The Steppengrille (Gryllus spec./assimilis: selective filters and signal mismatch on two time scales.

Directory of Open Access Journals (Sweden)

Matti Michael Rothbart

Full Text Available In Europe, several species of crickets are available commercially as pet food. Here we investigated the calling song and phonotactic selectivity for sound patterns on the short and long time scales for one such a cricket, Gryllus spec., available as "Gryllus assimilis", the Steppengrille, originally from Ecuador. The calling song consisted of short chirps (2-3 pulses, carrier frequency: 5.0 kHz emitted with a pulse period of 30.2 ms and chirp rate of 0.43 per second. Females exhibited high selectivity on both time scales. The preference for pulse period peaked at 33 ms which was higher then the pulse period produced by males. Two consecutive pulses per chirp at the correct pulse period were already sufficient for positive phonotaxis. The preference for the chirp pattern was limited by selectivity for small chirp duty cycles and for chirp periods between 200 ms and 500 ms. The long chirp period of the songs of males was unattractive to females. On both time scales a mismatch between the song signal of the males and the preference of females was observed. The variability of song parameters as quantified by the coefficient of variation was below 50% for all temporal measures. Hence, there was not a strong indication for directional selection on song parameters by females which could account for the observed mismatch. The divergence of the chirp period and female preference may originate from a founder effect, when the Steppengrille was cultured. Alternatively the mismatch was a result of selection pressures exerted by commercial breeders on low singing activity, to satisfy customers with softly singing crickets. In the latter case the prominent divergence between male song and female preference was the result of domestication and may serve as an example of rapid evolution of song traits in acoustic communication systems.

Dissecting the variance-covariance structure in insect physiology: the multivariate association between metabolism and morphology in the nymphs of the sand cricket (Gryllus firmus).

Science.gov (United States)

Nespolo, Roberto F; Castañeda, Luis E; Roff, Derek A

2005-08-01

Energy metabolism in animals has been largely studied in relation to exogenous sources of variation. However, because they give insight into the relationship between whole metabolism and lower organizational levels such as organs and tissues, examination of endogenous determinants of metabolism other than body mass is itself very important. We studied the multivariate association of body parts and several aspects of energy metabolism in an insect, the nymphs of the sand cricket, Gryllus firmus. By using a variety of both univariate and multivariate techniques, we explored the resultant variance-covariance matrix to build a path diagram with latent variables. After controlling for body mass, we found a significant canonical correlation between metabolism and morphology. According to the factor loadings and path coefficients, the most important contributions of morphology to the correlation were thorax and abdomen size measures, whereas the most important metabolic contribution was resting metabolism. Activity metabolism was mostly explained by body mass rather than body parts, which could be a result of resting rates being chronic consequences of the functioning of the metabolic machinery that the insect must maintain.

Adaptive plasticity in wild field cricket's acoustic signaling.

Directory of Open Access Journals (Sweden)

Susan M Bertram

Full Text Available Phenotypic plasticity can be adaptive when phenotypes are closely matched to changes in the environment. In crickets, rhythmic fluctuations in the biotic and abiotic environment regularly result in diel rhythms in density of sexually active individuals. Given that density strongly influences the intensity of sexual selection, we asked whether crickets exhibit plasticity in signaling behavior that aligns with these rhythmic fluctuations in the socio-sexual environment. We quantified the acoustic mate signaling behavior of wild-caught males of two cricket species, Gryllus veletis and G. pennsylvanicus. Crickets exhibited phenotypically plastic mate signaling behavior, with most males signaling more often and more attractively during the times of day when mating activity is highest in the wild. Most male G. pennsylvanicus chirped more often and louder, with shorter interpulse durations, pulse periods, chirp durations, and interchirp durations, and at slightly higher carrier frequencies during the time of the day that mating activity is highest in the wild. Similarly, most male G. veletis chirped more often, with more pulses per chirp, longer interpulse durations, pulse periods, and chirp durations, shorter interchirp durations, and at lower carrier frequencies during the time of peak mating activity in the wild. Among-male variation in signaling plasticity was high, with some males signaling in an apparently maladaptive manner. Body size explained some of the among-male variation in G. pennsylvanicus plasticity but not G. veletis plasticity. Overall, our findings suggest that crickets exhibit phenotypically plastic mate attraction signals that closely match the fluctuating socio-sexual context they experience.

Microbiology of cooked and dried edible Mediterranean field crickets (Gryllus bimaculatus) and superworms (Zophobas atratus) submitted to four different heating treatments.

