidine monohydrochloride single crystal was grown in a distilled water solution using the slow evaporation method at 40–45°C. The grown crystal was transparent and colourless, with a size of about 20 × 9 × 5 mm{sup 3}, obtained within a period of 21 days. The solubility of grown crystals have found out at various temperatures. The UV-visible transmittance studies show that the grown crystals have wide optical transparency in the entire visible region It is observed that the crystal has transparency window from 255nm to 700nm and its energy gap (Eg) found to be is 3.1eV. The grown crystal was subjected to powder X-ray diffraction analysis, confirming that the orthorhombic crystalline nature of the crystal. To identify the surface morphology, the as grown crystal was subjected to FE-SEM technique. The chemical composition of the grown crystal was estimated by Energy dispersive X-ray analysis. The optical behaviour of the grown crystal was analyzed by PL study.

Analysis of laser-generated plasma ionizing radiation by synthetic single crystal diamond detectors

Czech Academy of Sciences Publication Activity Database

Marinelli, M.; Milani, E.; Prestopino, G.; Verona, C.; Verona-Rinati, G.; Cutroneo, M.; Torrisi, L.; Margarone, Daniele; Velyhan, Andriy; Krása, Josef; Krouský, Eduard

2013-01-01

Roč. 272, May (2013), s. 104-108 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087; GA MŠk(CZ) 7E09092; GA MŠk(CZ) LC528 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OPVK 3 Laser Zdroj(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; 7FP LASERLAB-EUROPE(XE) 228334 Program:EE; FP7 Institutional support: RVO:68378271 Keywords : single crystal diamond * diamond detector * laser-generated plasma * ionizing radiation * time-of-fight spectrometer Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

RNA Crystallization

Science.gov (United States)

Golden, Barbara L.; Kundrot, Craig E.

2003-01-01

RNA molecules may be crystallized using variations of the methods developed for protein crystallography. As the technology has become available to syntheisize and purify RNA molecules in the quantities and with the quality that is required for crystallography, the field of RNA structure has exploded. The first consideration when crystallizing an RNA is the sequence, which may be varied in a rational way to enhance crystallizability or prevent formation of alternate structures. Once a sequence has been designed, the RNA may be synthesized chemically by solid-state synthesis, or it may be produced enzymatically using RNA polymerase and an appropriate DNA template. Purification of milligram quantities of RNA can be accomplished by HPLC or gel electrophoresis. As with proteins, crystallization of RNA is usually accomplished by vapor diffusion techniques. There are several considerations that are either unique to RNA crystallization or more important for RNA crystallization. Techniques for design, synthesis, purification, and crystallization of RNAs will be reviewed here.

A crystal barrel

CERN Multimedia

2007-01-01

The production of crystals for the barrel of the CMS electromagnetic calorimeter has been completed. This is an important milestone for the experiment, which received the last of its 62,960 crystals on 9 March. The members of the team responsible for the crystal acceptance testing at CERN display the last crystal for the CMS electromagnetic calorimeter barrel. From left to right: Igor Tarasov, Etiennette Auffray and Hervé Cornet.One of the six machines specially developed to measure 67 different parameters on each crystal. Igor Tarasov is seen inserting the last batch of crystals into the machine. The last of the 62,960 CMS barrel crystals arrived at CERN on 9 March. Once removed from its polystyrene protection, this delicate crystal, like thousands of its predecessors, will be inserted into the last of the 36 supermodules of the barrel electromagnetic calorimeter in a few days' time. This marks the end of an important chapter in an almost 15-year-long journey by the CMS crystals team, some of whose member...

Crystal structure of NaCd(H.sub.2./sub.PO.sub.3./sub.).sub.3./sub..H.sub.2./sub.O and spectroscopic study of NaM(H.sub.2./sub.PO.sub.3./sub.).sub.3./sub..H.sub.2./sub.O, M = Mn, Co, Ni, Zn, Mg and Cd

Czech Academy of Sciences Publication Activity Database

Ouarsal, R.; Lachkar, M.; Dušek, Michal; Albert, E.B.; Castelló, J.B.C.; El Bali, B.

2016-01-01

Roč. 106, Feb (2016), 132-137 ISSN 0277-5387 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : transition metal * phosphite * crystal structure * spectroscopy * d-d transitions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.926, year: 2016

Syntheses and properties of binuclear copper(II) mixed-ligand complexes involving thiodiglycolic acid. The crystal structures of [(phen)2Cu(m-tdga)Cu(phen)](NO3)2x5H2O and [(H2O)(pmdien)Cu(micro-tdga)Cu(pmdien)(H2O)](ClO4)

Czech Academy of Sciences Publication Activity Database

Kopel, P.; Trávníček, Zdeněk; Marek, J.; Korabik, M.; Mrozinski, J.

2003-01-01

Roč. 22, - (2003), s. 411-418 ISSN 0277-5387 R&D Projects: GA ČR GA203/99/0067 Institutional research plan: CEZ:AV0Z5038910 Keywords : Copper(II) * Thiodiglycolic acid complexes * Crystal structures Subject RIV: CE - Biochemistry Impact factor: 1.584, year: 2003

Effects of impurities on crystal growth in fructose crystallization

Science.gov (United States)

Chu, Y. D.; Shiau, L. D.; Berglund, K. A.

1989-10-01

The influence of impurities on the crystallization of anhydrous fructose from aqueous solution was studied. The growth kinetics of fructose crystals in the fructose-water-glucose and fructose-water-difructose dianhydrides systems were investigated using photomicroscopic contact nucleation techniques. Glucose is the major impurity likely to be present in fructose syrup formed during corn wet milling, while several difructose dianhydrides are formed in situ under crystallization conditions and have been proposed as a cause in the decrease of overall yields. Both sets of impurities were found to cause inhibition of crystal growth, but the mechanisms responsible in each case are different. It was found that the presence of glucose increases the solubility of fructose in water and thus lowers the supersaturation of the solution. This is probably the main effect responsible for the decrease of crystal growth. Since the molecular structures of difructose dianhydrides are similar to that of fructose, they are probably "tailor-made" impurities. The decrease of crystal growth is probably caused by the incorporation of these impurities into or adsorption to the crystal surface which would accept fructose molecules in the orientation that existed in the difructose dianhydride.

MyCrystals - a simple visual data management program for laboratory-scale crystallization experiments

DEFF Research Database (Denmark)

Løvgreen, Monika Nøhr; Løvgreen, Mikkel; Christensen, Hans Erik Mølager

2009-01-01

MyCrystals is designed as a user-friendly program to display crystal images and list crystallization conditions. The crystallization conditions entry fields can be customized to suit the experiments. MyCrystals is also able to sort the images by the entered crystallization conditions, which...

Pinning performance of (Nd.sub.0.33./sub.Eu.sub.0.2./sub.Gd.sub.0.47./sub.)Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. single crystal

Czech Academy of Sciences Publication Activity Database

Jirsa, Miloš; Rameš, Michal; Das, P.; Koblischka, M.R.; Wolf, T.; Hartmann, U.

2008-01-01

Roč. 97, - (2008), 012191/1-012191/5 ISSN 1742-6588. [European Conference on Applied Superconductivity /8./ - EUCAS 2007. Brussels, 16.09.2007-20.09.2007] R&D Projects: GA ČR GA202/05/0173; GA MŠk 1P05ME728 Institutional research plan: CEZ:AV0Z10100520 Keywords : vortex pinning * high-Tc superconductors * ternary superconductors * single crystal Subject RIV: BM - Solid Matter Physics ; Magnetism

Crystal structure and magnetic susceptibility of UOSe single crystals

International Nuclear Information System (INIS)

Kaczorowski, D.; Muenster Univ.; Poettgen, R.; Jeitschko, W.; Gajek, Z.; Zygmunt, A.

1993-01-01

The crystal structure and magnetic susceptibility behaviour of UOSe single crystals have been studied. UOSe crystalizes in the tetragonal PbFC1-type structure (space group P4/nmm) with the lattice parameters: a = 390.38(5) pm and c = 698.05(9) pm. It orders antiferromagnetically at T N =100±2 K and exhibits a very strong anisotropy in the susceptibility vs temperature variation. The magnetic and thermodynamic properties of UOSe are successfully interpreted in the framework of a perturbative ab initio crystal field approach. (Author)

Crystal structure and magnetic susceptibility of UOSe single crystals

Energy Technology Data Exchange (ETDEWEB)

Kaczorowski, D. (Polish Academy of Sciences, Wroclaw (Poland). Inst. for Low Temperature and Structure Research Muenster Univ. (Germany). Anorganisch-Chemisches Inst.); Poettgen, R.; Jeitschko, W. (Muenster Univ. (Germany). Anorganisch-Chemisches Inst.); Gajek, Z.; Zygmunt, A. (Polish Academy of Sciences, Wroclaw (Poland). Inst. for Low Temperature and Structure Research)

1993-01-01

The crystal structure and magnetic susceptibility behaviour of UOSe single crystals have been studied. UOSe crystalizes in the tetragonal PbFC1-type structure (space group P4/nmm) with the lattice parameters: a = 390.38(5) pm and c = 698.05(9) pm. It orders antiferromagnetically at T[sub N]=100[+-]2 K and exhibits a very strong anisotropy in the susceptibility vs temperature variation. The magnetic and thermodynamic properties of UOSe are successfully interpreted in the framework of a perturbative ab initio crystal field approach. (Author).

Nanoparticles in liquid crystals, and liquid crystals in nanoparticles

Science.gov (United States)

de Pablo, Juan

2015-03-01

Liquid crystals are remarkably sensitive to interfacial interactions. Small perturbations at a liquid crystal interface, for example, can be propagated over relatively long length scales, thereby providing the basis for a wide range of applications that rely on amplification of molecular events into macroscopic observables. Our recent research efforts have focused on the reverse phenomenon; that is, we have sought to manipulate the interfacial assembly of nanoparticles or the organization of surface active molecules by controlling the structure of a liquid crystal. This presentation will consist of a review of the basic principles that are responsible for liquid crystal-mediated interactions, followed by demonstrations of those principles in the context of two types of systems. In the first, a liquid crystal is used to direct the assembly of nanoparticles; through a combination of molecular and continuum models, it is found that minute changes in interfacial energy and particle size lead to liquid-crystal induced attractions that can span multiple orders of magnitude. Theoretical predictions are confirmed by experimental observations, which also suggest that LC-mediated assembly provides an effective means for fabrication of plasmonic devices. In the second type of system, the structure of a liquid crystal is controlled by confinement in submicron droplets. The morphology of the liquid crystal in a drop depends on a delicate balance between bulk and interfacial contributions to the free energy; that balance can be easily perturbed by adsorption of analytes or nanoparticles at the interface, thereby providing the basis for development of hierarchical assembly of responsive, anisotropic materials. Theoretical predictions also indicate that the three-dimensional order of a liquid crystal can be projected onto a two-dimensional interface, and give rise to novel nanostructures that are not found in simple isotropic fluids.

Second crystal cooling on cryogenically cooled undulator and wiggler double crystal monochromators

International Nuclear Information System (INIS)

Knapp, G. S.

1998-01-01

Simple methods for the cooling of the second crystals of cryogenically cooled undulator and wiggler double crystal monochromators are described. Copper braids between the first and second crystals are used to cool the second crystals of the double crystal monochromators. The method has proved successful for an undulator monochromator and we describe a design for a wiggler monochromator

Realisation of a novel crystal bender for a fast double crystal monochromator

CERN Document Server

Zaeper, R; Wollmann, R; Luetzenkirchen-Hecht, D; Frahm, R

2001-01-01

A novel crystal bender for an X-ray undulator beamline as part of a fast double crystal monochromator development for full EXAFS energy range was characterized. Rocking curves of the monochromator crystal system were recorded under different heat loads and bending forces of the indirectly cooled first Si(1 1 1) crystal. The monochromator development implements new piezo-driven tilt tables with wide angular range to adjust the crystals' Bragg angles and a high pressure actuated bender mechanism for the first crystal.

A Test of Macromolecular Crystallization in Microgravity: Large, Well-Ordered Insulin Crystals

Science.gov (United States)

Borgstahl, Gloria E. O.; Vahedi-Faridi, Ardeschir; Lovelace, Jeff; Bellamy, Henry D.; Snell, Edward H.; Whitaker, Ann F. (Technical Monitor)

2001-01-01

Crystals of insulin grown in microgravity on space shuttle mission STS-95 were extremely well-ordered and unusually large (many > 2 mm). The physical characteristics of six microgravity and six earth-grown crystals were examined by X-ray analysis employing superfine f slicing and unfocused synchrotron radiation. This experimental setup allowed hundreds of reflections to be precisely examined for each crystal in a short period of time. The microgravity crystals were on average 34 times larger, had 7 times lower mosaicity, had 54 times higher reflection peak heights and diffracted to significantly higher resolution than their earth grown counterparts. A single mosaic domain model could account for reflections in microgravity crystals whereas reflections from earth crystals required a model with multiple mosaic domains. This statistically significant and unbiased characterization indicates that the microgravity environment was useful for the improvement of crystal growth and resultant diffraction quality in insulin crystals and may be similarly useful for macromolecular crystals in general.

Protein Crystal Growth

Science.gov (United States)

2003-01-01

In order to rapidly and efficiently grow crystals, tools were needed to automatically identify and analyze the growing process of protein crystals. To meet this need, Diversified Scientific, Inc. (DSI), with the support of a Small Business Innovation Research (SBIR) contract from NASA s Marshall Space Flight Center, developed CrystalScore(trademark), the first automated image acquisition, analysis, and archiving system designed specifically for the macromolecular crystal growing community. It offers automated hardware control, image and data archiving, image processing, a searchable database, and surface plotting of experimental data. CrystalScore is currently being used by numerous pharmaceutical companies and academic and nonprofit research centers. DSI, located in Birmingham, Alabama, was awarded the patent Method for acquiring, storing, and analyzing crystal images on March 4, 2003. Another DSI product made possible by Marshall SBIR funding is VaporPro(trademark), a unique, comprehensive system that allows for the automated control of vapor diffusion for crystallization experiments.

Photonic Crystal Fibers

National Research Council Canada - National Science Library

Kristiansen, Rene E

2005-01-01

This report results from a contract tasking Crystal Fibre A/S as follows: Crystal Fibre will conduct research and development of large mode area, dual clad multi-core Yb-doped photonic crystal fiber...

Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation

Directory of Open Access Journals (Sweden)

J. Koralewska

2008-06-01

Full Text Available Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow of BaSO4 crystal magma in a mixing chamber. For comparison purposes the experimental data corresponding to a continuous DT (Draft Tube crystallizer with propeller agitator are presented and discussed. The various types of laboratory crystallizers used were fed with concentrated water solution of barium chloride (of 10 or 24 mass % and - in a stoichiometric proportion - crystalline ammonium sulphate, assuming isothermal (348 K and hydrodynamic (average residence time of suspension in a crystallizer: 900 s process conditions. The observed nucleation and growth rates of barium sulphate crystals were estimated on the basis of crystal size distributions (CSDs using convenient calculation scheme derived for an MSMPR (Mixed Suspension Mixed Product Removal model approach. Considering the experimental population density distribution courses, a size-dependent growth (SDG phenomenon was taken into account in the kinetic calculations. Five SDG kinetic models recommended in the accessible literature were used for kinetic parameter values estimation. It was proved statistically, that Rojkowski’s two SDG models (hyperbolic and exponential best suit for our own experimental data description. The experimental data presented can be practically applied for improving the constructions of liquid jet-pump DTM crystallizers recommended for reaction crystallization of sparingly soluble inorganic salts (especially for high concentrations of reaction substrates in the modern

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In-synthesis, structure, and crystal chemistry

Energy Technology Data Exchange (ETDEWEB)

Zaremba, R.I.; Rodewald, U. Ch.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany); Kalychak, Y.M.; Zaremba, V.I. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv, Lviv (Ukraine)

2006-08-15

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In have been synthesized from the elements by arc-melting. Single crystals were grown by special annealing modes. The thee indides were investigated via X-ray powder and single crystal diffraction: Ho{sub 6}Co{sub 2}Ga type, Immm, a = 886.7(3), b = 878.0(2), c = 932.1(3) pm, wR2 = 0.0517, 711 F{sup 2} values, 35 variables for Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Ho{sub 10}Ni{sub 9}In{sub 20} type, P4/nmm, a = 1287.5(2), c = 884.7(1) pm, wR2 = 0.0642, 1221 F{sup 2} values, 63 variables for Sc{sub 10}Ni{sub 9}In{sub 19.44}, and MgCu{sub 4}Sn type, anti F 43m, a = 704.03(7) pm, wR2 = 0.0267, 101 F{sup 2} values, and 7 variables for ScCu{sub 4}In. The scandium rich indide Sc{sub 6}Co{sub 2.18}In{sub 0.82} contains two Co{sub 2} dumb-bells at Co-Co distances of 221 and 230 pm. Each cobalt atom within these dumb-bells has a tricapped trigonal prismatic coordination. The In1 site has a distorted cube-like coordination by scandium and shows a mixed occupancy (36%) with cobalt. The In2 atoms have distorted icosahedral scandium coordination. As a consequence of the small size of the scandium atoms, the In4 site in Sc{sub 10}Ni{sub 9}In{sub 19.44} shows defects and was furthermore refined with a split model leading to a new distorted variant within the family of Ho{sub 10}Ni{sub 9}In{sub 20} compounds. ScCu{sub 4}In is an ordered version of the cubic Laves phase with scandium and indium atoms in the CN16 voids of the copper substructure. The Cu-Cu distances within the three-dimensional network of corner-sharing tetrahedra are 248.6 and 249.2 pm. The crystal chemical peculiarities of these three indide structures are briefly discussed. (orig.)

Co-crystallization as a separation technology: controlling product concentrations by co-crystals

NARCIS (Netherlands)

Urbanus, J.; Roelands, C.P.M.; Verdoes, D.; Jansens, P.J.; Horst, J.H. ter

2010-01-01

Co-crystallization is known as a product formulation technology, but it can also be used as a tool to solve crystallization problems. Product removal by co-crystallization in fermentations is used as a showcase to demonstrate the potential of co-crystallization as a separation technique. In

A novel mononuclear square-planar copper(II) complex (Pip-H.sup.+./sup.).sub.2./sub.[CuL.sub.4./sub.].sup.2-./sup. with 2-cyano-3-(2,5-dimethoxyphenyl)acrylic acid as ligand: synthesis, crystal structures, spectral and thermal studies

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Fejfarová, Karla; Dušek, Michal; Das, D.

2012-01-01

Roč. 143, č. 5 (2012), s. 753-761 ISSN 0026-9247 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : coper(II) complex * crystal structure * X-ray diffraction * Jana2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.629, year: 2012

Crystal growth, spectral and laser properties of Nd:LSAT single crystal

Science.gov (United States)

Hu, P. C.; Yin, J. G.; Zhao, C. C.; Gong, J.; He, X. M.; Zhang, L. H.; Liang, X. Y.; Hang, Y.

2011-10-01

Nd:(La, Sr)(Al, Ta)O3 (Nd:LSAT) crystal was grown by the Czochralski method. The absorption and fluorescence spectra of Nd:LSAT crystal at room temperature were investigated. With a fiber-coupled diode laser as pump source, the continuous-wave (CW) laser action of Nd:LSAT crystal was demonstrated. The result of diode-pumped laser operation of Nd:LSAT crystal single crystal is reported for what is to our knowledge the first time. The maximum output power at 1064 nm was obtained to be 165 mW under the incident pump power of 3 W, with the slope efficiency 10.9%.

Zinc(II) and mercury(II) complexes [Zn((2,6-Cl-ba).sub.2./sub.en)I.sub.2./sub.] and [Hg((2,6-Cl-ba).sub.2./sub.en)Br.sub.2./sub.] with the bidentate Schiff base ligand (2,6-Cl-ba).sub.2./sub.en: synthesis, characterization and crystal structures

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Grivani, G.; Seyyedi, M.; Fejfarová, Karla; Dušek, Michal

2013-01-01

Roč. 49, č. 1 (2013), 19-23 ISSN 0277-5387 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : zinc(II) * mercury(II) * Schiff base * single-crystal Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.047, year: 2013

A multistep single-crystal-to-single-crystal bromodiacetylene dimerization

Science.gov (United States)

Hoheisel, Tobias N.; Schrettl, Stephen; Marty, Roman; Todorova, Tanya K.; Corminboeuf, Clémence; Sienkiewicz, Andrzej; Scopelliti, Rosario; Schweizer, W. Bernd; Frauenrath, Holger

2013-04-01

Packing constraints and precise placement of functional groups are the reason that organic molecules in the crystalline state often display unusual physical or chemical properties not observed in solution. Here we report a single-crystal-to-single-crystal dimerization of a bromodiacetylene that involves unusually large atom displacements as well as the cleavage and formation of several bonds. Density functional theory computations support a mechanism in which the dimerization is initiated by a [2 + 1] photocycloaddition favoured by the nature of carbon-carbon short contacts in the crystal structure. The reaction proceeded up to the theoretical degree of conversion without loss of crystallinity, and it was also performed on a preparative scale with good yield. Moreover, it represents the first synthetic pathway to (E)-1,2-dibromo-1,2-diethynylethenes, which could serve as synthetic intermediates for the preparation of molecular carbon scaffolds. Our findings both extend the scope of single-crystal-to-single-crystal reactions and highlight their potential as a synthetic tool for complex transformations.

Crystal growth and properties of novel organic nonlinear optical crystals of 4-Nitrophenol urea

Energy Technology Data Exchange (ETDEWEB)

Mohan, M. Krishna, E-mail: krishnamohan.m@ktr.srmuniv.ac.in; Ponnusamy, S.; Muthamizhchelvan, C.

2017-07-01

Single crystals of 4-Nitrophenol urea have been grown from water using slow evaporation technique at constant temperature, with the vision to improve the properties of the crystals. The unit cell parameters of the grown crystals were determined by single crystal and powder X-Ray diffraction. FTIR studies reveals the presence of different vibrational bands. The Optical studies confirmed that the crystal is transparent up to 360 nm .TGA and DSC studies were carried out to understand the thermal behavior of crystals. The SHG studies show the suitability of the crystals for NLO applications. The etching studies were carried out to study the behavior of the crystals under different conditions.These studies reveal that the crystals of 4-Nitrophenol urea are suitable for device applications. - Highlights: • 4-Nitrophenol urea crystals of dimensions 14 mm × 1 mm were grown. • UV–Visible studies indicate the crystal is transparent in the region of 370–800 nm. • Thermal studies show the crystal starts decomposing at 170 °C. • SHG studies indicate that the crystals have NLO efficiency 3.5 times that of KDP.

Synthesis, characterization, crystal structure and antibacterial activity of new sulfur-bridged dinuclear silver(I) thiosemicarbazone complex [Ag.sub.2./sub.(PPh.sub.3./sub.).sub.2./sub.(μ-S-Brcatsc).sub.2./sub.(η.sup.1./sup.-S-Brcatsc).sub.2./sub.](NO.sub.3./sub.).sub.2./sub..

Czech Academy of Sciences Publication Activity Database

Shahsavani, E.; Khalaji, A.D.; Feizi, N.; Kučeráková, Monika; Dušek, Michal

2015-01-01

Roč. 429, Apr (2015), 61-66 ISSN 0020-1693 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : sulfur-bridged dinuclear silver(I) * thiosemicarbazone complex * single-crystal * distorted tetrahedron * antibacterial activity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2015

Growth of dopamine crystals

Energy Technology Data Exchange (ETDEWEB)

Patil, Vidya, E-mail: vidya.patil@ruparel.edu; Patki, Mugdha, E-mail: mugdha.patki@ruparel.edu [D. G. Ruparel College, Senapati Bapat Marg, Mahim, Mumbai – 400 016 (India)

2016-05-06

Many nonlinear optical (NLO) crystals have been identified as potential candidates in optical and electro-optical devices. Use of NLO organic crystals is expected in photonic applications. Hence organic nonlinear optical materials have been intensely investigated due to their potentially high nonlinearities, and rapid response in electro-optic effect compared to inorganic NLO materials. There are many methods to grow organic crystals such as vapor growth method, melt growth method and solution growth method. Out of these methods, solution growth method is useful in providing constraint free crystal. Single crystals of Dopamine have been grown by evaporating the solvents from aqueous solution. Crystals obtained were of the size of orders of mm. The crystal structure of dopamine was determined using XRD technique. Images of crystals were obtained using FEG SEM Quanta Series under high vacuum and low KV.

Parity violation and parity conservation in unstirred crystallization: Effect of first crystals

Energy Technology Data Exchange (ETDEWEB)

Szurgot, M. [Center of Mathematics and Physics, Technical University of Lodz (Poland)

2012-02-15

Statistics of nucleation of chiral forms was studied to establish the effect of the number of first crystals and their handedness on distributions of enantiomers. Various bimodal, trimodal and unimodal distributions are obtained in unstirred crystallization, depending on the number of initial crystals and growth conditions. The binomial distribution satisfactorily describes experimental distributions of enantiomeric excess and may be used to predict distributions and probabilities of nucleation of enantiomers. The first nucleated crystals determine the handedness of secondary crystals, and number of initial crystals governs statistics of chiral nucleation. According to the binomial distribution if single crystals nucleate as the first, the bimodal distributions result with D and L peaks. If LD, LL, and DD pairs are nucleated as first, trimodal distributions with D, R, and L peaks are created, and if groups of crystals of various handedness nucleate as the first the unimodal distributions of enantiomeric excess with racemate R peaks are formed. Chiral nucleation experiments on sodium bromate were the basis for the theoretical considerations and verifications of predictions resulting from binomial distributions on probabilities of the creation of L and D crystals, and racemates, and the presence of D, L, and R peaks in the distributions. Growth conditions affect the number of the first crystals and effectiveness of cloning, and as a result, the distributions of enantiomers. Formation of pure enantiomers and/or racemates proves that the conservation of chiral symmetry, and the breakage of chiral symmetry can occur in unstirred crystallization. (copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Orientational and structural properties of ferroelectric liquid crystal with broad temperature range of the SmC* phase by .sup.13./sup.C NMR, x-ray scattering and dielectric spectroscopy

Czech Academy of Sciences Publication Activity Database

Bubnov, Alexej M.; Domenici, V.; Hamplová, Věra; Kašpar, Miroslav; Veracini, C.A.; Glogarová, Milada

2009-01-01

Roč. 21, č. 3 (2009), 035102/1-035102/8 ISSN 0953-8984 R&D Projects: GA AV ČR(CZ) GA202/09/0047; GA ČR GA202/05/0431; GA MŠk OC 175; GA AV ČR IAA100100710 Institutional research plan: CEZ:AV0Z10100520 Keywords : ferroelectric liquid crystal * high spontaneous polarization * 13 C nuclear magnetic resonance * x-ray scattering * dielectric spectroscopy * viscosity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.964, year: 2009

Crystallization Pathways in Biomineralization

Science.gov (United States)

Weiner, Steve; Addadi, Lia

2011-08-01

A crystallization pathway describes the movement of ions from their source to the final product. Cells are intimately involved in biological crystallization pathways. In many pathways the cells utilize a unique strategy: They temporarily concentrate ions in intracellular membrane-bound vesicles in the form of a highly disordered solid phase. This phase is then transported to the final mineralization site, where it is destabilized and crystallizes. We present four case studies, each of which demonstrates specific aspects of biological crystallization pathways: seawater uptake by foraminifera, calcite spicule formation by sea urchin larvae, goethite formation in the teeth of limpets, and guanine crystal formation in fish skin and spider cuticles. Three representative crystallization pathways are described, and aspects of the different stages of crystallization are discussed. An in-depth understanding of these complex processes can lead to new ideas for synthetic crystallization processes of interest to materials science.

Crystal Systems.

Science.gov (United States)

Schomaker, Verner; Lingafelter, E. C.

1985-01-01

Discusses characteristics of crystal systems, comparing (in table format) crystal systems with lattice types, number of restrictions, nature of the restrictions, and other lattices that can accidently show the same metrical symmetry. (JN)

Research and Development of Crystal Purification for Product of Uranium Crystallization Process

Energy Technology Data Exchange (ETDEWEB)

Yano, K. [Japan Atomic Energy Agency - JAEA (Japan)

2009-06-15

Uranium crystallization has been developed as a part of advanced aqueous reprocessing for FBR spent fuel. Although the purity of uranyl nitrate hexahydrate (UNH) crystal from the crystallization process is supposed to meet a specification of FBR blanket fuel, an improvement of its purity is able to reduce the cost of fuel fabrication and storage (in case interim storage of recovered uranium is required). In this work, UNH crystal purification was developed as additional process after crystallization. Contamination of the crystal is caused by mother solution and solid state impurities. They are inseparable by washing and filtration. Mother solution on the surface of UNH crystals is removable by washing, but it is difficult to remove that in an obstructed part of crystalline aggregate by washing. Major elements of solid state impurities are cesium and barium. Cesium precipitates with tetravalent plutonium as a double nitrate, Cs{sub 2}Pu(NO{sub 3}){sub 6}. Barium crystallizes as Ba(NO{sub 3}){sub 2} because of its low solubility in nitric acid solution. It is difficult to separate their particle from UNH crystal by solid-liquid separation such as simple filtration. As a kind of crystal purification, there are some methods using sweating. Sweating is a phenomenon that a crystal melts partly below its melting point and it is caused by depression of freezing point due to impurity. It is considerably applicable for removal of mother solution. Concerning the solid state impurities, which has higher melting point than that of UNH crystal, it is supposed that they are separable by melting UNH crystal and filtration. The behaviors of impurities and applicability of sweating and melting-filtration operations to the purification for UNH crystal were investigated experimentally on a beaker and an engineering scale. With regard to behaviors of impurities, the conditions of cesium and barium precipitation were surveyed and it was clarified that there were most impurities on the

Growth of single crystals of BaFe12O19 by solid state crystal growth

International Nuclear Information System (INIS)

Fisher, John G.; Sun, Hengyang; Kook, Young-Geun; Kim, Joon-Seong; Le, Phan Gia

2016-01-01

Single crystals of BaFe 12 O 19 are grown for the first time by solid state crystal growth. Seed crystals of BaFe 12 O 19 are buried in BaFe 12 O 19 +1 wt% BaCO 3 powder, which are then pressed into pellets containing the seed crystals. During sintering, single crystals of BaFe 12 O 19 up to ∼130 μm thick in the c-axis direction grow on the seed crystals by consuming grains from the surrounding polycrystalline matrix. Scanning electron microscopy-energy dispersive spectroscopy analysis shows that the single crystal and the surrounding polycrystalline matrix have the same chemical composition. Micro-Raman scattering shows the single crystal to have the BaFe 12 O 19 structure. The optimum growth temperature is found to be 1200 °C. The single crystal growth behavior is explained using the mixed control theory of grain growth. - Highlights: • Single crystals of BaFe 12 O 19 are grown by solid state crystal growth. • A single crystal up to ∼130 μm thick (c-axis direction) grows on the seed crystal. • The single crystal and surrounding ceramic matrix have similar composition. • Micro-Raman scattering shows the single crystal has the BaFe 12 O 19 structure.

Crystals in the LHC

CERN Multimedia

Antonella Del Rosso

2012-01-01

Bent crystals can be used to deflect charged particle beams. Their use in high-energy accelerators has been investigated for almost 40 years. Recently, a bent crystal was irradiated for the first time in the HiRadMat facility with an extreme particle flux, which crystals would have to withstand in the LHC. The results were very encouraging and confirmed that this technology could play a major role in increasing the beam collimation performance in future upgrades of the machine.   UA9 bent crystal tested with a laser. Charged particles interacting with a bent crystal can be trapped in channelling states and deflected by the atomic planes of the crystal lattice (see box). The use of bent crystals for beam manipulation in particle accelerators is a concept that has been well-assessed. Over the last three decades, a large number of experimental findings have contributed to furthering our knowledge and improving our ability to control crystal-particle interactions. In modern hadron colliders, su...

Systematic Modelling and Crystal Size Distribution Control for Batch Crystallization Processes

DEFF Research Database (Denmark)

Abdul Samad, Noor Asma Fazli; Singh, Ravendra; Sin, Gürkan

Crystallization processes form an important class of separation methods that are frequently used in the chemical, the pharmaceutical and the food industry. The specifications of the crystal product are usually given in terms of crystal size, shape and purity. In order to predict the desired cryst...

Automation in biological crystallization.

Science.gov (United States)

Stewart, Patrick Shaw; Mueller-Dieckmann, Jochen

2014-06-01

Crystallization remains the bottleneck in the crystallographic process leading from a gene to a three-dimensional model of the encoded protein or RNA. Automation of the individual steps of a crystallization experiment, from the preparation of crystallization cocktails for initial or optimization screens to the imaging of the experiments, has been the response to address this issue. Today, large high-throughput crystallization facilities, many of them open to the general user community, are capable of setting up thousands of crystallization trials per day. It is thus possible to test multiple constructs of each target for their ability to form crystals on a production-line basis. This has improved success rates and made crystallization much more convenient. High-throughput crystallization, however, cannot relieve users of the task of producing samples of high quality. Moreover, the time gained from eliminating manual preparations must now be invested in the careful evaluation of the increased number of experiments. The latter requires a sophisticated data and laboratory information-management system. A review of the current state of automation at the individual steps of crystallization with specific attention to the automation of optimization is given.