Science.gov (United States)

Grabowski, Nils Th; Klein, Günter

2017-01-01

To increase the shelf life of edible insects, modern techniques (e.g. freeze-drying) add to the traditional methods (degutting, boiling, sun-drying or roasting). However, microorganisms become inactivated rather than being killed, and when rehydrated, many return to vegetative stadia. Crickets (Gryllus bimaculatus) and superworms (Zophobas atratus) were submitted to four different drying techniques (T1 = 10' cooking, 24 h drying at 60℃; T2 = 10' cooking, 24 h drying at 80℃; T3 = 30' cooking, 12 h drying at 80℃, and 12 h drying at 100℃; T4 = boiling T3-treated insects after five days) and analysed for total bacteria counts, Enterobacteriaceae, staphylococci, bacilli, yeasts and moulds counts, E. coli, salmonellae, and Listeria monocytogenes (the latter three being negative throughout). The microbial counts varied strongly displaying species- and treatment-specific patterns. T3 was the most effective of the drying treatments tested to decrease all counts but bacilli, for which T2 was more efficient. Still, total bacteria counts remained high (G. bimaculatus > Z. atratus). Other opportunistically pathogenic microorganisms (Bacillus thuringiensis, B. licheniformis, B. pumilis, Pseudomonas aeruginosa, and Cryptococcus neoformans) were also encountered. The tyndallisation-like T4 reduced all counts to below detection limit, but nutrients leakage should be considered regarding food quality. In conclusion, species-specific drying procedures should be devised to ensure food safety. © The Author(s) 2016.

Speciation, Divergence, and the Origin of Gryllus rubens: Behavior, Morphology, and Molecules

Directory of Open Access Journals (Sweden)

David A. Gray

2011-05-01

Full Text Available The last 25 years or so has seen a huge resurgence of interest in speciation research. This has coincided with the development and widespread use of new tools in molecular genetics, especially DNA sequencing, to inform ecological and evolutionary questions. Here I review about a decade of work on the sister species of field crickets Gryllus texensis and G. rubens. This work has included analysis of morphology, behavior, and the mitochondrial DNA molecule. The molecular work in particular has dramatically re-shaped my interpretation of the speciational history of these taxa, suggesting that rather than ‘sister’ species we should consider these taxa as ‘mother-daughter’ species with G. rubens derived from within a subset of ancestral G. texensis.

Body-enlarging effect of royal jelly in a non-holometabolous insect species, Gryllus bimaculatus

Directory of Open Access Journals (Sweden)

Atsushi Miyashita

2016-06-01

Full Text Available Honeybee royal jelly is reported to have body-enlarging effects in holometabolous insects such as the honeybee, fly and silkmoth, but its effect in non-holometabolous insect species has not yet been examined. The present study confirmed the body-enlarging effect in silkmoths fed an artificial diet instead of mulberry leaves used in the previous literature. Administration of honeybee royal jelly to silkmoth from early larval stage increased the size of female pupae and adult moths, but not larvae (at the late larval stage or male pupae. We further examined the body-enlarging effect of royal jelly in a non-holometabolous species, the two-spotted cricket Gryllus bimaculatus, which belongs to the evolutionarily primitive group Polyneoptera. Administration of royal jelly to G. bimaculatus from its early nymph stage enlarged both males and females at the mid-nymph and adult stages. In the cricket, the body parts were uniformly enlarged in both males and females; whereas the enlarged female silkmoths had swollen abdomens. Administration of royal jelly increased the number, but not the size, of eggs loaded in the abdomen of silkmoth females. In addition, fat body cells were enlarged by royal jelly in the silkmoth, but not in the cricket. These findings suggest that the body-enlarging effect of royal jelly is common in non-holometabolous species, G. bimaculatus, but it acts in a different manner than in holometabolous species.

Pertumbuhan tiga spesies jangkrik lokal yang dibudidayakan pada padat penebaran dan jenis pakan berbeda

Directory of Open Access Journals (Sweden)

Priyantini Widiyaningrum

2012-02-01

Full Text Available In the development of cricket farming, important information in regard with cultivated method, type of crickets, feed stuff, density level, and it's productivity is essential. The aim of this study was to evaluate the effects of different density level and rations on growth performace of three species of local crickets, i.e Gryllus bimaculatus De Geer, Gryllus mitratus Burn and Gryllus testaceus Walk.Three levels of box square density (500, 750 and 1000 cricket/box and two levels of additional feed (mustard green and papaya leaveswere used as treatments. The results showed that the density level of approximately 1000 cricket/box had no significant influence on growth performance of the three species local crickets. Nevertheless, higher density level tended to increase mortality rate especially for G. bimaculatus (rate of mortality = 45.86%. The use of feed combination of formulated ration plus mustard green resulted in better growth performance and higher egg production compared to the combination of formulated ration plus papaya leaves.

Differences in carotenoid accumulation among three feeder-cricket species: implications for carotenoid delivery to captive insectivores.

Science.gov (United States)

Ogilvy, Victoria; Fidgett, Andrea L; Preziosi, Richard F

2012-01-01

There are a limited number of feeder-invertebrates available to feed captive insectivores, and many are deficient in certain nutrients. Gut-loading is used to increase the diversity of nutrients present in the captive insectivore diet; however, little is known about delivery of carotenoids via gut-loading. Carotenoids may influence health and reproduction due to their roles in immune and antioxidant systems. We assessed interspecific variation in carotenoid accumulation and retention in three feeder-cricket species (Gryllus bimaculatus, Gryllodes sigillatus and Acheta domesticus) fed one of three diets (wheat-bran, fish-food based formulated diet, and fresh fruit and vegetables). Out of the three species of feeder-cricket in the fish-food-based dietary treatment group, G. bimaculatus had the greatest total carotenoid concentration. All cricket species fed the wheat-bran diet had very low carotenoid concentrations. Species on the fish-food-based diet had intermediate carotenoid concentrations, and those on the fruit and vegetable diet had the highest concentrations. Carotenoid retention was poor across all species. Overall, this study shows that, by providing captive insectivores with G. bimaculatus crickets recently fed a carotenoid-rich diet, the quantity of carotenoids in the diet can be increased. © 2011 Wiley Periodicals, Inc.