Pressure cryocooling protein crystals

Science.gov (United States)

Kim, Chae Un [Ithaca, NY; Gruner, Sol M [Ithaca, NY

2011-10-04

Preparation of cryocooled protein crystal is provided by use of helium pressurizing and cryocooling to obtain cryocooled protein crystal allowing collection of high resolution data and by heavier noble gas (krypton or xenon) binding followed by helium pressurizing and cryocooling to obtain cryocooled protein crystal for collection of high resolution data and SAD phasing simultaneously. The helium pressurizing is carried out on crystal coated to prevent dehydration or on crystal grown in aqueous solution in a capillary.

Large three-dimensional photonic crystals based on monocrystalline liquid crystal blue phases.

Science.gov (United States)

Chen, Chun-Wei; Hou, Chien-Tsung; Li, Cheng-Chang; Jau, Hung-Chang; Wang, Chun-Ta; Hong, Ching-Lang; Guo, Duan-Yi; Wang, Cheng-Yu; Chiang, Sheng-Ping; Bunning, Timothy J; Khoo, Iam-Choon; Lin, Tsung-Hsien

2017-09-28

Although there have been intense efforts to fabricate large three-dimensional photonic crystals in order to realize their full potential, the technologies developed so far are still beset with various material processing and cost issues. Conventional top-down fabrications are costly and time-consuming, whereas natural self-assembly and bottom-up fabrications often result in high defect density and limited dimensions. Here we report the fabrication of extraordinarily large monocrystalline photonic crystals by controlling the self-assembly processes which occur in unique phases of liquid crystals that exhibit three-dimensional photonic-crystalline properties called liquid-crystal blue phases. In particular, we have developed a gradient-temperature technique that enables three-dimensional photonic crystals to grow to lateral dimensions of ~1 cm (~30,000 of unit cells) and thickness of ~100 μm (~ 300 unit cells). These giant single crystals exhibit extraordinarily sharp photonic bandgaps with high reflectivity, long-range periodicity in all dimensions and well-defined lattice orientation.Conventional fabrication approaches for large-size three-dimensional photonic crystals are problematic. By properly controlling the self-assembly processes, the authors report the fabrication of monocrystalline blue phase liquid crystals that exhibit three-dimensional photonic-crystalline properties.

Crystallization In Multicomponent Glasses

International Nuclear Information System (INIS)

Kruger, A.A.; Hrma, P.R.

2009-01-01

In glass processing situations involving glass crystallization, various crystalline forms nucleate, grow, and dissolve, typically in a nonuniform temperature field of molten glass subjected to convection. Nuclear waste glasses are remarkable examples of multicomponent vitrified mixtures involving partial crystallization. In the glass melter, crystals form and dissolve during batch-to-glass conversion, melter processing, and product cooling. Crystals often agglomerate and sink, and they may settle at the melter bottom. Within the body of cooling glass, multiple phases crystallize in a non-uniform time-dependent temperature field. Self-organizing periodic distribution (the Liesegnang effect) is common. Various crystallization phenomena that occur in glass making are reviewed.

CRYSTALLIZATION IN MULTICOMPONENT GLASSES

Energy Technology Data Exchange (ETDEWEB)

KRUGER AA; HRMA PR

2009-10-08

In glass processing situations involving glass crystallization, various crystalline forms nucleate, grow, and dissolve, typically in a nonuniform temperature field of molten glass subjected to convection. Nuclear waste glasses are remarkable examples of multicomponent vitrified mixtures involving partial crystallization. In the glass melter, crystals form and dissolve during batch-to-glass conversion, melter processing, and product cooling. Crystals often agglomerate and sink, and they may settle at the melter bottom. Within the body of cooling glass, multiple phases crystallize in a non-uniform time-dependent temperature field. Self-organizing periodic distribution (the Liesegnang effect) is common. Various crystallization phenomena that occur in glass making are reviewed.

Investigation of lactose crystallization process during condensed milk cooling using native vacuum-crystallizer

Directory of Open Access Journals (Sweden)

E. I. Dobriyan

2016-01-01

Full Text Available One of the most general defects of condensed milk with sugar is its consistency heterogeneity – “candying”. The mentioned defect is conditioned by the presence of lactose big crystals in the product. Lactose crystals size up to 10 µm is not organoleptically felt. The bigger crystals impart heterogeneity to the consistency which can be evaluated as “floury”, “sandy”, “crunch on tooth”. Big crystals form crystalline deposit on the can or industrial package bottom in the form of thick layer. Industrial processing of the product with the defective process of crystallization results in the expensive equipment damage of the equipment at the confectionary plant accompanied with heavy losses. One of the factors influencing significantly lactose crystallization is the product cooling rate. Vacuum cooling is the necessary condition for provision of the product consistency homogeneity. For this purpose the vacuum crystallizers of “Vigand” company, Germany, are used. But their production in the last years has been stopped. All-Russian dairy research institute has developed “The references for development of the native vacuum crystallizer” according to which the industrial model has been manufactured. The produced vacuum – crystallizer test on the line for condensed milk with sugar production showed that the product cooling on the native vacuum-crystallizer guarantees production of the finished product with microstructure meeting the requirements of State standard 53436–2009 “Canned Milk. Milk and condensed cream with sugar”. The carried out investigations evidences that the average lactose crystals size in the condensed milk with sugar cooled at the native crystallizer makes up 6,78 µm. The granulometric composition of the product crystalline phase cooled at the newly developed vacuum-crystallizer is completely identical to granulometric composition of the product cooled at “Vigand” vacuum-crystallizer.

High-quality bulk hybrid perovskite single crystals within minutes by inverse temperature crystallization

KAUST Repository

Saidaminov, Makhsud I.

2015-07-06

Single crystals of methylammonium lead trihalide perovskites (MAPbX3; MA=CH3NH3+, X=Br− or I−) have shown remarkably low trap density and charge transport properties; however, growth of such high-quality semiconductors is a time-consuming process. Here we present a rapid crystal growth process to obtain MAPbX3 single crystals, an order of magnitude faster than previous reports. The process is based on our observation of the substantial decrease of MAPbX3 solubility, in certain solvents, at elevated temperatures. The crystals can be both size- and shape-controlled by manipulating the different crystallization parameters. Despite the rapidity of the method, the grown crystals exhibit transport properties and trap densities comparable to the highest quality MAPbX3 reported to date. The phenomenon of inverse or retrograde solubility and its correlated inverse temperature crystallization strategy present a major step forward for advancing the field on perovskite crystallization.

Photonic crystal light source

Science.gov (United States)

Fleming, James G [Albuquerque, NM; Lin, Shawn-Yu [Albuquerque, NM; Bur, James A [Corrales, NM

2004-07-27

A light source is provided by a photonic crystal having an enhanced photonic density-of-states over a band of frequencies and wherein at least one of the dielectric materials of the photonic crystal has a complex dielectric constant, thereby producing enhanced light emission at the band of frequencies when the photonic crystal is heated. The dielectric material can be a metal, such as tungsten. The spectral properties of the light source can be easily tuned by modification of the photonic crystal structure and materials. The photonic crystal light source can be heated electrically or other heating means. The light source can further include additional photonic crystals that exhibit enhanced light emission at a different band of frequencies to provide for color mixing. The photonic crystal light source may have applications in optical telecommunications, information displays, energy conversion, sensors, and other optical applications.

single crystals

Indian Academy of Sciences (India)

2018-05-18

May 18, 2018 ... Abstract. 4-Nitrobenzoic acid (4-NBA) single crystals were studied for their linear and nonlinear optical ... studies on the proper growth, linear and nonlinear optical ..... between the optic axes and optic sign of the biaxial crystal.

Macromolecular crystallization in microgravity

International Nuclear Information System (INIS)

Snell, Edward H; Helliwell, John R

2005-01-01

Density difference fluid flows and sedimentation of growing crystals are greatly reduced when crystallization takes place in a reduced gravity environment. In the case of macromolecular crystallography a crystal of a biological macromolecule is used for diffraction experiments (x-ray or neutron) so as to determine the three-dimensional structure of the macromolecule. The better the internal order of the crystal then the greater the molecular structure detail that can be extracted. It is this structural information that enables an understanding of how the molecule functions. This knowledge is changing the biological and chemical sciences, with major potential in understanding disease pathologies. In this review, we examine the use of microgravity as an environment to grow macromolecular crystals. We describe the crystallization procedures used on the ground, how the resulting crystals are studied and the knowledge obtained from those crystals. We address the features desired in an ordered crystal and the techniques used to evaluate those features in detail. We then introduce the microgravity environment, the techniques to access that environment and the theory and evidence behind the use of microgravity for crystallization experiments. We describe how ground-based laboratory techniques have been adapted to microgravity flights and look at some of the methods used to analyse the resulting data. Several case studies illustrate the physical crystal quality improvements and the macromolecular structural advances. Finally, limitations and alternatives to microgravity and future directions for this research are covered. Macromolecular structural crystallography in general is a remarkable field where physics, biology, chemistry and mathematics meet to enable insight to the fundamentals of life. As the reader will see, there is a great deal of physics involved when the microgravity environment is applied to crystallization, some of it known, and undoubtedly much yet to

Crystal plasticity study of single crystal tungsten by indentation tests

International Nuclear Information System (INIS)

Yao, Weizhi

2012-01-01

Owing to its favorable material properties, tungsten (W) has been studied as a plasma-facing material in fusion reactors. Experiments on W heating in plasma sources and electron beam facilities have shown an intense micro-crack formation at the heated surface and sub-surface. The cracks go deep inside the irradiated sample, and often large distorted areas caused by local plastic deformation are present around the cracks. To interpret the crack-induced microscopic damage evolution process in W, one needs firstly to understand its plasticity on a single grain level, which is referred to as crystal plasticity. In this thesis, the crystal plasticity of single crystal tungsten (SCW) has been studied by spherical and Berkovich indentation tests and the finite element method with a crystal plasticity model. Appropriate values of the material parameters included in the crystal plasticity model are determined by fitting measured load-displacement curves and pile-up profiles with simulated counterparts for spherical indentation. The numerical simulations reveal excellent agreement with experiment. While the load-displacement curves and the deduced indentation hardness exhibit little sensitivity to the indented plane at small indentation depths, the orientation of slip directions within the crystals governs the development of deformation hillocks at the surface. It is found that several factors like friction, indentation depth, active slip systems, misoriented crystal orientation, misoriented sample surface and azimuthal orientation of the indenter can affect the indentation behavior of SCW. The Berkovich indentation test was also used to study the crystal plasticity of SCW after deuterium irradiation. The critical load (pop-in load) for triggering plastic deformation under the indenter is found to depend on the crystallographic orientation. The pop-in loads decrease dramatically after deuterium plasma irradiation for all three investigated crystallographic planes.

Phase-field crystal simulation facet and branch crystal growth

Science.gov (United States)

Chen, Zhi; Wang, Zhaoyang; Gu, Xinrui; Chen, Yufei; Hao, Limei; de Wit, Jos; Jin, Kexin

2018-05-01

Phase-field crystal model with one mode is introduced to describe morphological transition. The relationship between growth morphology and smooth density distribution was investigated. The results indicate that the pattern selection of dendrite growth is caused by the competition between interface energy anisotropy and interface kinetic anisotropy based on the 2D phase diagram. When the calculation time increases, the crystal grows to secondary dendrite at the dimensionless undercooling equal to - 0.4. Moreover, when noise is introduced in the growth progress, the symmetry is broken in the growth mode, and there becomes irregular fractal-like growth morphology. Furthermore, the single crystal shape develops into polycrystalline when the noise amplitude is large enough. When the dimensionless undercooling is less than - 0.3, the noise has a significant effect on the growth shape. In addition, the growth velocity of crystal near to liquid phase line is slow, while the shape far away from the liquid adapts to fast growth. Based on the simulation results, the method was proved to be effective, and it can easily obtain different crystal shapes by choosing the different points in 2D phase diagram.

Changes in copper sulfate crystal habit during cooling crystallization

Science.gov (United States)

Giulietti, M.; Seckler, M. M.; Derenzo, S.; Valarelli, J. V.

1996-09-01

The morphology of technical grade copper(II) sulfate pentahydrate crystals produced from batch cooling experiments in the temperature range of 70 to 30°C is described and correlated with the process conditions. A slow linear cooling rate (batch time of 90 min) predominantly caused the appearance of well-formed crystals. Exponential cooling (120 min) resulted in the additional formation of agglomerates and twins. The presence of seeds for both cooling modes led to round crystals, agglomerates and twins. Fast linear cooling (15 min) gave rise to a mixture of the former types. Broken crystals and adhering fragments were often found. Growth zoning was pronounced in seeded and linear cooling experiments. Fluid inclusions were always found and were more pronounced for larger particles. The occurrence of twinning, zoning and fluid inclusions was qualitatively explained in terms of fundamental principles.

Crystals in light.

Science.gov (United States)

Kahr, Bart; Freudenthal, John; Gunn, Erica

2010-05-18

We have made images of crystals illuminated with polarized light for almost two decades. Early on, we abandoned photosensitive chemicals in favor of digital electrophotometry with all of the attendant advantages of quantitative intensity data. Accurate intensities are a boon because they can be used to analytically discriminate small effects in the presence of larger ones. The change in the form of our data followed camera technology that transformed picture taking the world over. Ironically, exposures in early photographs were presumed to correlate simply with light intensity, raising the hope that photography would replace sensorial interpretation with mechanical objectivity and supplant the art of visual photometry. This was only true in part. Quantitative imaging accurate enough to render the separation of crystalloptical quantities had to await the invention of the solid-state camera. Many pioneers in crystal optics were also major figures in the early history of photography. We draw out the union of optical crystallography and photography because the tree that connects the inventors of photography is a structure unmatched for organizing our work during the past 20 years, not to mention that silver halide crystallites used in chemical photography are among the most consequential "crystals in light", underscoring our title. We emphasize crystals that have acquired optical properties such as linear birefringence, linear dichroism, circular birefringence, and circular dichroism, during growth from solution. Other crystalloptical effects were discovered that are unique to curiously dissymmetric crystals containing embedded oscillators. In the aggregate, dyed crystals constitute a generalization of single crystal matrix isolation. Simple crystals provided kinetic stability to include guests such as proteins or molecules in excited states. Molecular lifetimes were extended for the preparation of laser gain media and for the study of the photodynamics of single

Chromatic dispersion of liquid crystal infiltrated capillary tubes and photonic crystal fibers

DEFF Research Database (Denmark)

Rasmussen, Per Dalgaard; Lægsgaard, Jesper; Bang, Ole

2006-01-01

We consider chromatic dispersion of capillary tubes and photonic crystal fibers infiltrated with liquid crystals. A perturbative scheme for inclusion of material dispersion of both liquid crystal and the surrounding waveguide material is derived. The method is used to calculate the chromatic...

A novel trinuclear copper(II) complex containing a symmetric tetradentate N.sub.2./sub.O.sub.2./sub. Schiff base ligand: synthesis, characterization, crystal structure and its usage as a new precursor for the preparation of CuO particles

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Ghorbani, M.; Feizi, N.; Akbari, A.; Eigner, Václav; Dušek, Michal

2017-01-01

Roč. 121, Jan (2017), s. 9-12 ISSN 0277-5387 R&D Projects: GA ČR(CZ) GA15-12653S; GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : trinuclear complex * copper(II) complex * Schiff base * crystal structure * thermal decomposition Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 1.926, year: 2016

Surface and bulk crystallization of amorphous solid water films: Confirmation of “top-down” crystallization

Energy Technology Data Exchange (ETDEWEB)

Yuan, Chunqing; Smith, R. Scott; Kay, Bruce D.

2016-10-01

The crystallization kinetics of nanoscale amorphous solid water (ASW) films are investigated using temperature-programmed desorption (TPD) and reflection absorption infrared spectroscopy (RAIRS). TPD measurements are used to probe surface crystallization and RAIRS measurements are used to probe bulk crystallization. Isothermal TPD results show that surface crystallization is independent of the film thickness (from 100 to 1000 ML). Conversely, the RAIRS measurements show that the bulk crystallization time increases linearly with increasing film thickness. These results suggest that nucleation and crystallization begin at the ASW/vacuum interface and then the crystallization growth front propagates linearly into the bulk. This mechanism was confirmed by selective placement of an isotopic layer (5% D2O in H2O) at various positions in an ASW (H2O) film. In this case, the closer the isotopic layer was to the vacuum interface, the earlier the isotopic layer crystallized. These experiments provide direct evidence to confirm that ASW crystallization in vacuum proceeds by a “top-down” crystallization mechanism.

Reducing the positional modulation of NbO.sub.6./sub.-octahedra in Sr.sub.x./sub.Ba.sub.1-x./sub.Nb.sub.2./sub.O.sub.6./sub. by increasing the barium content: A single crystal neutron diffraction study at ambient temperature for x=0.61 and x=0.34

Czech Academy of Sciences Publication Activity Database

Schefer, J.; Schaniel, D.; Petříček, Václav; Woike, T.; Cousson, A.; Wöhlecke, M.

2008-01-01

Roč. 223, č. 6 (2008), s. 399-407 ISSN 0044-2968 R&D Projects: GA ČR GA202/06/0757 Institutional research plan: CEZ:AV0Z10100521 Keywords : influencing positional modulation * optical materials * modulated structure * single crystal structure analysis * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.708, year: 2008

Graphene-based photonic crystal

International Nuclear Information System (INIS)

Berman, Oleg L.; Boyko, Vladimir S.; Kezerashvili, Roman Ya.; Kolesnikov, Anton A.; Lozovik, Yurii E.

2010-01-01

A novel type of photonic crystal formed by embedding a periodic array of constituent stacks of alternating graphene and dielectric discs into a background dielectric medium is proposed. The photonic band structure and transmittance of such photonic crystal are calculated. The graphene-based photonic crystals can be used effectively as the frequency filters and waveguides for the far infrared region of electromagnetic spectrum. Due to substantial suppression of absorption of low-frequency radiation in doped graphene the damping and skin effect in the photonic crystal are also suppressed. The advantages of the graphene-based photonic crystal are discussed.

NATO Advanced Research Workshop on Incommensurate Crystals, Liquid Crystals, and Quasi-Crystals

CERN Document Server

Clark, N

1988-01-01

In this NATO-sponsored Advanced Research Workshop we succeeded in bringing together approximately forty scientists working in the three main areas of structurally incommensurate materials: incommensurate crystals (primarily ferroelectric insulators), incommensurate liquid crystals, and metallic quasi-crystals. Although these three classes of materials are quite distinct, the commonality of the physics of the origin and descrip­ tion of these incommensurate structures is striking and evident in these proceedings. A measure of the success of this conference was the degree to which interaction among the three subgroups occurred; this was facili­ tated by approximately equal amounts of theory and experiment in the papers presented. We thank the University of Colorado for providing pleasant housing and conference facilities at a modest cost, and we are especially grate­ ful to Ann Underwood, who retyped all the manuscripts into camera-ready form. J. F. Scott Boulder, Colorado N. A. Clark v CONTENTS PART I: INCO...

Stepwise crystallization and the layered distribution in crystallization kinetics of ultra-thin poly(ethylene terephthalate) film

Energy Technology Data Exchange (ETDEWEB)

Zuo, Biao, E-mail: chemizuo@zstu.edu.cn, E-mail: wxinping@yahoo.com; Xu, Jianquan; Sun, Shuzheng; Liu, Yue; Yang, Juping; Zhang, Li; Wang, Xinping, E-mail: chemizuo@zstu.edu.cn, E-mail: wxinping@yahoo.com [Department of Chemistry, Key Laboratory of Advanced Textile Materials and Manufacturing Technology of the Education Ministry, Zhejiang Sci-Tech University, Hangzhou 310018 (China)

2016-06-21

Crystallization is an important property of polymeric materials. In conventional viewpoint, the transformation of disordered chains into crystals is usually a spatially homogeneous process (i.e., it occurs simultaneously throughout the sample), that is, the crystallization rate at each local position within the sample is almost the same. Here, we show that crystallization of ultra-thin poly(ethylene terephthalate) (PET) films can occur in the heterogeneous way, exhibiting a stepwise crystallization process. We found that the layered distribution of glass transition dynamics of thin film modifies the corresponding crystallization behavior, giving rise to the layered distribution of the crystallization kinetics of PET films, with an 11-nm-thick surface layer having faster crystallization rate and the underlying layer showing bulk-like behavior. The layered distribution in crystallization kinetics results in a particular stepwise crystallization behavior during heating the sample, with the two cold-crystallization temperatures separated by up to 20 K. Meanwhile, interfacial interaction is crucial for the occurrence of the heterogeneous crystallization, as the thin film crystallizes simultaneously if the interfacial interaction is relatively strong. We anticipate that this mechanism of stepwise crystallization of thin polymeric films will allow new insight into the chain organization in confined environments and permit independent manipulation of localized properties of nanomaterials.

Apparatus for mounting crystal

Science.gov (United States)

Longeway, Paul A.

1985-01-01

A thickness monitor useful in deposition or etching reactor systems comprising a crystal-controlled oscillator in which the crystal is deposited or etched to change the frequency of the oscillator. The crystal rests within a thermally conductive metallic housing and arranged to be temperature controlled. Electrode contacts are made to the surface primarily by gravity force such that the crystal is substantially free of stress otherwise induced by high temperature.

ALICE photon spectrometer crystals

CERN Multimedia

Maximilien Brice

2006-01-01

Members of the mechanical assembly team insert the last few crystals into the first module of ALICE's photon spectrometer. These crystals are made from lead-tungstate, a crystal as clear as glass but with nearly four times the density. When a high-energy particle passes through one of these crystals it will scintillate, emitting a flash of light allowing the energy of photons, electrons and positrons to be measured.

Crystallization and crystal manipulation of a steric chaperone in complex with its lipase substrate

International Nuclear Information System (INIS)

Pauwels, Kris; Loris, Remy; Vandenbussche, Guy; Ruysschaert, Jean-Marie; Wyns, Lode; Van Gelder, Patrick

2005-01-01

Crystals of the lipase of B. glumae in complex with its specific foldase were obtained in two forms. Crystallization, crystal manipulation and preliminary X-ray diffraction analysis are described. Bacterial lipases that are secreted via the type II secretion pathway require a lipase-specific foldase in order to obtain their native and biologically active conformation in the periplasmic space. The lipase–foldase complex from Burkholderia glumae (319 and 333 residues, respectively) was crystallized in two crystal forms. One crystal form belongs to space group P3 1 21 (P3 2 21), with unit-cell parameters a = b = 122.3, c = 98.2 Å. A procedure is presented which improved the diffraction of these crystals from ∼5 to 2.95 Å. For the second crystal form, which belonged to space group C2 with unit-cell parameters a = 183.0, b = 75.7, c = 116.6 Å, X-ray data were collected to 1.85 Å

Growth of single crystals of BaFe12O19 by solid state crystal growth

Science.gov (United States)

Fisher, John G.; Sun, Hengyang; Kook, Young-Geun; Kim, Joon-Seong; Le, Phan Gia

2016-10-01

Single crystals of BaFe12O19 are grown for the first time by solid state crystal growth. Seed crystals of BaFe12O19 are buried in BaFe12O19+1 wt% BaCO3 powder, which are then pressed into pellets containing the seed crystals. During sintering, single crystals of BaFe12O19 up to ∼130 μm thick in the c-axis direction grow on the seed crystals by consuming grains from the surrounding polycrystalline matrix. Scanning electron microscopy-energy dispersive spectroscopy analysis shows that the single crystal and the surrounding polycrystalline matrix have the same chemical composition. Micro-Raman scattering shows the single crystal to have the BaFe12O19 structure. The optimum growth temperature is found to be 1200 °C. The single crystal growth behavior is explained using the mixed control theory of grain growth.

Separation of enantiomers by continuous preferential crystallization: Experimental realization using a coupled crystallizer configuration

DEFF Research Database (Denmark)

Chaaban, Joussef Hussein; Dam-Johansen, Kim; Kiil, Søren

2013-01-01

The experimental realization of a continuous preferential crystallization process, consisting of two mixed-flow crystallizers coupled via crystal-free liquid exchange streams and with only the liquid phases operating continuously, is addressed. Experiments in triplicate, using the conglomerate....... Successful enantioseparation by crystal growth, with the repeatability being within ±10% deviation, was obtained. However, slow crystal growth, due to a low surface integration rate, led to a negligible consumption of the desired enantiomer added in the feed solution, resulting in low productivities....... Productivities, yields, and purities of solid products were influenced by the morphological differences in the seed crystals. Due to irregularly shaped seed crystals, increase in the productivities and yields were achieved in the L-Tank. Lower purities of solid products from the L-Tank compared to purities...

Optically Anomalous Crystals

CERN Document Server

Shtukenberg, Alexander; Kahr, Bart

2007-01-01

Optical anomalies in crystals are puzzles that collectively constituted the greatest unsolved problems in crystallography in the 19th Century. The most common anomaly is a discrepancy between a crystal’s symmetry as determined by its shape or by X-ray analysis, and that determined by monitoring the polarization state of traversing light. These discrepancies were perceived as a great impediment to the development of the sciences of crystals on the basis of Curie’s Symmetry Principle, the grand organizing idea in the physical sciences to emerge in the latter half of the 19th Century. Optically Anomalous Crystals begins with an historical introduction covering the contributions of Brewster, Biot, Mallard, Brauns, Tamman, and many other distinguished crystallographers. From this follows a tutorial in crystal optics. Further chapters discuss the two main mechanisms of optical dissymmetry: 1. the piezo-optic effect, and 2. the kinetic ordering of atoms. The text then tackles complex, inhomogeneous crystals, and...

Organic semiconductor crystals.

Science.gov (United States)

Wang, Chengliang; Dong, Huanli; Jiang, Lang; Hu, Wenping

2018-01-22

Organic semiconductors have attracted a lot of attention since the discovery of highly doped conductive polymers, due to the potential application in field-effect transistors (OFETs), light-emitting diodes (OLEDs) and photovoltaic cells (OPVs). Single crystals of organic semiconductors are particularly intriguing because they are free of grain boundaries and have long-range periodic order as well as minimal traps and defects. Hence, organic semiconductor crystals provide a powerful tool for revealing the intrinsic properties, examining the structure-property relationships, demonstrating the important factors for high performance devices and uncovering fundamental physics in organic semiconductors. This review provides a comprehensive overview of the molecular packing, morphology and charge transport features of organic semiconductor crystals, the control of crystallization for achieving high quality crystals and the device physics in the three main applications. We hope that this comprehensive summary can give a clear picture of the state-of-art status and guide future work in this area.

Crystal growth, spectral and laser properties of Nd:LuAG single crystal

International Nuclear Information System (INIS)

Xu, X D; Meng, J Q; Cheng, Y; Li, D Z; Cheng, S S; Wu, F; Zhao, Z W; Wang, X D; Xu, J

2009-01-01

Nd:LuAG (Nd:Lu 3 Al 5 O 12 ) crystal was grown by the Czochralski method. X-ray powder diffraction experiments show that the Nd:LuAG crystal crystallizes in the cubic with space group Ia3d and has the cell parameter: a = 1.1907 nm, V = 1.6882 nm 3 . The absorption and fluorescence spectra of Nd:LuAG crystal at room temperature were investigated. With a fiber-coupled diode laser as pump source, the continuous-wave (CW) laser action of Nd:LuAG crystal was demonstrated. The maximum output power at 1064 nm was obtained to be 3.8 W under the incident pump power of 17.3 W, with the optical conversion efficiency 22.0% and the slope efficiency 25.7%

Crystal growth, spectral and laser properties of Nd:LuAG single crystal

Science.gov (United States)

Xu, X. D.; Wang, X. D.; Meng, J. Q.; Cheng, Y.; Li, D. Z.; Cheng, S. S.; Wu, F.; Zhao, Z. W.; Xu, J.

2009-09-01

Nd:LuAG (Nd:Lu3Al5O12) crystal was grown by the Czochralski method. X-ray powder diffraction experiments show that the Nd:LuAG crystal crystallizes in the cubic with space group Ia3d and has the cell parameter: a = 1.1907 nm, V = 1.6882 nm3. The absorption and fluorescence spectra of Nd:LuAG crystal at room temperature were investigated. With a fiber-coupled diode laser as pump source, the continuous-wave (CW) laser action of Nd:LuAG crystal was demonstrated. The maximum output power at 1064 nm was obtained to be 3.8 W under the incident pump power of 17.3 W, with the optical conversion efficiency 22.0% and the slope efficiency 25.7%.

Dissolution enhancement of Deflazacort using hollow crystals prepared by antisolvent crystallization process.

Science.gov (United States)

Paulino, A S; Rauber, G; Campos, C E M; Maurício, M H P; de Avillez, R R; Capobianco, G; Cardoso, S G; Cuffini, S L

2013-05-13

Deflazacort (DFZ), a derivate of prednisolone, is a poorly soluble drug which has been proposed to have major advantages over other corticosteroids. Poorly soluble drugs present limited bioavailability due to their low solubility and dissolution rate and several strategies have been developed in order to find ways to improve them. In general, pharmaceutical laboratories use a micronized process to reduce the particle size in order to increase the dissolution of the drugs. However, this process causes changes such as polymorphic transitions, particle agglomeration and a reduction in fluidity and wettability. These solid-state properties affect the dissolution behavior and stability performance of drugs. Crystallization techniques are widely used in the pharmaceutical industry and antisolvent crystallization has been used to obtain ultrafine particles. In this study, DFZ was investigated in terms of its antisolvent crystallization in different solvents and under various preparation conditions (methanol/water ratio, stirring and evaporation rate, etc.), in order to compare the physicochemical properties between crystallized samples and raw materials available on the Brazilian market with and without micronization. Crystalline structure, morphology, and particle size, and their correlation with the Intrinsic Dissolution Rate (IDR) and dissolution profile as relevant biopharmaceutical properties were studied. Crystallization conditions were achieved which provided crystalline samples of hollow-shaped crystals with internal channels, which increased the dissolution rate of DFZ. The antisolvent crystallization process allowed the formation of hollow crystals, which demonstrated a better dissolution profile than the raw material (crystalline and micronized), making this a promising technique as a crystallization strategy for improving the dissolution and thus the bioavailability of poorly soluble drugs. Copyright © 2013 Elsevier B.V. All rights reserved.

Lu.sub.2./sub.SiO.sub.5./sub.:Ce and Y.sub.2./sub.SiO.sub.5./sub.:Ce single crystals and single crystalline film scintillators: comparisom of the luminescent and scintillation properties

Czech Academy of Sciences Publication Activity Database

Zorenko, Y.; Gorbenko, V.; Savchyn, V.; Zorenko, T.; Grinyov, B.; Sidletskiy, O.; Fedorov, A.; Mareš, Jiří A.; Nikl, Martin; Kučera, M.

2013-01-01

Roč. 56, SEP (2013), s. 84-89 ISSN 1350-4487. [International Conference on Luminescent Detectors and Transformers of Ionizing Radiation 2012 /8./, LUMDETR 2012. Halle (Saale), 10.09.2012-14.09.2012] R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : Lu 2 SiO 5 :Ce * Y 2 SiO 2 * single crystalline film, * single crystal * luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.140, year: 2013

Studies on growth, crystal structure and characterization of novel organic nicotinium trifluoroacetate single crystals

Energy Technology Data Exchange (ETDEWEB)

Dhanaraj, P.V. [Centre for Crystal Growth, SSN College of Engineering, Kalavakkam 603 110 (India); Rajesh, N.P., E-mail: rajeshnp@hotmail.com [Centre for Crystal Growth, SSN College of Engineering, Kalavakkam 603 110 (India); Sundar, J. Kalyana; Natarajan, S. [Department of Physics, Madurai Kamaraj University, Madurai 625 021 (India); Vinitha, G. [Department of Physics, Crescent Engineering College, Chennai 600 048 (India)

2011-09-15

Highlights: {yields} Good quality crystals of nicotinium trifluoroacetate in monoclinic system were grown for first time. {yields} Nicotinium trifluoroacetate crystal exhibits third order nonlinear optical properties. {yields} The optical spectrum of nicotinium trifluoroacetate crystal reveals the wide transmission in the entire range with cutoff wavelength at 286 nm. {yields} Nicotinium trifluoroacetate is a low dielectric constant material. - Abstract: An organic material, nicotinium trifluoroacetate (NTF) was synthesized and single crystals in monoclinic system were grown from aqueous solution for the first time. Its solubility and metastable zone width were estimated. The crystal structure of NTF was analyzed to reveal the molecular arrangements and the formation of hydrogen bonds in the crystal. High-resolution X-ray diffraction rocking curve measurements were performed to analyze the structural perfection of the grown crystals. Functional groups in NTF were identified by Fourier transform infrared spectral analysis. Thermal behaviour and stability of NTF were studied by thermogravimetric and differential thermal analysis and differential scanning calorimetry. Mechanical and dielectric properties of NTF crystals were analyzed. Optical studies reveal that NTF crystals are transparent in the wavelength range 286-1100 nm. The third order nonlinear optical parameters of NTF were derived by the Z-scan technique.

Crystallization and Characterization of Galdieria sulphuraria RUBISCO in Two Crystal Forms: Structural Phase Transition Observed in P21 Crystal Form

Directory of Open Access Journals (Sweden)

Boguslaw Stec

2007-10-01

Full Text Available We have isolated ribulose-1,5-bisphosphate-carboxylase/oxygenase (RUBISCOfrom the red algae Galdieria Sulphuraria. The protein crystallized in two different crystalforms, the I422 crystal form being obtained from high salt and the P21 crystal form beingobtained from lower concentration of salt and PEG. We report here the crystallization,preliminary stages of structure determination and the detection of the structural phasetransition in the P21 crystal form of G. sulphuraria RUBISCO. This red algae enzymebelongs to the hexadecameric class (L8S8 with an approximate molecular weight 0.6MDa.The phase transition in G. sulphuraria RUBISCO leads from two hexadecamers to a singlehexadecamer per asymmetric unit. The preservation of diffraction power in a phasetransition for such a large macromolecule is rare.