Substrate texture affects female cricket walking response to male calling song

Science.gov (United States)

Sarmiento-Ponce, E. J.; Sutcliffe, M. P. F.; Hedwig, B.

2018-03-01

Field crickets are extensively used as a model organism to study female phonotactic walking behaviour, i.e. their attraction to the male calling song. Laboratory-based phonotaxis experiments generally rely on arena or trackball-based settings; however, no attention has been paid to the effect of substrate texture on the response. Here, we tested phonotaxis in female Gryllus bimaculatus, walking on trackballs machined from methyl-methacrylate foam with different cell sizes. Surface height variations of the trackballs, due to the cellular composition of the material, were measured with profilometry and characterized as smooth, medium or rough, with roughness amplitudes of 7.3, 16 and 180 µm. Female phonotaxis was best on a rough and medium trackball surface, a smooth surface resulted in a significant lower phonotactic response. Claws of the cricket foot were crucial for effective walking. Females insert their claws into the surface pores to allow mechanical interlocking with the substrate texture and a high degree of attachment, which cannot be established on smooth surfaces. These findings provide insight to the biomechanical basis of insect walking and may inform behavioural studies that the surface texture on which walking insects are tested is crucial for the resulting behavioural response.

Winning fights induces hyperaggression via the action of the biogenic amine octopamine in crickets.

Directory of Open Access Journals (Sweden)

Jan Rillich

Full Text Available Winning an agonistic interaction against a conspecific is known to heighten aggressiveness, but the underlying events and mechanism are poorly understood. We quantified the effect of experiencing successive wins on aggression in adult male crickets (Gryllus bimaculatus by staging knockout tournaments and investigated its dependence on biogenic amines by treatment with amine receptor antagonists. For an inter-fight interval of 5 min, fights between winners escalated to higher levels of aggression and lasted significantly longer than the preceding round. This winner effect is transient, and no longer evident for an inter-fight interval of 20 min, indicating that it does not result from selecting individuals that were hyper-aggressive from the outset. A winner effect was also evident in crickets that experienced wins without physical exertion, or that engaged in fights that were interrupted before a win was experienced. Finally, the winner effect was abolished by prior treatment with epinastine, a highly selective octopamine receptor blocker, but not by propranolol, a ß-adrenergic receptor antagonist, nor by yohimbine, an insect tyramine receptor blocker nor by fluphenazine an insect dopamine-receptor blocker. Taken together our study in the cricket indicates that the physical exertion of fighting, together with some rewarding aspect of the actual winning experience, leads to a transient increase in aggressive motivation via activation of the octopaminergic system, the invertebrate equivalent to the adrenergic system of vertebrates.

Caracterização de Danos de Gryllus sp. em Plantas de Eucalipto, em Laboratório Characterization of Mischief of Gryllus sp. in Plants of Eucalyptus, in Laboratory

Directory of Open Access Journals (Sweden)

Leonardo Rodrigues Barbosa

2010-02-01

Full Text Available

Objetivou-se caracterizar os danos de Gryllus sp. em plantas de E. grandis, em laboratório. Avaliaram-se três grupos de plantas: grupo 1 – com 7 dias e 2,5 mm de diâmetro médio; grupo 2 – com 49 dias e 3,3 mm de diâmetro e grupo 3 –com 80 dias e 5,7 mm de diâmetro. Utilizaram-se para cada grupo 12 plantas individualizadas em gaiolas com um casal de grilos, por 15 dias. Avaliaram-se diariamente a ausência de danos, sinais de mastigação superficiais, sinais de mastigação profundos e corte do caule. O diâmetro e a idade das mudas afetaram a manifestação e intensidade dos danos de grilos nas plantas.

Doi: 10.4336/2009.pfb.59.63

Impact of cercal air currents on singing motor pattern generation in the cricket (Gryllus bimaculatus DeGeer)

Science.gov (United States)

2015-01-01

The cercal system of crickets detects low-frequency air currents produced by approaching predators and self-generated air currents during singing, which may provide sensory feedback to the singing motor network. We analyzed the effect of cercal stimulation on singing motor pattern generation to reveal the response of a singing interneuron to predator-like signals and to elucidate the possible role of self-generated air currents during singing. In fictive singing males, we recorded an interneuron of the singing network while applying air currents to the cerci; additionally, we analyzed the effect of abolishing the cercal system in freely singing males. In fictively singing crickets, the effect of short air stimuli is either to terminate prematurely or to lengthen the interchirp interval, depending on their phase in the chirp cycle. Within our stimulation paradigm, air stimuli of different velocities and durations always elicited an inhibitory postsynaptic potential in the singing interneuron. Current injection in the singing interneuron elicited singing motor activity, even during the air current-evoked inhibitory input from the cercal pathway. The disruptive effects of air stimuli on the fictive singing pattern and the inhibitory response of the singing interneuron point toward the cercal system being involved in initiating avoidance responses in singing crickets, according to the established role of cerci in a predator escape pathway. After abolishing the activity of the cercal system, the timing of natural singing activity was not significantly altered. Our study provides no evidence that self-generated cercal sensory activity has a feedback function for singing motor pattern generation. PMID:26334014