Hybrid colloidal plasmonic-photonic crystals.

Science.gov (United States)

Romanov, Sergei G; Korovin, Alexander V; Regensburger, Alois; Peschel, Ulf

2011-06-17

We review the recently emerged class of hybrid metal-dielectric colloidal photonic crystals. The hybrid approach is understood as the combination of a dielectric photonic crystal with a continuous metal film. It allows to achieve a strong modification of the optical properties of photonic crystals by involving the light scattering at electronic excitations in the metal component into moulding of the light flow in series to the diffraction resonances occurring in the body of the photonic crystal. We consider different realizations of hybrid plasmonic-photonic crystals based on two- and three-dimensional colloidal photonic crystals in association with flat and corrugated metal films. In agreement with model calculations, different resonance phenomena determine the optical response of hybrid crystals leading to a broadly tuneable functionality of these crystals. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Phononic crystals fundamentals and applications

CERN Document Server

Adibi, Ali

2016-01-01

This book provides an in-depth analysis as well as an overview of phononic crystals. This book discusses numerous techniques for the analysis of phononic crystals and covers, among other material, sonic and ultrasonic structures, hypersonic planar structures and their characterization, and novel applications of phononic crystals. This is an ideal book for those working with micro and nanotechnology, MEMS (microelectromechanical systems), and acoustic devices. This book also: Presents an introduction to the fundamentals and properties of phononic crystals Covers simulation techniques for the analysis of phononic crystals Discusses sonic and ultrasonic, hypersonic and planar, and three-dimensional phononic crystal structures Illustrates how phononic crystal structures are being deployed in communication systems and sensing systems.

New cyclic aminals derived from rac-trans-1,2-diaminocyclohexane: synthesis and crystal structure of racemic 1,8,10,12-tetraazatetracyclo[8.3.1.1..sup.8,12./sup.O.sup.2,7./sup.] pentadecane and a route to its enantiomerically pure (R,R) and (S,S) isomers

Czech Academy of Sciences Publication Activity Database

Rivera, A.; Quiroga, D.; Jiménez-Cruz, L.; Fejfarová, Karla; Dušek, Michal

2012-01-01

Roč. 53, č. 3 (2012), s. 345-348 ISSN 0040-4039 Grant - others:AV ČR(CZ) AP0701 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : crystal structure * X-ray diffraction * Jana2006 * chiral cyclic aminals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.397, year: 2012

ISSN 2073 ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg.

African Journals Online (AJOL)

DELL

A 12 years old girl, first in birth order was brou right clavicular area. The swelling had been not in size gradually as the patient grew up with ag medical, surgical or family history of significa injury. On examination, the patient was of avera middle of right clavicle. The skin over the lum increased with abduction of the right.

Tunable bandpass filter based on photonic crystal fiber filled with multiple liquid crystals

DEFF Research Database (Denmark)

Scolari, Lara; Tartarini, G.; Borelli, E.

2007-01-01

A tunable bandpass filter based on a photonic crystal fiber filled with two different liquid crystals is demonstrated. 130 nm bandwidth tunability is achieved by tuning the temperature from 30degC to 90degC.......A tunable bandpass filter based on a photonic crystal fiber filled with two different liquid crystals is demonstrated. 130 nm bandwidth tunability is achieved by tuning the temperature from 30degC to 90degC....

Crystal growth and magnetic property of YFeO3 crystal

Indian Academy of Sciences (India)

2Department of Physics, Shanghai University, Shanghai 200444, China. 3School ... YFeO3 and other rare earth substituted crystals with distorted orthorhombic pervoskite-like struc- .... gen, with rotation rates of 30 rpm for the growing crystal or.

Modeling of monolayer charge-stabilized colloidal crystals with static hexagonal crystal lattice

Science.gov (United States)

Nagatkin, A. N.; Dyshlovenko, P. E.

2018-01-01

The mathematical model of monolayer colloidal crystals of charged hard spheres in liquid electrolyte is proposed. The particles in the monolayer are arranged into the two-dimensional hexagonal crystal lattice. The model enables finding elastic constants of the crystals from the stress-strain dependencies. The model is based on the nonlinear Poisson-Boltzmann differential equation. The Poisson-Boltzmann equation is solved numerically by the finite element method for any spatial configuration. The model has five geometrical and electrical parameters. The model is used to study the crystal with particles comparable in size with the Debye length of the electrolyte. The first- and second-order elastic constants are found for a broad range of densities. The model crystal turns out to be stable relative to small uniform stretching and shearing. It is also demonstrated that the Cauchy relation is not fulfilled in the crystal. This means that the pair effective interaction of any kind is not sufficient to proper model the elasticity of colloids within the one-component approach.

EFFECT OF CONTINUOUS CRYSTALLIZER PERFORMANCE ON STRUVITE CRYSTALS PRODUCED IN REACTION CRYSTALLIZATION FROM SOLUTIONS CONTAINING PHOSPHATE(V AND ZINC(II IONS

Directory of Open Access Journals (Sweden)

N. Hutnik

Full Text Available Abstract Continuous reaction crystallization of struvite from aqueous solutions containing phosphate(V (1.0 mass % and zinc(II ions (from 0.1 to 2.0 mg kg-1 in a continuous DT MSMPR crystallizer was investigated. The influence of pH (9 - 11 and mean residence time (900 - 3600 s on the product characteristics and its chemical composition was tested. Struvite crystals of mean size 22-41 µm were produced. An increase in Zn2+ concentration decreased the mean crystal size and homogeneity. An elevation of the pH also decreased the struvite crystal size. Augmenting the mean residence time influenced product quality advantageously. Coexistence of struvite and Zn(OH2 in the product was confirmed analytically.

Crystal Genetics, Inc.

Science.gov (United States)

Kermani, Bahram G

2016-07-01

Crystal Genetics, Inc. is an early-stage genetic test company, focused on achieving the highest possible clinical-grade accuracy and comprehensiveness for detecting germline (e.g., in hereditary cancer) and somatic (e.g., in early cancer detection) mutations. Crystal's mission is to significantly improve the health status of the population, by providing high accuracy, comprehensive, flexible and affordable genetic tests, primarily in cancer. Crystal's philosophy is that when it comes to detecting mutations that are strongly correlated with life-threatening diseases, the detection accuracy of every single mutation counts: a single false-positive error could cause severe anxiety for the patient. And, more importantly, a single false-negative error could potentially cost the patient's life. Crystal's objective is to eliminate both of these error types.

Structure determination of KLaS.sub.2./sub., KPrS.sub.2./sub., KEuS.sub.2./sub., KGdS.sub.2./sub., KLuS.sub.2./sub., KYS.sub.2./sub., RbYS.sub.2./sub., NaLaS.sub.2./sub. and crystal-chemical analysis of the group 1 and thallium(I) rare-earth sulfide series

Czech Academy of Sciences Publication Activity Database

Fábry, Jan; Havlák, Lubomír; Dušek, Michal; Vaněk, Přemysl; Drahokoupil, Jan; Jurek, Karel

2014-01-01

Roč. 70, Part 2 (2014), s. 360-371 ISSN 0108-7681 R&D Projects: GA ČR(CZ) GAP204/11/0809; GA TA ČR TA01011017 Institutional support: RVO:68378271 Keywords : alkaline rare-earth sulfides * structure analysis * crystal chemistry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.184, year: 2014

Aluminum-air battery crystallizer

Science.gov (United States)

Maimoni, A.

1987-01-01

A prototype crystallizer system for the aluminum-air battery operated reliably through simulated startup and shutdown cycles and met its design objectives. The crystallizer system allows for crystallization and removal of the aluminium hydroxide reaction product; it is required to allow steady-state and long-term operation of the aluminum-air battery. The system has to minimize volume and maintain low turbulence and shear to minimize secondary nucleation and energy consumption while enhancing agglomeration. A lamella crystallizer satisfies system constraints.

Role of crystal orientation on chemical mechanical polishing of single crystal copper

Energy Technology Data Exchange (ETDEWEB)

Zhu, Aibin, E-mail: abzhu@mail.xjtu.edu.cn; He, Dayong; Luo, Wencheng; Liu, Yangyang

2016-11-15

Highlights: • The role of crystal orientation in cooper CMP by quasi-continuum was studied. • The atom displacement diagrams were obtained and analyzed. • The stress distribution diagrams and load-displacement curves were analyzed. • This research is helpful to revealing the material removal mechanism of CMP. - Abstract: The material removal mechanism of single crystal copper in chemical mechanical polishing (CMP) has not been intensively investigated. And the role of crystal orientation in CMP of single crystal cooper is not quite clear yet. Quasi-continuum method was adopted in this paper to simulate the process of nano-particles grinding on single crystal copper in CMP process. Three different crystal orientations, i.e. x[100]y[001], x[001]y[110] and x[–211]y[111], were chosen for analysis. The atom displacement diagrams, stress distribution diagrams and load-displacement curves were obtained. After analyzing the deformation mechanism, residual stress of the work piece material and cutting force, results showed that, the crystal orientation of work piece has great influence on the deformation characteristics and surface quality of work piece during polishing. In the A(001)[100] orientation, the residual stress distribution after polishing is deeper, and the stress is larger than that in the B(110)[001] and C(111)[–211] orientations. And the average tangential cutting force in the A(001)[100] orientation is much larger than those in the other two crystal orientation. This research is helpful to revealing the material removal mechanism of CMP process.

Photonic crystal pioneer

Science.gov (United States)

Anscombe, Nadya

2011-08-01

Over the past ten years, Crystal Fiber, now part of NKT Photonics, has been busy commercializing photonic crystal fibre. Nadya Anscombe finds out about the evolution of the technology and its applications.

Controlled growth of filamentary crystals and fabrication of single-crystal whisker probes

International Nuclear Information System (INIS)

Givargizov, E. I.

2006-01-01

The growth of filamentary crystals (whiskers) on a single-crystal substrate through the vapour-liquid-solid mechanism is described. The possibility of fabricating oriented systems of whiskers on the basis of this mechanism of crystal growth is noted. A phenomenon that is important for nanotechnology is noted: the existence of a critical diameter of whiskers, below which they are not formed. The phenomenon of radial periodic instability, which is characteristic of nanowhiskers, is described and the ways of its elimination are shown. The possibility of transforming whiskers into single-crystal tips and the growth of crystalline diamond particles at their apices are noted as important for practice. Possible applications of systems of whiskers and tips are described briefly. Particular attention is paid to the latest direction in whisker technology-fabrication of single-crystal whisker probes for atomic force microscopy

On-line monitoring of the crystallization process: relationship between crystal size and electrical impedance spectra

International Nuclear Information System (INIS)

Zhao, Yanlin; Yao, Jun; Wang, Mi

2016-01-01

On-line monitoring of crystal size in the crystallization process is crucial to many pharmaceutical and fine-chemical industrial applications. In this paper, a novel method is proposed for the on-line monitoring of the cooling crystallization process of L-glutamic acid (LGA) using electrical impedance spectroscopy (EIS). The EIS method can be used to monitor the growth of crystal particles relying on the presence of an electrical double layer on the charged particle surface and the polarization of double layer under the excitation of alternating electrical field. The electrical impedance spectra and crystal size were measured on-line simultaneously by an impedance analyzer and focused beam reflectance measurement (FBRM), respectively. The impedance spectra were analyzed using the equivalent circuit model and the equivalent circuit elements in the model can be obtained by fitting the experimental data. Two equivalent circuit elements, including capacitance ( C 2 ) and resistance ( R 2 ) from the dielectric polarization of the LGA solution and crystal particle/solution interface, are in relation with the crystal size. The mathematical relationship between the crystal size and the equivalent circuit elements can be obtained by a non-linear fitting method. The function can be used to predict the change of crystal size during the crystallization process. (paper)

Active Photonic Crystal Waveguides

DEFF Research Database (Denmark)

Ek, Sara

This thesis deals with the fabrication and characterization of active photonic crystal waveguides, realized in III-V semiconductor material with embedded active layers. The platform offering active photonic crystal waveguides has many potential applications. One of these is a compact photonic...... due to photonic crystal dispersion. The observations are explained by the enhancement of net gain by light slow down. Another application based on active photonic crystal waveguides is micro lasers. Measurements on quantum dot micro laser cavities with different mirror configurations and photonic...

Crystal growth and scintillation properties of Pr-doped SrI2 single crystals

Science.gov (United States)

Yokota, Yuui; Ito, Tomoki; Yoshino, Masao; Yamaji, Akihiro; Ohashi, Yuji; Kurosawa, Shunsuke; Kamada, Kei; Yoshikawa, Akira

2018-04-01

Pr-doped SrI2 (Pr:SrI2) single crystals with various Pr concentrations were grown by the halide-micro-pulling-down (H-μ-PD) method, and the scintillation properties were investigated. Pr1%:SrI2 single crystal with high transparency could be grown by the H-μ-PD method while Pr2, 3 and 5%:SrI2 single crystals included some cracks and opaque parts. In the photoluminescence spectrum of the Pr1%:SrI2 single crystal, an emission peak originated from the Pr3+ ion was observed around 435 nm while the radioluminescence spectra showed an emission peak around 535 nm for the undoped SrI2 and Pr:SrI2 single crystals. Light yields of Pr1, 2, 3 and 5%:SrI2 single crystals under γ-ray irradiation were 7700, 8700, 7200 and 6700 photons/MeV, respectively. Decay times of Pr1 and 2%:SrI2 single crystals under γ-ray irradiation were 55.9 and 35.0 ns of the fast decay component, and 435 and 408 ns of the slow decay component, respectively.

Improvement of crystal identification performance for a four-layer DOI detector composed of crystals segmented by laser processing

Science.gov (United States)

Mohammadi, Akram; Inadama, Naoko; Yoshida, Eiji; Nishikido, Fumihiko; Shimizu, Keiji; Yamaya, Taiga

2017-09-01

We have developed a four-layer depth of interaction (DOI) detector with single-side photon readout, in which segmented crystals with the patterned reflector insertion are separately identified by the Anger-type calculation. Optical conditions between segmented crystals, where there is no reflector, affect crystal identification ability. Our objective of this work was to improve crystal identification performance of the four-layer DOI detector that uses crystals segmented with a recently developed laser processing technique to include laser processed boundaries (LPBs). The detector consisted of 2 × 2 × 4mm3 LYSO crystals and a 4 × 4 array multianode photomultiplier tube (PMT) with 4.5 mm anode pitch. The 2D position map of the detector was calculated by the Anger calculation method. At first, influence of optical condition on crystal identification was evaluated for a one-layer detector consisting of a 2 × 2 crystal array with three different optical conditions between the crystals: crystals stuck together using room temperature vulcanized (RTV) rubber, crystals with air coupling and segmented crystals with LPBs. The crystal array with LPBs gave the shortest distance between crystal responses in the 2D position map compared with the crystal array coupled with RTV rubber or air due to the great amount of cross-talk between segmented crystals with LPBs. These results were used to find optical conditions offering the optimum distance between crystal responses in the 2D position map for the four-layer DOI detector. Crystal identification performance for the four-layer DOI detector consisting of an 8 × 8 array of crystals segmented with LPBs was examined and it was not acceptable for the crystals in the first layer. The crystal identification was improved for the first layer by changing the optical conditions between all 2 × 2 crystal arrays of the first layer to RTV coupling. More improvement was observed by combining different optical conditions between all

Hypersonic phononic crystals.

Science.gov (United States)

Gorishnyy, T; Ullal, C K; Maldovan, M; Fytas, G; Thomas, E L

2005-03-25

In this Letter we propose the use of hypersonic phononic crystals to control the emission and propagation of high frequency phonons. We report the fabrication of high quality, single crystalline hypersonic crystals using interference lithography and show that direct measurement of their phononic band structure is possible with Brillouin light scattering. Numerical calculations are employed to explain the nature of the observed propagation modes. This work lays the foundation for experimental studies of hypersonic crystals and, more generally, phonon-dependent processes in nanostructures.

Alignment of crystal orientations of the multi-domain photonic crystals in Parides sesostris wing scales

Science.gov (United States)

Yoshioka, S.; Fujita, H.; Kinoshita, S.; Matsuhana, B.

2014-01-01

It is known that the wing scales of the emerald-patched cattleheart butterfly, Parides sesostris, contain gyroid-type photonic crystals, which produce a green structural colour. However, the photonic crystal is not a single crystal that spreads over the entire scale, but it is separated into many small domains with different crystal orientations. As a photonic crystal generally has band gaps at different frequencies depending on the direction of light propagation, it seems mysterious that the scale is observed to be uniformly green under an optical microscope despite the multi-domain structure. In this study, we have carefully investigated the structure of the wing scale and discovered that the crystal orientations of different domains are not perfectly random, but there is a preferred crystal orientation that is aligned along the surface normal of the scale. This finding suggests that there is an additional factor during the developmental process of the microstructure that regulates the crystal orientation. PMID:24352678

Food crystallization and eggs.

Science.gov (United States)

Egg products can be utilized to control crystallization in a diverse realm of food products. Albumen and egg yolk can aid in the control of sugar crystal formation in candies. Egg yolk can enhance the textural properties and aid in the control of large ice crystal formation in frozen desserts. In...

Chitosan-Assisted Crystallization and Film Forming of Perovskite Crystals through Biomineralization.

Science.gov (United States)

Yang, Yang; Sun, Chen; Yip, Hin-Lap; Sun, Runcang; Wang, Xiaohui

2016-03-18

Biomimetic mineralization is a powerful approach for the synthesis of advanced composite materials with hierarchical organization and controlled structure. Herein, chitosan was introduced into a perovskite precursor solution as a biopolymer additive to control the crystallization and to improve the morphology and film-forming properties of a perovskite film by way of biomineralization. The biopolymer additive was able to control the size and morphology of the perovskite crystals and helped to form smooth films. The mechanism of chitosan-mediated nucleation and growth of the perovskite crystals was explored. As a possible application, the chitosan-perovskite composite film was introduced into a planar heterojunction solar cell and increased power conversion efficiency relative to that observed for the pristine perovskite film was achieved. The biomimetic mineralization method proposed in this study provides an alternative way of preparing perovskite crystals with well-controlled morphology and properties and extends the applications of perovskite crystals in photoelectronic fields, including planar-heterojunction solar cells. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Optics of globular photonic crystals

International Nuclear Information System (INIS)

Gorelik, V S

2007-01-01

The results of experimental and theoretical studies of the optical properties of globular photonic crystals - new physical objects having a crystal structure with the lattice period exceeding considerably the atomic size, are presented. As globular photonic crystals, artificial opal matrices consisting of close-packed silica globules of diameter ∼200 nm were used. The reflection spectra of these objects characterising the parameters of photonic bands existing in these crystals in the visible spectral region are presented. The idealised models of the energy band structure of photonic crystals investigated in the review give analytic dispersion dependences for the group velocity and the effective photon mass in a globular photonic crystal. The characteristics of secondary emission excited in globular photonic crystals by monochromatic and broadband radiation are presented. The results of investigations of single-photon-excited delayed scattering of light observed in globular photonic crystals exposed to cw UV radiation and radiation from a repetitively pulsed copper vapour laser are presented. The possibilities of using globular photonic crystals as active media for lasing in different spectral regions are considered. It is proposed to use globular photonic crystals as sensitive sensors in optoelectronic devices for molecular analysis of organic and inorganic materials by the modern methods of laser spectroscopy. The results of experimental studies of spontaneous and stimulated globular scattering of light are discussed. The conditions for observing resonance and two-photon-excited delayed scattering of light are found. The possibility of accumulation and localisation of the laser radiation energy inside a globular photonic crystal is reported. (review)

Crystal growth, optical properties, and laser operation of Yb3+-doped NYW single crystal

Science.gov (United States)

Cheng, Y.; Xu, X. D.; Yang, X. B.; Xin, Z.; Cao, D. H.; Xu, J.

2009-11-01

Laser crystal Yb3+-doped NaY(WO4)2 (Yb:NYW) with excellent quality has been grown by Czochralski technique. The rocking curves from (400) plane of as-grown Yb:NYW crystal was measured and the full-width value at half-maximum was 19.92″. The effective segregation coefficients were measured by the X-ray fluorescence method. The polarized absorption spectra and the fluorescence spectra of Yb:NYW crystal were measured at room temperature. The fluorescence decay lifetime of Yb3+ ion in NYW crystal has been investigated. The spectroscopic parameters of Yb:NYW crystal are calculated and compared with those of Yb:YAG crystal. A continuous wave output power of 3.06 W at 1031 nm was obtained with a slope efficiency of 42% by use of diode pumping.

the role of community participation in intermittent preventive

African Journals Online (AJOL)

2014-06-01

Jun 1, 2014 ... paid to community participation in malaria control in the past and this ... current Artemisinin Combination Therapy (ACT)for malaria treatment is ..... Malaria Journal. 2009; 8:292. . 2. Ghana Health Service: Final draft antimalarial drug policy for Ghana, Accra. 2004. 3. Keta District Report. Keta, 2001. 4. Pitt C ...

Cooling Crystallization of Indomethacin: Effect of Supersaturation, Temperature and Seeding on Polymorphism and Crystal Size Distribution

DEFF Research Database (Denmark)

Malwade, Chandrakant Ramkrishna; Qu, Haiyan

2018-01-01

In this work, effect of crystallization parameters i.e., supersaturation, seeding, and temperature on polymorphism and crystal size of a non-steroidal anti-inflammatory drug, indomethacin (IMC), was investigated. Firstly, several crystallization solvents (ethanol, methanol, ethyl acetate, acetone...... of IMC from ethanol confirmed that the supersaturation, operating temperature and seeding does affect the polymorphism as well as crystal size distribution of IMC. Fine needle shaped crystals of metastable α-IMC were obtained at 5 °C with high supersaturation even in presence of γ-IMC seeds, while...... rhombic plates like crystals of thermodynamically stable γ-IMC were obtained in remaining experiments. The amount of seed loading only marginally influenced the crystal growth rate and median particle diameter (d50). Particle size analysis of crystals obtained showed bimodal distribution in all...

Building a crystal palace

CERN Multimedia

2007-01-01

The end-caps of the CMS electromagnetic calorimeter (ECAL) take shape as the first quadrant was completed on Wednesday 3 October. 1831 crystals, organised into five by five blocks named ‘supercrystals’, make up the first quadrant of Dee 1.With the 61,200-crystal barrel of its electromagnetic calorimeter (ECAL) complete, CMS is now building the endcaps, on the tenth anniversary of their initial design. Crystals for the endcaps were the last to be made, so the race is now on to have them all in place and ready for the turn-on of the LHC next year. Assembly of the first of eight quadrants began in June and crystal mounting was completed on Wednesday 3 October. Each crystal is transparent, has a volume just larger than a CERN coffee cup yet weighs a huge 1.5kg. 1831 of these lead tungstate crystals went into the first quadrant from a total 14,648 in the endcaps. The lead and tungsten account for 86% of each crystal’s weight, but as project leader Dave Cockerill expl...

Protein-crystal growth experiment (planned)

Science.gov (United States)

Fujita, S.; Asano, K.; Hashitani, T.; Kitakohji, T.; Nemoto, H.; Kitamura, S.

1988-01-01

To evaluate the effectiveness of a microgravity environment on protein crystal growth, a system was developed using 5 cubic feet Get Away Special payload canister. In the experiment, protein (myoglobin) will be simultaneously crystallized from an aqueous solution in 16 crystallization units using three types of crystallization methods, i.e., batch, vapor diffusion, and free interface diffusion. Each unit has two compartments: one for the protein solution and the other for the ammonium sulfate solution. Compartments are separated by thick acrylic or thin stainless steel plates. Crystallization will be started by sliding out the plates, then will be periodically recorded up to 120 hours by a still camera. The temperature will be passively controlled by a phase transition thermal storage component and recorded in IC memory throughout the experiment. Microgravity environment can then be evaluated for protein crystal growth by comparing crystallization in space with that on Earth.

Preparation of Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8-x} tracks and thick films by jet printing

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 OHE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom). E-mail: bag10 at cus.cam.ac.uk

2000-05-01

The formation of the 2212 phase material on both silver and magnesium oxide (100) substrates was successfully achieved by the dropwise deposition of solutions of 2212 dissolved in nitric acid or organic acids such as acetic acid or propionic acid using commercial ink-jet printing head using so-called technique 'droplet-on-request'. Precursor solutions were prepared by dissolving either a mixture of metal nitrates (Bi(NO{sub 3}){sub 3}{center_dot}5H{sub 2}O, Sr(NO{sub 3}){sub 2}, Ca(NO{sub 3}){sub 2}{center_dot}4H{sub 2}O and Cu(NO{sub 3}){sub 2}{center_dot}3H{sub 2}O) or 2212 superconducting powder in acid solutions. From this initial study using simple solutions on conventional substrates such as polycrystalline silver and large MgO single crystals, the preparation of the textured thick 2212 film for superconducting circuits and interconnections by the ink-jet printing process appears quite promising. The critical temperatures of the selected superconducting coatings were in range of 82-92 K. (author)

Temperature-mediated polymorphism in molecular crystals: The impact on crystal packing and charge transport

KAUST Repository

Stevens, Loah A.; Goetz, Katelyn P.; Fonari, Alexandr; Shu, Ying; Williamson, Rachel M.; Bredas, Jean-Luc; Coropceanu, Veaceslav P.; Jurchescu, Oana D.; Collis, Gavin E.

2015-01-01

We report a novel synthesis to ultra high purity 7,14-bis((trimethylsilyl)ethynyl)dibenzo[b,def]-chrysene (TMS-DBC) and the use of this material in the growth of single crystals by solution and vapor deposition techniques. We observe that the substrate temperature has a dramatic impact on the crystal growth, producing two distinct polymorphs of TMS-DBC; low temperature (LT) fine red needles and high temperature (HT) large yellow platelets. Single crystal X-ray crystallography confirms packing structures where the LT crystals form a 1D slipped-stack structure, while the HT crystals adopt a 2D brickwork motif. These polymorphs also represent a rare example where both are extremely stable and do not interconvert to the other crystal structure upon solvent or thermal annealing. Single crystal organic field-effect transistors of the LT and HT crystals show that the HT 2D brickwork motif produces hole mobilities as high as 2.1 cm2 V-1 s-1, while the mobility of the 1D structure is significantly lower, at 0.028 cm2 V-1 s-1. Electronic-structure calculations indicate that the superior charge transport in the brickwork polymorph in comparison to the slipped-stack polymorph is due to the presence of an increased dimensionality of the charge migration pathways.

Temperature-mediated polymorphism in molecular crystals: The impact on crystal packing and charge transport

KAUST Repository

Stevens, Loah A.

2015-01-13

We report a novel synthesis to ultra high purity 7,14-bis((trimethylsilyl)ethynyl)dibenzo[b,def]-chrysene (TMS-DBC) and the use of this material in the growth of single crystals by solution and vapor deposition techniques. We observe that the substrate temperature has a dramatic impact on the crystal growth, producing two distinct polymorphs of TMS-DBC; low temperature (LT) fine red needles and high temperature (HT) large yellow platelets. Single crystal X-ray crystallography confirms packing structures where the LT crystals form a 1D slipped-stack structure, while the HT crystals adopt a 2D brickwork motif. These polymorphs also represent a rare example where both are extremely stable and do not interconvert to the other crystal structure upon solvent or thermal annealing. Single crystal organic field-effect transistors of the LT and HT crystals show that the HT 2D brickwork motif produces hole mobilities as high as 2.1 cm2 V-1 s-1, while the mobility of the 1D structure is significantly lower, at 0.028 cm2 V-1 s-1. Electronic-structure calculations indicate that the superior charge transport in the brickwork polymorph in comparison to the slipped-stack polymorph is due to the presence of an increased dimensionality of the charge migration pathways.

Physico-mechanical and dissolution behaviours of ibuprofen crystals crystallized in the presence of various additives

Directory of Open Access Journals (Sweden)

A Nokhodchi

2010-06-01

Full Text Available "n  "n Background and the purpose of the study: The success of any direct-tableting procedure is strongly affected by the quality of the crystals used in the process. Ibuprofen is a poorly compactible drug with a high tendency for capping. In order to use ibuprofen in direct compression formulations, physico-mechanical properties of ibuprofen should be improved considerably. The aim of the present investigation was to employ crystallization techniques in order to improve the physico-mechanical properties of ibuprofen for direct compression. "nMethods:The experimental methods involved the preparation of ibuprofen crystals by solvent change technique. Ibuprofen was dissolved in ethanol and crystallized out with water in the absence or presence of various hydrophilic additives (PEG 6000, 8000, Brij 98P and polyvinyl alcohol 22000, PVA 22000 with different concentrations. The physico-mechanical properties of the ibuprofen crystals were studied in terms of flow, density, tensile strength and dissolution behaviour. Morphology of ibuprofen crystals was studied by scanning electron microscopic (SEM. Solid state of the recrystallized particles was also investigated using differential scanning calorimeter (DSC and FT-IR. "nResults:Ibuprofen samples crystallized in the presence of PEG 6000 and 8000 and PVA showed remarkable increase in the tensile strengths of the directly compressed tablets, while some other additives, i.e. Brij 98P did not produce improved ibuprofen crystals. Ibuprofen powders made from particles obtained in the presence of PVA and Brij 98P showed similar dissolution profiles to the commercial ibuprofen particles. DSC and FT-IR results ruled out any significant interaction between ibuprofen and additives except for the samples crystallized in the presence of PEG 8000. Conclusion:The crystal habit of ibuprofen can be altered successfully by the crystallization technique which was developed in this study. The crystals developed in the

Thermo-, photo-, and mechano-responsive liquid crystal networks enable tunable photonic crystals.

Science.gov (United States)

Akamatsu, N; Hisano, K; Tatsumi, R; Aizawa, M; Barrett, C J; Shishido, A

2017-10-25

Tunable photonic crystals exhibiting optical properties that respond reversibly to external stimuli have been developed using liquid crystal networks (LCNs) and liquid crystal elastomers (LCEs). These tunable photonic crystals possess an inverse opal structure and are photo-responsive, but circumvent the usual requirement to contain dye molecules in the structure that often limit their applicability and cause optical degradation. Herein, we report tunable photonic crystal films that reversibly tune the reflection peak wavelength under thermo-, photo- and mechano-stimuli, through bilayering a stimuli-responsive LCN including azobenzene units with a colourless inverse opal film composed of non-responsive, flexible durable polymers. By mechanically deforming the azobenzene containing LCN via various stimuli, the reflection peak wavelength from the bilayered film assembly could be shifted on demand. We confirm that the reflection peak shift occurs due to the deformation of the stimuli-responsive layer propagating towards and into the inverse opal layer to change its shape in response, and this shift behaviour is repeatable without optical degradation.

Crystallization Stages of the Bishop Tuff Magma Body Recorded in Crystal Textures in Pumice Clasts

Energy Technology Data Exchange (ETDEWEB)

Pamukcu, Ayla; Gualda, Guilherme A.R.; Anderson, Jr. , Alfred T. (Vanderbilt); (UC)

2012-07-25

The Bishop Tuff is a giant silicic ignimbrite erupted at 0.76 Ma in eastern California, USA. Five pumice clasts from the late-erupted Bishop Tuff (Aeolian Buttes) were studied in an effort to better understand the pre- and syn-eruptive history of the Bishop magma body and place constraints on the timescales of its existence. This study complements and expands on a previous study that focused on early-erupted Bishop Tuff pumice clasts. Bulk densities of pumice clasts were measured using an immersion method, and phenocryst crystal contents were determined using a sieving and winnowing procedure. X-ray tomography was used to obtain qualitative and quantitative textural information, particularly crystal size distributions (CSDs). We have determined CSDs for crystals ranging in size from {approx}10 to {approx}1000 {micro}m for three groups of mineral phases: magnetite ({+-}ilmenite), pyroxene + biotite, quartz + feldspar. Similar to early-erupted pumice, late-erupted pumice bulk density and crystal contents are positively correlated, and comparison of crystal fraction vs size trends suggests that the proportion of large crystals is the primary control on crystallinity. Porosity is negatively correlated with crystal content, which is difficult to reconcile with closed-system crystallization. Magnetite and pyroxene + biotite size distributions are fractal in nature, often attributed to fragmentation; however, crystals are mostly whole and euhedral, such that an alternative mechanism is necessary to explain these distributions. Quartz + feldspar size distributions are kinked, with a shallow-sloped log-linear section describing large crystals (> 140 {micro}m) and a steep-sloped log-linear section describing small crystals (< 140 {micro}m). We interpret these two crystal populations as resulting from a shift in crystallization regime. We suggest that the shallow-sloped section describes a pre-eruptive quartz + feldspar growth-dominated regime, whereas the steep

Characteristics of indomethacin-saccharin (IMC-SAC) co-crystals prepared by an anti-solvent crystallization process.

Science.gov (United States)

Chun, Nan-Hee; Wang, In-Chun; Lee, Min-Jeong; Jung, Yun-Taek; Lee, Sangkil; Kim, Woo-Sik; Choi, Guang J

2013-11-01

The creation of co-crystals of various insoluble drug substances has been extensively investigated as a promising approach to improve their pharmaceutical performance. In this study, co-crystal powders of indomethacin and saccharin (IMC-SAC) were prepared by an anti-solvent (water) addition and compared with co-crystals by evaporation method. No successful synthesis of a pharmaceutical co-crystal powder via an anti-solvent approach has been reported. Among solvents examined, methanol was practically the only one that resulted in the formation of highly pure IMC-SAC co-crystal powders by anti-solvent approach. The mechanism of a preferential formation of IMC-SAC co-crystal to IMC was explained with two aspects: phase solubility diagram and solution complexation concept. Accordingly, the anti-solvent approach can be considered as a competitive route for producing pharmaceutical co-crystal powders with acceptable properties. Copyright © 2013 Elsevier B.V. All rights reserved.