Transmission of Xanthomonas campestris pv. campestris in seed production crops of cauliflower

NARCIS (Netherlands)

Kastelein, P.; Krijger, M.C.; Zouwen, van der P.S.; Steen, van der J.J.M.; Stevens, L.H.; Wolf, van der J.M.; Fernandes Vieira, J.; Amaral Villela, F.

2014-01-01

n 2011, two polytunnel greenhouse experiments were conducted on seed production farms, one under conventional conditions in the South-West (Rilland) and the other under organic conditions in the East (Voorst) of the Netherlands, to study transmission routes of Xanthomonas campestris pv. campestris

Are attractive male crickets better able to pay the costs of an immune challenge?

Science.gov (United States)

Telemeco, Melissa S.C.; Bartholomay, Lyric C.

2015-01-01

Reproduction and immunity are fitness-related traits that trade-off with each other. Parasite-mediated theories of sexual selection suggest, however, that higher-quality males should suffer smaller costs to reproduction-related traits and behaviours (e.g., sexual display) from an immune challenge because these males possess more resources with which to deal with the challenge. We used Gryllus texensis field crickets to test the prediction that attractive males should better maintain the performance of fitness-related traits (e.g., calling effort) in the face of an immune challenge compared with unattractive males. We found no support for our original predictions. However, that immune activation causes attractive males to significantly increase their calling effort compared with unattractive males suggests that these males might terminally invest in order to compensate for decreased future reproduction. PMID:26713249

Cricket club

CERN Multimedia

Cricket club

2010-01-01

The start of the Cricket season is upon us! Net practice takes place each Thursday evening from 15 April onwards, at the CERN Prévessin site, starting at 18:00 (http://cern.ch/Club-Cricket/CricketField.pdf). All newcomers will be made very welcome. The first practice match will be on Sunday, 18 April. Information about the CERN Cricket Club and the current fixture list for 2010 can be found on the web at http://cern.ch/Club-Cricket/  

Male responses to conspecific advertisement signals in the field cricket Gryllus rubens (Orthoptera: Gryllidae).

Science.gov (United States)

Jang, Yikweon

2011-01-20

In many species males aggregate and produce long-range advertisement signals to attract conspecific females. The majority of the receivers of these signals are probably other males most of the time, and male responses to competitors' signals can structure the spatial and temporal organization of the breeding aggregation and affect male mating tactics. I quantified male responses to a conspecific advertisement stimulus repeatedly over three age classes in Gryllus rubens (Orthoptera: Gryllidae) in order to estimate the type and frequency of male responses to the broadcast stimulus and to determine the factors affecting them. Factors tested included body size, wing dimorphism, age, and intensity of the broadcast stimulus. Overall, males employed acoustic response more often than positive phonotactic response. As males aged, the frequency of positive phonotactic response decreased but that of the acoustic response increased. That is, males may use positive phonotaxis in the early stages of their adult lives, possibly to find suitable calling sites or parasitize calling males, and then later in life switch to acoustic responses in response to conspecific advertisement signals. Males with smaller body size more frequently exhibited acoustic responses. This study suggests that individual variation, more than any factors measured, is critical for age-dependent male responses to conspecific advertisement signals.

Cricket Club

CERN Multimedia

Cricket Club

2012-01-01

  The start of the 2012 Cricket season is only days away!  The CERN club is always looking for new players and newcomers will be made very welcome. Net practice takes place each Thursday evening from 19 April onwards, at the CERN Prévessin site (http://cern.ch/Club-Cricket/CricketField.pdf), from 18:00 to around 19:30. The first practice match will be on Sunday, 22 April.  Information about the CERN Cricket Club and the current fixture list for 2012 can be found on the web at: http://cern.ch/Club-Cricket/.

Occurrence of Xanthomonas campestris pv. campestris (Pammel, 1895 Dowson 1939, on Brassicas in Montenegro

Directory of Open Access Journals (Sweden)

Dragana Radunović

2012-01-01

Full Text Available Brassicas form the most important group of vegetable crops in Montenegro. The cabbage(Brassica oleracea var. capitata is most commonly grown, although other brassicas,particularly kale, Brussels sprout, cauliflower and broccoli, have been increasingly producedsince recently. One of the specialties of vegetable production in Montenegro is growing ofcollard (Brassica oleracea var. acephala, which is the simplest variety of the Brassica oleraceaspecies and in the nearest relation with their wild ancestor – the sylvestris variety.Diseases are the main restrictive factors for successful production of these vegetables.Susceptibility of the cultivars and inadequate control often result in more or less damagedcrops in some plots.Causal agents of brassica diseases, especially bacterial, have not been investigated inMontenegro until 2009. Since the symptoms observed in 2009 were „V” shaped leaf edgenecrosis and black rot of vascular tissue, it was assumed that they were caused by plantpathogenic bacterium Xanthomonas campestris pv. campestris.Samples of the infected plants were collected from different localities in Montenegro.Isolation and identification of the bacterium were performed using laboratory methodsaccording to Schaad (1980, Lelliott and Stead (1987 and Arsenijević (1997. Examinationof chosen bacterial isolates was conducted using both, classical bacteriological methods(examination of their pathogenic, morphological, cultivation and biochemical and physiologicalcharacteristics, and ELISA test.The obtained results confirmed the presence of X.campestris pv. campestris (Pammel,1895 Dowson 1939, on cabbage, kale, broccoli and collard in Montenegro. This is the firstexperimental evidence that collard is the host of X. campestris pv. campestris in Montenegro.

CERN Cricket Club

CERN Multimedia

CERN Cricket Club

2010-01-01

CERN Cricket Club Match Reports The cricket season is well under way, despite the weather, and several matches have been played. The match reporters have, however, found it too difficult to limit their reports to ¼ of a page, hence the reports have not appeared in the bulletin. All reports can be found at http://cern.ch/Club-Cricket/reports/reports.html The list of forthcoming matches can be consulted at http://cern.ch/Club-Cricket/fixtures.html Further information about the CERN Cricket Club can be found at http://cern.ch/Club-Cricket/

CRICKET

CERN Multimedia

Cricket Club

2013-01-01

The CERN Cricket Club has played 18 matches so far this season, winning 12 and losing 6, with 12 fixtures remaining before the end of the season. As match reports are too long to be included in the weekly bulletin, the full reports and the schedule, which includes a weekend trip to Milan at the end of September, can be found under “Matches (Fixtures, results, reports)” on the Cricket Club web site at http://cern.ch/Club-Cricket/ Anyone interested in playing cricket is welcome to join us at net practice, which takes place on the Prévessin site each Thursday evening from 18:00 to around 19:30 (weather permitting).

Are attractive male crickets better able to pay the costs of an immune challenge?

Directory of Open Access Journals (Sweden)

Clint D. Kelly

2015-12-01

Full Text Available Reproduction and immunity are fitness-related traits that trade-off with each other. Parasite-mediated theories of sexual selection suggest, however, that higher-quality males should suffer smaller costs to reproduction-related traits and behaviours (e.g., sexual display from an immune challenge because these males possess more resources with which to deal with the challenge. We used Gryllus texensis field crickets to test the prediction that attractive males should better maintain the performance of fitness-related traits (e.g., calling effort in the face of an immune challenge compared with unattractive males. We found no support for our original predictions. However, that immune activation causes attractive males to significantly increase their calling effort compared with unattractive males suggests that these males might terminally invest in order to compensate for decreased future reproduction.

Sex-specific effect of juvenile diet on adult disease resistance in a field cricket.

Directory of Open Access Journals (Sweden)

Clint D Kelly

Full Text Available Food limitation is expected to reduce an individual's body condition (body mass scaled to body size and cause a trade-off between growth and other fitness-related traits, such as immunity. We tested the condition-dependence of growth and disease resistance in male and female Gryllus texensis field crickets by manipulating diet quality via nutrient content for their entire life and then subjecting individuals to a host resistance test using the live bacterium Serratia marcescens. As predicted, crickets on a high-quality diet eclosed more quickly, and at a larger body size and mass. Crickets on a high-quality diet were not in better condition at the time of eclosion, but they were in better condition 7-11 days after eclosion, with females also being in better condition than males. Despite being in better condition, however, females provided with a high-quality diet had significantly poorer disease resistance than females on a low-quality diet and in poor condition. Similarly, males on low- and high-quality diets did not differ in their disease resistance, despite differing in their body condition. A sex difference in disease resistance under diet-restriction suggests that females might allocate resources toward immunity during development if they expect harsh environmental conditions as an adult or it might suggest that females allocate resources toward other life history activities (i.e. reproduction when food availability increases. We do not know what immune effectors were altered under diet-restriction to increase disease resistance, but our findings suggest that increased immune function might provide an explanation for the sexually-dimorphic increase in longevity generally observed in diet-restricted animals.

Cricket Club

CERN Multimedia

Cricket Club

2011-01-01

The CERN Cricket Club has had a good start to the season, winning five and losing two matches, with one cancelled due to torrential rain in the South of France. Reports of the matches can be found on the Cricket Club web site at http://cern.ch/Club-Cricket/ under “Match reports”. The schedule of matches can be found under “Fixtures”. Anyone interested in playing cricket is welcome to join us at net practice, which takes place every week at 18:00 on the Prevessin site.

Cricket club

CERN Document Server

Cricket club

2017-01-01

Cern Cricket Club The CERN Cricket Club 2017 season begins soon, the first net practice is scheduled (weather permitting) for Thursday April 13th, at 18:00! The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/cricket/. Or turn up for net practice, which takes place each Thursday evening (apart from CERN official holidays) until the end of September (starting at 18:00 to around 19:30) at the CERN Prévessin site: http://cern.ch/cricket/CERN-Ground.html.