Phenomenon of ''self-cleaning'' of crystals

International Nuclear Information System (INIS)

Matveev, O.A.; Arkad'eva, E.N.; Goncharov, L.A.

1975-01-01

Crystals of germanium and cadmium telluride have been produced having the characteristics corresponding to the low content of electrically active impurities and crystal defects. The crystals have been grown under conditions of an equilibrium diffusion-concentration interaction of the impurities and crystal defects, with the donor alloying and controlling the acceptors concentration. These crystals have been studied with the help of the mass-spectral analysis, the Hall effect, photoelectroscopy, spectral photoconductivity and losses of collection of a charge from an ionizing particle on gamma-detectors fabricated of the crystals. Herein the doped composition of the crystals has been determined, the concentrations of the shallow and deep acceptors and donors have been measured separately, the life-times of the electrons and holes have been measured, the energetic position and the concentration of the carrier capture levels have been determined. The crystals grown possess all the characteristic features of rather pure crystals. The results of the mass-spectral analysis have shown that in the cadmium telluride crystals the impurities are present within 10 14 to 10 17 cm -3 . Therefore, a deep ''self-refining'' of the crystal takes place, which proceeds by means of deactivation of the electrically active centers with their associating into electrically inactive complexes. Thus a fact of the deep ''self-refining'' of germanium- and cadmium telluride crystals is stated. It is presumed that such a ''self-refining'' can actually proceed practically in all the crystals

Disorder in Protein Crystals.

Science.gov (United States)

Clarage, James Braun, II

1990-01-01

Methods have been developed for analyzing the diffuse x-ray scattering in the halos about a crystal's Bragg reflections as a means of determining correlations in atomic displacements in protein crystals. The diffuse intensity distribution for rhombohedral insulin, tetragonal lysozyme, and triclinic lysozyme crystals was best simulated in terms of exponential displacement correlation functions. About 90% of the disorder can be accounted for by internal movements correlated with a decay distance of about 6A; the remaining 10% corresponds to intermolecular movements that decay in a distance the order of size of the protein molecule. The results demonstrate that protein crystals fit into neither the Einstein nor the Debye paradigms for thermally fluctuating crystalline solids. Unlike the Einstein model, there are correlations in the atomic displacements, but these correlations decay more steeply with distance than predicted by the Debye-Waller model for an elastic solid. The observed displacement correlations are liquid -like in the sense that they decay exponentially with the distance between atoms, just as positional correlations in a liquid. This liquid-like disorder is similar to the disorder observed in 2-D crystals of polystyrene latex spheres, and similar systems where repulsive interactions dominate; hence, these colloidal crystals appear to provide a better analogy for the dynamics of protein crystals than perfectly elastic lattices.

Last crystals for the CMS chandelier

CERN Multimedia

2008-01-01

In March, the last crystals for CMS’s electromagnetic calorimeter arrived from Russia and China. Like dedicated jewellers crafting an immense chandelier, the CMS ECAL collaborators are working extremely hard to install all the crystals before the start-up of the LHC. One of the last CMS end-cap crystals, complete with identification bar code. Lead tungstate crystals mounted onto one section of the CMS ECAL end caps. Nearly 10 years after the first production crystal arrived at CERN in September 1998, the very last shipment has arrived. These final crystals will be used to complete the end-caps of the electromagnetic calorimeter (ECAL) at CMS. All in all, there are more than 75,000 crystals in the ECAL. The huge quantity of CMS lead tungstate crystals used in the ECAL corresponds to the highest volume ever produced for a single experiment. The excellent quality of the crystals, both in ter...

Elastic properties of Ti-24Nb-4Zr-8Sn single crystals with bcc crystal structure

International Nuclear Information System (INIS)

Zhang, Y.W.; Li, S.J.; Obbard, E.G.; Wang, H.; Wang, S.C.; Hao, Y.L.; Yang, R.

2011-01-01

Research highlights: → The single crystals of Ti2448 alloy with the bcc crystal structure were prepared. → The elastic moduli and constants were measured by several resonant methods. → The crystal shows significant elastic asymmetry in tension and compression. → The crystal exhibits weak nonlinear elasticity with large elastic strain ∼2.5%. → The crystal has weak atomic interactions against crystal distortion to low symmetry. - Abstract: Single crystals of Ti2448 alloy (Ti-24Nb-4Zr-8Sn in wt.%) were grown successfully using an optical floating-zone furnace. Several kinds of resonant methods gave consistent Young's moduli of 27.1, 56.3 and 88.1 GPa and shear moduli of 34.8, 11.0 and 14.6 GPa for the , and oriented single crystals, and C 11 , C 12 and C 44 of 57.2, 36.1 and 35.9 GPa respectively. Uniaxial testing revealed asymmetrical elastic behaviors of the crystals: tension caused elastic softening with a large reversible strain of ∼4% and a stress plateau of ∼250 MPa, whereas compression resulted in gradual elastic stiffening with much smaller reversible strain. The crystals exhibited weak nonlinear elasticity with a large elastic strain of ∼2.5% and a high strength, approaching ∼20% and ∼30% of its ideal shear and ideal tensile strength respectively. The crystals showed linear elasticity with a small elastic strain of ∼1%. These elastic deformation characteristics have been interpreted in terms of weakened atomic interactions against crystal distortion to low crystal symmetry under external applied stresses. These results are consistent with the properties of polycrystalline Ti2448, including high strength, low elastic modulus, large recoverable strain and weak strengthening effect due to grain refinement.

Radiation Damage in Scintillating Crystals

CERN Document Server

Zhu Ren Yuan

1998-01-01

Crystal Calorimetry in future high energy physics experiments faces a new challenge to maintain its precision in a hostile radiation environment. This paper discusses the effects of radiation damage in scintillating crystals, and concludes that the predominant radiation damage effect in crystal scintillators is the radiation induced absorption, or color center formation, not the loss of the scintillation light yield. The importance of maintaining crystal's light response uniformity and the feasibility to build a precision crystal calorimeter under radiation are elaborated. The mechanism of the radiation damage in scintillating crystals is also discussed. While the damage in alkali halides is found to be caused by the oxygen or hydroxyl contamination, it is the structure defects, such as oxygen vacancies, cause damage in oxides. Material analysis methods used to reach these conclusions are presented in details.

Preparation of Three-Dimensional Photonic Crystals of Zirconia by Electrodeposition in a Colloidal Crystals Template

Directory of Open Access Journals (Sweden)

Lei Pan

2016-07-01

Full Text Available Three-dimensional photonic crystals of zirconia were prepared by electrodeposition in a colloidal crystals template following calcination at 500 °C. Scanning electron microscopy, thermogravimetric analysis, X-ray diffraction, and reflectance spectroscopy were employed to characterize the photonic crystals of zirconia. It was found that hydrated zirconium ions could penetrate the colloidal crystals template and reach the substrate easily by electrodeposition, which resulted in stronger bonding between the substrate and the as-deposited membrane. Moreover, the electrodeposited membrane had low water content, leading to a low amount of shrinkage during calcination. Both these properties could suppress detachment from the substrate upon removal of the colloidal crystals template. Therefore, the three-dimensional photonic crystals of zirconia synthesized in this study exhibited very good preservation of the ordered structures of the colloidal crystals template with a high density. A peak of reflection higher than 70% was formed in the reflectance spectrum because of the strong diffraction of the ordered structures.

Crystallization of isoelectrically homogeneous cholera toxin

International Nuclear Information System (INIS)

Spangler, B.D.; Westbrook, E.M.

1989-01-01

Past difficulty in growing good crystals of cholera toxin has prevented the study of the crystal structure of this important protein. The authors have determined that failure of cholera toxin to crystallize well has been due to its heterogeneity. They have now succeeded in overcoming the problem by isolating a single isoelectric variant of this oligomeric protein (one A subunit and five B subunits). Cholera toxin purified by their procedure readily forms large single crystals. The crystal form has been described previously. They have recorded data from native crystals of cholera toxin to 3.0-angstrom resolution with our electronic area detectors. With these data, they have found the orientation of a 5-fold symmetry axis within these crystals, perpendicular to the screw dyad of the crystal. They are now determining the crystal structure of cholera toxin by a combination of multiple heavy-atom isomorphous replacement and density modification techniques, making use of rotational 5-fold averaging of the B subunits

Antioxidative succinobucol-sterol conjugates: Crystal structures and pseudosymmetry in the crystals

Czech Academy of Sciences Publication Activity Database

Ikonen, S.; Jurček, Ondřej; Wimmer, Zdeněk; Drašar, P.; Kolehmainen, E.

2012-01-01

Roč. 1011, Mar 2012 (2012), s. 25-33 ISSN 0022-2860 R&D Projects: GA MŠk(CZ) OC10001; GA MŠk 2B06024 Institutional research plan: CEZ:AV0Z50380511 Keywords : Probucol * Steroid * Phytosterol Subject RIV: CC - Organic Chemistry Impact factor: 1.404, year: 2012

Preparation and characterization of superfine ammonium perchlorate (AP) crystals through ceramic membrane anti-solvent crystallization

Science.gov (United States)

Ma, Zhenye; Li, Cheng; Wu, Rujun; Chen, Rizhi; Gu, Zhenggui

2009-10-01

In this paper, a novel ceramic membrane anti-solvent crystallization (CMASC) method was proposed for the safe and rapid preparation ammonium perchlorate (AP) crystals, in which the acetone and ethyl acetate were chosen as solvent and anti-solvent, respectively. Comparing with the conventional liquid anti-solvent crystallization (LASC), CMASC which successfully introduces ceramic membrane with regular pore structure to the LASC as feeding medium, is favorable to control the rate of feeding rate and, therefore, to obtain size and morphology controllable AP. Several kinds of micro-sized AP particles with different morphology were obtained including polyhedral-like, quadrate-like to rod-like. The effect of processing parameters on the crystal size and shape of AP crystals such as volume ratio of anti-solvent to solvent, feeding pressure and crystallization temperature were investigated. It is found that higher volume ratio of anti-solvent to solvent, higher feeding pressure and higher temperature result in smaller particle size. Scaning electron microscopy (SEM) and X-ray diffraction (XRD) were used to characterize the resulting AP crystals. The nucleation and growth kinetic of the resulting AP crystals were also discussed.

Synthesis, spectroscopic study and crystal structure of a new single-enantiomer C(O)NHP(O)-based phosphoric triamide, CCl.sub.3./sub.C(O)NHP(O)[(R)-(+)-NHCH(CH.sub.3./sub.)(C.sub.6./sub.H.sub.5./sub.)].sub.2./sub..0.25H.sub.2./sub.O

Czech Academy of Sciences Publication Activity Database

Ariani, M.; Pouirayoubi, M.; Dušek, Michal; Vahdani Alviri, B.; Eigner, Václav; Damodaran, K.

2017-01-01

Roč. 33, č. 4 (2017), s. 17-19 ISSN 1883-3578 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : crystal structure * phosphoric triamide * single-enantiomer * X-ray analysis Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.)

Introduction to crystal growth and characterization

CERN Document Server

Benz, Klaus-Werner

2014-01-01

This new textbook provides for the first time a comprehensive treatment of the basics of contemporary crystallography and crystal growth in a single volume. The reader will be familiarized with the concepts for the description of morphological and structural symmetry of crystals. The architecture of crystal structures of selected inorganic and molecular crystals is illustrated. The main crystallographic databases as data sources of crystal structures are described. Nucleation processes, their kinetics and main growth mechanism will be introduced in fundamentals of crystal growth. Some phase d

Experimental investigation and crystal-field modeling of Er{sup 3+} energy levels in GSGG crystal

Energy Technology Data Exchange (ETDEWEB)

Gao, J.Y., E-mail: jygao1985@sina.com [Anhui Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Hefei 230031 (China); Sun, D.L.; Zhang, Q.L. [Anhui Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Hefei 230031 (China); Wang, X.F. [Anhui Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Hefei 230031 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100049 (China); Liu, W.P.; Luo, J.Q.; Sun, G.H.; Yin, S.T. [Anhui Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Hefei 230031 (China)

2016-06-25

The Er{sup 3+}-doped Gd{sub 3}Sc{sub 2}Ga{sub 3}O{sub 12} (Er{sup 3+}:GSGG) single crystal, a excellent medium of the mid-infrared and anti-radiation solid state laser pumped by laser diode, was grown by Czochralski method successfully. The absorption spectra were measured and analyzed in a wider spectral wavelength range of 350–1700 nm at different temperatures of 7.6, 77, 200 and 300 K. The free-ions and crystal-field parameters were fitted to the experimental energy levels with the root mean square deviation of 9.86 cm{sup −1}. According to the crystal-field calculations, 124 degenerate energy levels of Er{sup 3+} in GSGG host crystals were assigned. The fitting results of free-ions and crystal-field parameters were compared with those already reported of Er{sup 3+}:YSGG. The results indicated that the free-ions parameters for Er{sup 3+} in GSGG host are similar to those in YSGG host crystals, and the crystal-field interaction of GSGG is weaker than that of YSGG, which may result in the better laser characterization of Er{sup 3+}:GSGG crystal. - Highlights: • The efficient diode-end-pumped laser crystal Er:GSGG has been grown successfully. • The absorption spectra of Er:GSGG have been measured in range of 350–1700 nm. • The fitting result is very well for the root mean square deviation is 9.86 cm{sup −1}. • The 124 levels of Er:GSGG have been assigned from the crystal-field calculations.

1D polymeric copper(I) complex [Cu-.sub.2./sub.(mu-(2,6-Cl-ba).sub.2./sub.en)(mu-I).sub.2./sub.].sub.n./sub. with exceptionally short Cu-Cu distance: synthesis, characterization, thermal study and crystal structure

Czech Academy of Sciences Publication Activity Database

Khalaji, A.D.; Peyghoun, S.J.; Akbari, A.; Feizi, N.; Dušek, Michal; Eigner, Václav

2017-01-01

Roč. 1127, Jan (2017), s. 511-514 ISSN 0022-2860 R&D Projects: GA MŠk LO1603; GA ČR(CZ) GA14-03276S EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : 1D polymer * copper(I) complex * Schiff base ligand * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.753, year: 2016

The MORPHEUS II protein crystallization screen

Energy Technology Data Exchange (ETDEWEB)

Gorrec, Fabrice, E-mail: fgorrec@mrc-lmb.cam.ac.uk [MRC Laboratory of Molecular Biology, Francis Crick Avenue, Cambridge Biomedical Campus, Cambridge CB2 0QH (United Kingdom)

2015-06-27

MORPHEUS II is a 96-condition initial crystallization screen formulated de novo. The screen incorporates reagents selected from the Protein Data Bank to yield crystals that are not observed in traditional conditions. In addition, the formulation facilitates the optimization and cryoprotection of crystals. High-quality macromolecular crystals are a prerequisite for the process of protein structure determination by X-ray diffraction. Unfortunately, the relative yield of diffraction-quality crystals from crystallization experiments is often very low. In this context, innovative crystallization screen formulations are continuously being developed. In the past, MORPHEUS, a screen in which each condition integrates a mix of additives selected from the Protein Data Bank, a cryoprotectant and a buffer system, was developed. Here, MORPHEUS II, a follow-up to the original 96-condition initial screen, is described. Reagents were selected to yield crystals when none might be observed in traditional initial screens. Besides, the screen includes heavy atoms for experimental phasing and small polyols to ensure the cryoprotection of crystals. The suitability of the resulting novel conditions is shown by the crystallization of a broad variety of protein samples and their efficiency is compared with commercially available conditions.

The MORPHEUS II protein crystallization screen

International Nuclear Information System (INIS)

Gorrec, Fabrice

2015-01-01

MORPHEUS II is a 96-condition initial crystallization screen formulated de novo. The screen incorporates reagents selected from the Protein Data Bank to yield crystals that are not observed in traditional conditions. In addition, the formulation facilitates the optimization and cryoprotection of crystals. High-quality macromolecular crystals are a prerequisite for the process of protein structure determination by X-ray diffraction. Unfortunately, the relative yield of diffraction-quality crystals from crystallization experiments is often very low. In this context, innovative crystallization screen formulations are continuously being developed. In the past, MORPHEUS, a screen in which each condition integrates a mix of additives selected from the Protein Data Bank, a cryoprotectant and a buffer system, was developed. Here, MORPHEUS II, a follow-up to the original 96-condition initial screen, is described. Reagents were selected to yield crystals when none might be observed in traditional initial screens. Besides, the screen includes heavy atoms for experimental phasing and small polyols to ensure the cryoprotection of crystals. The suitability of the resulting novel conditions is shown by the crystallization of a broad variety of protein samples and their efficiency is compared with commercially available conditions

Magnetostriction of Tb-Dy-Fe crystals

International Nuclear Information System (INIS)

Mei Wu; Okane, T.; Umeda, T.