CRICKET CLUB

CERN Multimedia

CRICKET CLUB

2013-01-01

The CERN Cricket Club 2013 season begins soon! The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/Club-Cricket/ or turn up for net practice, which takes place each Thursday evening from April 18th until the end of September (starting at 18:00 to around 19:30) at the CERN Prévessin site: http://club-cricket.web.cern.ch/Club-Cricket/CERN-Ground.html The first match will be at home on Sunday, April 21st against Rhone CC from Lyon.

Identification of novel allergen in edible insect, Gryllus bimaculatus and its cross-reactivity with Macrobrachium spp. allergens.

Science.gov (United States)

Srinroch, Chutima; Srisomsap, Chantragan; Chokchaichamnankit, Daranee; Punyarit, Phaibul; Phiriyangkul, Pharima

2015-10-01

Edible insects have recently been promoted as a source of protein and have a high nutrition value. Identification of allergens and cross-reactivity between Macrobrachium spp. and the field cricket (Gryllus bimaculatus) is necessary for food safety control and to assist in the diagnosis and therapy of allergy symptoms. Denaturing polyacrylamide gel electrophoresis (SDS-PAGE) was used to separate proteins. Allergens were determined and identified by IgE-immunoblotting with pooled sera from prawn-allergic patients (n=16) and LC-MS/MS. Arginine kinase (AK) and glyceraldehyde 3-phosphate dehydrogenase (GAPDH) were determined as the important allergens in muscle of Macrobrachium rosenbergii whereas, hemocyanin (HC) was identified as an allergen in Macrobrachium spp. The allergens in Macrobrachium lanchesteri were identified as AK and HC. In addition, hexamerin1B (HEX1B) was identified as a novel and specific allergen in G. bimaculatus. The important allergen in G. bimaculatus and Macrobrachium spp. is AK and was found to cross-react between both species. Copyright © 2015 Elsevier Ltd. All rights reserved.

Flower infection of Brassica oleracea with Xanthomonas campestris pv. campestris results in high levels of seed infection

NARCIS (Netherlands)

Wolf, van der J.M.; Zouwen, van der P.S.; Heijden, van der L.

2013-01-01

During seed production, Brassica seed may become infected with Xanthomonas campestris pv. campestris after systemic colonization of plants upon leaf infection, or alternatively, after flower infection. Polytunnel experiments were conducted in 2007 and 2008 to study the relative importance of these

CRICKET CLUB

CERN Document Server

Cricket Club

2012-01-01

The CERN Cricket Club is now midway through the season and has had mixed fortunes, winning seven and losing five matches, with one drawn last weekend against the Fleet Street Strollers. Two wins were recorded against Trafford Solicitors in Bellingham in the north of England only days after the heaviest rainfall in the North East in living memory, read the detailed match report online to see what the grounds man had to say when we insisted on playing! Reports of all matches can be found on the Cricket Club web site at http://cern.ch/Club-Cricket/ under “ Matches (Fixtures, results, reports) ”. The schedule of matches can be found under “Fixtures”. Upcoming fixtures include the Eifion Jones Single Wicket Competition on August 19th and away matches against Rhone CC in Lyon and against Milan and Euratom Cricket clubs in Settimo Milanese in September. Anyone interested in playing cricket is welcome to join us at net practice, which takes place on Thursday every week...

DNA polymorphism analysis of Xanthomonas campestris pv ...

African Journals Online (AJOL)

strand conformation polymorphism (SSCP) techniques using M13 and 16S rRNA primers, respectively, for genotyping of the phytopathogenic bacterium Xanthomonas campestris pv. campestris was studied. RAPD provided a simple, rapid, and ...

Divergence in male cricket song and female preference functions in three allopatric sister species.

Science.gov (United States)

Hennig, Ralf Matthias; Blankers, Thomas; Gray, David A

2016-05-01

Multivariate female preference functions for male sexual signals have rarely been investigated, especially in a comparative context among sister species. Here we examined male signal and female preference co-variation in three closely related, but allopatric species of Gryllus crickets and quantified male song traits as well as female preferences. We show that males differ conspicuously in either one of two relatively static song traits, carrier frequency or pulse rate; female preference functions for these traits also differed, and would in combination enhance species discrimination. In contrast, the relatively dynamic song traits, chirp rate and chirp duty cycle, show minimal divergence among species and relatively greater conservation of female preference functions. Notably, among species we demonstrate similar mechanistic rules for the integration of pulse and chirp time scales, despite divergence in pulse rate preferences. As these are allopatric taxa, selection for species recognition per se is unlikely. More likely sexual selection combined with conserved properties of preference filters enabled divergent coevolution of male song and female preferences.

Cricket club

CERN Multimedia

Cricket club

2017-01-01

The CERN Cricket Club Annual General Meeting will be held on Thursday 30th November 2017 at 18:30 Restaurant No.1 (NOVAE) Draft Agenda Opening / Adoption of agenda/Apologies for absence Minutes of the 2016 AGM Captain's Report for 2017 Treasurer's Report for 2017 Groundsman's Report for 2017 Kit Report for 2017 Election of Officers for 2018 Cricket Switzerland  affairs and CERN Fixtures for 2018 CERN umpires New EU rules on personal data Any other business Close of meeting Offices up for election are: President, Vice-President, Secretary, Captain, Vice-Captain, Treasurer, Groundsman, coach, social convenor and match manager organiser. Any nominations should be sent to the Secretary in time for the Meeting. For more details on the CERN Cricket Club, see the web page http://cern.ch/cricket/.

Cricket club

CERN Document Server

Cricket club

2017-01-01

The CERN Cricket Club Annual General Meeting will be held on Thursday 30th November 2017 at 18:30 Restaurant No.1 (NOVAE) Draft Agenda Opening/Adoption of agenda/Apologies for absence Minutes of the 2016 AGM Captain's Report for 2017 Treasurer's Report for 2017 Groundsman's Report for 2017 Kit Report for 2017 Election of Officers for 2018 Cricket Switzerland  affairs and CERN Fixtures for 2018 CERN umpires New EU rules on personal data Any other business Close of meeting Offices up for election are: President, Vice-President, Secretary, Captain, Vice-Captain, Treasurer, Groundsman, coach, social convenor and match manager organiser. Any nominations should be sent to the Secretary in time for the Meeting. For more details on the CERN Cricket Club, see the web page http://cern.ch/cricket/.

Cricket Club

CERN Multimedia

Cricket Club

2013-01-01

The CERN Cricket Club has had a mixed first month of what has been the wettest and coldest start to a season ever, winning two and losing two matches, with one cancelled. Information about the club can be found on the Cricket Club web site at http://cern.ch/Club-Cricket/ Reports of the matches can be found under “Matches (Fixtures, results, reports)” and the schedule, which includes weekend trips to the South of France, Bellingham (UK), and Milan, can be found under “Fixtures”. Anyone interested in playing cricket is welcome to join us at net practice, which takes place on the Prevessin site each Thursday evening from 18:00 to around 19:30 (weather permitting – several sessions have already been cancelled due to the inclement weather).

Influence of the male ejaculate on post-mating prezygotic barriers in field crickets.

Directory of Open Access Journals (Sweden)

Erica L Larson

Full Text Available Post-copulatory interactions between males and females involve highly coordinated, complex traits that are often rapidly evolving and divergent between species. Failure to produce and deposit eggs may be a common post-mating prezygotic barrier, yet little is known about what prevents the induction of egg-laying between species. The field crickets, Gryllus firmus and G. pennsylvanicus are isolated by a one-way reproductive incompatibility; G. pennsylvanicus males fail to fertilize G. firmus eggs or to induce normal egg-laying in G. firmus females. We use experimental crosses to elucidate the role of accessory gland-derived vs. testis-derived components of the G. firmus male ejaculate on egg-laying in conspecific and heterospecific crosses. Using surgical castrations to create 'spermless' males that transfer only seminal fluid proteins (SFPs we test whether G. firmus male SFPs can induce egg-laying in conspecific crosses and rescue egg-laying in crosses between G. pennsylvanicus males and G. firmus females. We find G. firmus SFPs induce only a small short-term egg-laying response and that SFPs alone cannot explain the normal induction of egg-laying. Gryllus firmus SFPs also do not rescue the heterospecific cross. Testis-derived components, such as sperm or prostaglandins, most likely stimulate egg-laying or act as transporters for SFPs to targets in the female reproductive tract. These results highlight the utility of experimental approaches for investigating the phenotypes that act as barriers between species and suggest that future work on the molecular basis of the one-way incompatibility between G. firmus and G. pennsylvanicus should focus on divergent testis-derived compounds or proteins in addition to SFPs.

Cricket Club

CERN Multimedia

Cricket Club

2016-01-01

The CERN Cricket Club 2016 season begins soon, the first net practice is scheduled (weather permitting) for Thursday April 14th, at 18:00!  The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/Club-Cricket/ or turn up for net practice, which takes place each Thursday evening (apart from CERN official holidays) until the end of September (starting at 18:00 to around 19:30) at the CERN Prévessin site: http://club-cricket.web.cern.ch/Club-Cricket/CERN-Ground.html There will be an indoor game at the Bout-du-Monde on April 3rd and the season starts with a match at home on Sunday, April 24th against Rhone CC from Lyon.

USING Xanthomonas Campestris

African Journals Online (AJOL)

eobe

Xanthan gum is a major biopolymer which finds a lot of applications industrially and domestically. ... gum was produced from pineapple peels using Xanthomonas campestris by ... producing microorganism is strongly influenced by the medium.

Cricket Club

CERN Document Server

Cricket Club

2012-01-01

The CERN Cricket Club Annual General Meeting will be held on Monday 26th November 2012 at 18:30 Restaurant No 1 (NOVAE) Draft Agenda Opening/Adoption of agenda/Apologies for absence Minutes of the 2011 AGM Captain's Report for 2012 Treasurer's Report for 2012 Groundsman's and Kit Report for 2012 Election of Officers for 2013 SCA affairs and CERN Fixtures for 2013 Any other business Close of meeting Offices up for election are: Secretary, Captain, Vice-captain, Treasurer and Groundsman. Any nominations should be sent to the Secretary in time for the Meeting. For more details on the CERN Cricket Club, see the web page http://cern.ch/Club-Cricket/

Xanthan gum production by Xanthomonas campestris pv ...