1998-01-01

left angle 111 right angle -oriented twin free Tb-Dy-Fe single crystals, left angle 112 right angle - and left angle 110 right angle -oriented twinned ''single'' Tb-Dy-Fe crystals were prepared using floating zone melting crystal growth methods. Magnetostrictive performances of the crystals were investigated. Better low-field properties were observed in the left angle 110 right angle twinned crystals than in the left angle 112 right angle crystals. The highest properties were achieved in the left angle 111 right angle twin free single crystals. Even though there were still oxidized particles in the present left angle 111 right angle single crystals, a large magnetostrictive jump of 1700 ppm and a very low saturation magnetic field of 500 Oe were obtained. To understand magnetization and magnetostriction of different Tb-Dy-Fe crystals, theoretical modeling was carried out based on a simplified domain rotation model. Magnetization moment rotation paths of different domains were simulated and hence the resultant magnetostriction was obtained, which could adequately account for the experimental results of different crystals. The limitation of the domain rotation model was also discussed. (orig.)

Crystallization of copper metaphosphate glass

Science.gov (United States)

Bae, Byeong-Soo; Weinberg, Michael C.

1993-01-01

The effect of the valence state of copper in copper metaphosphate glass on the crystallization behavior and glass transition temperature has been investigated. The crystallization of copper metaphosphate is initiated from the surface and its main crystalline phase is copper metaphosphate (Cu(PO)3),independent of the (Cu sup 2+)/(Cu(total)). However, the crystal morphology, the relative crystallization rates, and their temperature dependences are affected by the (Cu sup 2+)/(Cu (total)) ratio in the glass. On the other hand, the totally oxidized glass crystallizes from all over the surface. The relative crystallization rate of the reduced glass to the totally oxidized glass is large at low temperature, but small at high temperature. The glass transition temperature of the glass increases as the (Cu sup 2+)/(Cu(total)) ratio is raised. It is also found that the atmosphere used during heat treatment does not influence the crystallization of the reduced glass, except for the formation of a very thin CuO surface layer when heated in air.

Crystal ball single event display

International Nuclear Information System (INIS)

Grosnick, D.; Gibson, A.; Allgower, C.; Alyea, J.; Argonne National Lab., IL

1997-01-01

The Single Event Display (SED) is a routine that is designed to provide information graphically about a triggered event within the Crystal Ball. The SED is written entirely in FORTRAN and uses the CERN-based HICZ graphing package. The primary display shows the amount of energy deposited in each of the NaI crystals on a Mercator-like projection of the crystals. Ten different shades and colors correspond to varying amounts of energy deposited within a crystal. Information about energy clusters is displayed on the crystal map by outlining in red the thirteen (or twelve) crystals contained within a cluster and assigning each cluster a number. Additional information about energy clusters is provided in a series of boxes containing useful data about the energy distribution among the crystals within the cluster. Other information shown on the event display include the event trigger type and data about π o 's and η's formed from pairs of clusters as found by the analyzer. A description of the major features is given, along with some information on how to install the SED into the analyzer

Hopper Growth of Salt Crystals.

Science.gov (United States)

Desarnaud, Julie; Derluyn, Hannelore; Carmeliet, Jan; Bonn, Daniel; Shahidzadeh, Noushine

2018-06-07

The growth of hopper crystals is observed for many substances, but the mechanism of their formation remains ill understood. Here we investigate their growth by performing evaporation experiments on small volumes of salt solutions. We show that sodium chloride crystals that grow very fast from a highly supersaturated solution form a peculiar form of hopper crystal consisting of a series of connected miniature versions of the original cubic crystal. The transition between cubic and such hopper growth happens at a well-defined supersaturation where the growth rate of the cubic crystal reaches a maximum (∼6.5 ± 1.8 μm/s). Above this threshold, the growth rate varies as the third power of supersaturation, showing that a new mechanism, controlled by the maximum speed of surface integration of new molecules, induces the hopper growth of cubic crystals in cascade.

Protein crystal growth in low gravity

Science.gov (United States)

Feigelson, Robert S.

1993-01-01

This Final Technical Report for NASA Grant NAG8-774 covers the period from April 27, 1989 through December 31, 1992. It covers five main topics: fluid flow studies, the influence of growth conditions on the morphology of isocitrate lyase crystals, control of nucleation, the growth of lysozyme by the temperature gradient method and graphoepitaxy of protein crystals. The section on fluid flow discusses the limits of detectability in the Schlieren imaging of fluid flows around protein crystals. The isocitrate lyase study compares crystals grown terrestrially under a variety of conditions with those grown in space. The controlling factor governing the morphology of the crystals is the supersaturation. The lack of flow in the interface between the drop and the atmosphere in microgravity causes protein precipitation in the boundary layer and a lowering of the supersaturation in the drop. This lowered supersaturation leads to improved crystal morphology. Preliminary experiments with lysozyme indicated that localized temperature gradients could be used to nucleate crystals in a controlled manner. An apparatus (thermonucleator) was designed to study the controlled nucleation of protein crystals. This apparatus has been used to nucleate crystals of materials with both normal (ice-water, Rochelle salt and lysozyme) and retrograde (horse serum albumin and alpha chymotrypsinogen A) solubility. These studies have lead to the design of an new apparatus that small and more compatible with use in microgravity. Lysozyme crystals were grown by transporting nutrient from a source (lysozyme powder) to the crystal in a temperature gradient. The influence of path length and cross section on the growth rate was demonstrated. This technique can be combined with the thermonucleator to control both nucleation and growth. Graphoepitaxy utilizes a patterned substrate to orient growing crystals. In this study, silicon substrates with 10 micron grooves were used to grow crystals of catalase

Liquid Crystal Colloids

Science.gov (United States)

Smalyukh, Ivan I.

2018-03-01

Colloids are abundant in nature, science, and technology, with examples ranging from milk to quantum dots and the colloidal atom paradigm. Similarly, liquid crystal ordering is important in contexts ranging from biological membranes to laboratory models of cosmic strings and liquid crystal displays in consumer devices. Some of the most exciting recent developments in both of these soft matter fields emerge at their interface, in the fast-growing research arena of liquid crystal colloids. Mesoscale self-assembly in such systems may lead to artificial materials and to structures with emergent physical behavior arising from patterning of molecular order and nano- or microparticles into precisely controlled configurations. Liquid crystal colloids show exceptional promise for new discovery that may impinge on composite material fabrication, low-dimensional topology, photonics, and so on. Starting from physical underpinnings, I review the state of the art in this fast-growing field, with a focus on its scientific and technological potential.

Electrical properties of molecular crystals

International Nuclear Information System (INIS)

Barraud, A.

1968-01-01

This literature survey summarizes the electrical properties of molecular crystals: molecular crystal structure, transport and excitation mechanisms of charge-carriers, and differences compared to inorganic semi-conductors. The main results concerning the electrical conductivity of the most-studied molecular crystals are presented, together with the optical and photo-electrical properties of these crystals. Finally the different types of electrical measurements used are reviewed, as well as the limits of each method. (author) [fr

Monitoring and Characterization of Crystal Nucleation and Growth during Batch Crystallization

NARCIS (Netherlands)

Kadam, S.S.

2012-01-01

Batch crystallization is commonly used in pharmaceutical, agrochemical, specialty and fine chemicals industry. The advantages of batch crystallization lie in its ease of operation and the relatively simple equipment that can be used. On the other hand a major disadvantage associated with it is the

Progress on photonic crystals

CERN Document Server

Lecoq, P; Gundacker, S; Hillemanns, H; Jarron, P; Knapitsch, A; Leclercq, J L; Letartre, X; Meyer, T; Pauwels, K; Powolny, F; Seassal, C

2010-01-01

The renewal of interest for Time of Flight Positron Emission Tomography (TOF PET) has highlighted the need for increasing the light output of scintillating crystals and in particular for improving the light extraction from materials with a high index of refraction. One possible solution to overcome the problem of total internal reflection and light losses resulting from multiple bouncing within the crystal is to improve the light extraction efficiency at the crystal/photodetector interface by means of photonic crystals, i.e. media with a periodic modulation of the dielectric constant at the wavelength scale. After a short reminder of the underlying principles this contribution proposes to present the very encouraging results we have recently obtained on LYSO pixels and the perspectives on other crystals such as BGO, LuYAP and LuAG. These results confirm the impressive predictions from our previously published Monte Carlo simulations. A detailed description of the sample preparation procedure is given as well ...

Crystal growth, spectroscopic and laser properties of Tm:LuAG crystal

Science.gov (United States)

Xu, X. D.; Wang, X. D.; Lin, Z. F.; Cheng, Y.; Li, D. Z.; Cheng, S. S.; Wu, F.; Zhao, Z. W.; Gao, C. Q.; Gao, M. W.; Xu, J.

2009-11-01

Tm:Lu3Al5O12 (Tm:LuAG) crystal was grown by the Czochralski method. The segregation coefficient was measured by Inductively Coupled Plasma Atomic Emission Spectrometer. The cell parameters were analyzed with X-ray powder diffraction experiments. The absorption and fluorescence spectra of Tm:LuAG crystal at room temperature were investigated. With a 20 W fiber-coupled diode laser as pump source, the continuous-wave (CW) laser action of Tm:LuAG crystal was demonstrated. The maximum output power at 2020 nm was obtained to be 3.04 W, and the slope efficiency was 25.3%.

The temperature dependence studies of rare-earth (Dy.sup.3+./sup., Sm.sup.3+./sup., Eu.sup.3+./sup. and Tb.sup.3+./sup.) activated Gd.sub.3./sub.Ga.sub.3./sub.Al.sub.2./sub.O.sub.12./sub. garnet single crystals

Czech Academy of Sciences Publication Activity Database

Bartosiewicz, Karol; Babin, Vladimir; Beitlerová, Alena; Boháček, Pavel; Jurek, Karel; Nikl, Martin

2017-01-01

Roč. 189, Sep (2017), s. 126-139 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : Gd3Ga3Al2O12 * rare earth dopants * energy transfer * thermal quenching * single crystal Sub ject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 2.686, year: 2016

Advances in nonlinear polymers and inorganic crystals, liquid crystals, and laser media

International Nuclear Information System (INIS)

Musikant, S.

1987-01-01

These proceedings collect papers on laser materials. Topics include: solid state lasers, fracture mechanics in laser materials, optical second harmonic generation, nonlinear optics, molecular crystals, crystal-phase transformation, and materials for laser fusion reactors

Synthesis, crystal structure, physicochemical properties of hydrogen bonded supramolecular assembly of N,N-diethylanilinium-3, 5-dinitrosalicylate crystal

Science.gov (United States)

Rajkumar, M.; Chandramohan, A.

2017-12-01

An organic salt, N,N-diethylanilinium 3,5-dinitrosalicylate was synthesized and single crystals grown by employing the slow solvent evaporation solution growth technique in methanol-acetone (1:1) mixture. The electronic transitions of the salt crystal were studied by UV-Visible spectrum. The optical transmittance window and lower wavelength cut-off of grown crystal have been identified by UV-Vis-NIR studies. The FT-IR spectrum was recorded to confirm the presence of various functional groups in the grown crystal. 1H and 13C NMR spectrum were recorded to establish the molecular structure of the title crystal. Single crystal X-ray diffraction data indicated that the crystal belongs to monoclinic crystal system with P21/n space group. The thermal stability of the crystal was established by TG/DTA studies. The mechanical properties of the grown crystal were studied by Vickers' microhardness technique. The dielectric studies indicated that the dielectric constant and dielectric loss decrease exponentially with frequency at different temperatures.

LITERATURE SURVEY FOR FRACTIONAL CRYSTALLIZATION STUDY

International Nuclear Information System (INIS)

PERSON, J.C.

2004-01-01

The literature survey for the fractional crystallization study of material from tank 241-S-112 is completed, fulfilling the requirements of the Test Plan for Tank 241-S-112 Fractional Crystallization Study (Herting 2003). Crystallization involves the formation of one or more solid phases from a fluid phase or an amorphous solid phase. It is applied extensively in the chemical industry, both as a purification process and a separation process. The main advantage of crystallization over distillation is the production of substances with a very high purity, at a low level of energy consumption, and at relatively mild process conditions. Crystallization is one of the older operations in the chemical industry; therefore, practical experience can usually be used for the design and operation of industrial crystallizers. In addition, advances in the understanding of crystallization kinetics can be useful in the control, design, and scale-up of industrial crystallizers. Research work is currently underway; e.g., the CrysCODE (Crystallizer Control and Design) project, littu://www.aui.tudelft.nl/uroiect/Cn/scode/crvscode.htm, at the Delft University of Technology, with the goal of improving the performance and controllability of industrial crystallizers by means of better control and improved design methodologies. Recent developments in fluid dynamics and reactor technology (e.g., compartment approaches) have led to a better understanding of processes and scale-up phenomena. The ultimate aim of such research is to develop a knowledge-based design frame for optimization of industrial crystallization units. Development work is in progress on a rigorous design analysis model for the description of the crystallization process as a function of the reactor geometry, crystallization kinetics, and operating conditions. One modeling effort is aimed at improving the predictive crystallizer model by implementing a population balance equation that depends on two variables: the size and

Proteins and their crystals

Czech Academy of Sciences Publication Activity Database

Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, D.

2003-01-01

Roč. 10, - (2003), s. 30-31 ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:MSM 123100001 Keywords : antiviral proteins Subject RIV: CD - Macromolecular Chemistry

The crystal structure and twinning of neodymium gallium perovskite single crystals

International Nuclear Information System (INIS)

Ubizskii, S.B.; Vasylechko, L.O.; Savytskii, D.I.; Matkovskii, A.O.; Syvorotka, I.M.

1994-01-01

By means of X-ray structure analysis, the crystal structure of neodymium gallium perovskite (NGP) single crystals (NdGaO 3 ) being used as a substrate for HTSC film epitaxy has been refined and the position of atoms has been determined. The possibility of YBa 2 Cu 3 O 7-x film epitaxy on the plane (110) of NGP crystal as well as its advantages and pitfalls are analysed from structural data. The twinning types in the NGP crystal were established. The twinning structure of NGP substrates is found to be stable up to a temperature of 1173 K, as differentiated from the LaGaO 3 and LaAlO 3 substrates. It is intimated that the twinning in the NGP substrates oriented as (001) can result in creation of 90 degrees twin bonds in a film, and in the case of (110)-oriented plates it is possible to ignore the twinning presence in substrate completely. (author)

Silumins alloy crystallization

Directory of Open Access Journals (Sweden)

S. Pietrowski

2009-07-01

Full Text Available This paper presents the results of research, by ATD method, of hypo-, near- and hyperutectic silumins crystallization containing the following alloying additives: Mg, Ni, Cu, Cr, Mo, W, V. It has been shown that, depending on their concentration may crystallize pre-eutectic or eutectic multicomponent phases containing these alloy additives. It has been revealed that any subsequent crystallizable phase nucleate and grows near the liquid/former crystallized phase interface. In multiphases compound also falls the silicon, resulting in a reduction in its quantity and the fragmentation in the eutectic mixture. As a result, it gets a high hardness of silumins in terms of 110-220HB.

Co-Crystal Screening of Diclofenac

Directory of Open Access Journals (Sweden)

John Desper

2011-08-01

Full Text Available In the pharmaceutical industry, co-crystals are becoming increasingly valuable as crystalline solids that can offer altered/improved physical properties of an active pharmaceutical ingredient (API without changing its chemical identity or biological activity. In order to identify new solid forms of diclofenac—an analgesic with extremely poor aqueous solubility for which few co-crystal structures have been determined—a range of pyrazoles, pyridines, and pyrimidines were screened for co-crystal formation using solvent assisted grinding and infrared spectroscopy with an overall success rate of 50%. The crystal structures of three new diclofenac co-crystals are reported herein: (diclofenac∙(2-aminopyrimidine, (diclofenac∙(2-amino-4,6-dimethylpyrimidine, and (diclofenac∙(2-amino-4-chloro-6-methylpyrimidine.

Co-crystal screening of diclofenac.

Science.gov (United States)

Aakeröy, Christer B; Grommet, Angela B; Desper, John

2011-08-31

In the pharmaceutical industry, co-crystals are becoming increasingly valuable as crystalline solids that can offer altered/improved physical properties of an active pharmaceutical ingredient (API) without changing its chemical identity or biological activity. In order to identify new solid forms of diclofenac-an analgesic with extremely poor aqueous solubility for which few co-crystal structures have been determined-a range of pyrazoles, pyridines, and pyrimidines were screened for co-crystal formation using solvent assisted grinding and infrared spectroscopy with an overall success rate of 50%. The crystal structures of three new diclofenac co-crystals are reported herein: (diclofenac)∙(2-aminopyrimidine), (diclofenac)∙(2-amino-4,6-dimethylpyrimidine), and (diclofenac)∙(2-amino-4-chloro-6-methylpyrimidine).