African Journals Online (AJOL)

Cassava starch is a main renewable bio-resource with low price and mass production in Guangxi, China. It was used as carbon source in growing Xanthomonas campestris pv. campestris 8004 (Xcc 8004) for xanthan gum production in this study. The xanthan gum yield of gelatinized cassava starch was higher than that of ...

CERN Cricket Club

CERN Multimedia

Staff Association

2014-01-01

CERN CRICKET CLUB   The CERN Cricket Club 2014 season has been a good one so far with the team qualifying for the Swiss Cup semi-finals, with home advantage on the Prevessin ground on Sunday, August 24th. Their opponents will only be known the day before when the final game in the Eastern Division is played.  The CERN ground hasn’t quite recovered from the Bosons&More party last year, the wet weather making it impossible to roll the ground, but the new, wider strip is a big improvement. Net practice eventually started in late July, which is probably why the results at the beginning of the season weren’t so good. As match reports are too long to be included in the weekly bulletin, the full reports and the schedule can be found under “Matches (Fixtures, results, reports)” on the Cricket Club web site at http://cern.ch/Club-Cricket/    Anyone interested in playing cricket is welcome to join us at net practice, which takes pla...

CERN Cricket club

CERN Multimedia

CERN Cricket club

2015-01-01

The CERN Cricket Club 2015 season begins soon, the first net practice is scheduled (weather permitting) for Thursday April 16th, at 18:00! The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/Club-Cricket/ or turn up for net practice, which takes place each Thursday evening from April 16th (apart from CERN official holidays) until the end of September (starting at 18:00 to around 19:30) at the CERN Prévessin site: http://club-cricket.web.cern.ch/Club-Cricket/CERN-Ground.html The first match will be at home on Sunday, April 19th against Rhone CC from Lyon.

Context-Dependent Olfactory Learning in an Insect

Science.gov (United States)

Matsumoto, Yukihisa; Mizunami, Makoto

2004-01-01

We studied the capability of the cricket "Gryllus bimaculatus" to select one of a pair of odors and to avoid the other in one context and to do the opposite in another context. One group of crickets was trained to associate one of a pair of odors (conditioned stimulus, CS1) with water reward (appetitive unconditioned stimulus, US+) and another…

Injuries in Cricket.

Science.gov (United States)

Pardiwala, Dinshaw N; Rao, Nandan N; Varshney, Ankit V

Cricket is a popular global sport that requires a combination of physical fitness, skill, and strategy. Although a noncontact sport, overuse and impact injuries are common since players engage in a wide range of physical activities, including running, throwing, batting, bowling, catching, and diving. Significant or match time-loss injuries are defined as those that either prevent a player from being fully available for selection in a major match, or during a major match, cause a player to be unable to bat, bowl, or keep wicket when required by either the rules or the team's captain. This review describes the various region-wise injuries sustained in cricket along with their epidemiology, biomechanics, treatment, and prevention. Data were collected from peer-reviewed articles (obtained via PubMed search) published through November 2016 that involved the medical, biomechanical, and epidemiological aspects of cricket injuries. Clinical review. Level 4. Cricket was one of the first sports to publish recommended methods for injury surveillance in 2005 from England, South Africa, Australia, the West Indies, and India. While the incidence of injuries is about the same, the prevalence of injuries has increased due to game format changes, increasing number of matches played, and decreased rest between matches. Bowling (41.3%), fielding, and wicket keeping (28.6%) account for most injuries. Acute injuries are most common (64%-76%), followed by acute-on-chronic (16%-22.8%) and chronic ones (8%-22%). The most common modern-day cricket injury is hamstring strain, and the most severe is lumbar stress fracture in young fast bowlers. With improved understanding of the scientific and medical aspects of cricket, along with advances in surgical and nonsurgical treatment techniques, the time to return to play has shortened considerably. While the prevalence of cricket injuries has increased, their severity has decreased over the past decades.

Behavioural mediators of genetic life-history trade-offs: a test of the pace-of-life syndrome hypothesis in field crickets.

Science.gov (United States)

Santostefano, Francesca; Wilson, Alastair J; Niemelä, Petri T; Dingemanse, Niels J

2017-10-11

The pace-of-life syndrome (POLS) hypothesis predicts associations between life history and 'risky' behaviours. Individuals with 'fast' lifestyles should develop faster, reproduce earlier, exhibit more risk-prone behaviours, and die sooner than those with 'slow' lifestyles. While support for POLS has been equivocal to date, studies have relied on individual-level (phenotypic) patterns in which genetic trade-offs may be masked by environmental effects on phenotypes. We estimated genetic correlations between life history (development, lifespan, size) and risky behaviours (exploration, aggression) in a pedigreed population of Mediterranean field crickets ( Gryllus bimaculatus ). Path analyses showed that behaviours mediated some genetic relationships between life history traits, though not those involved in trade-offs. Thus, while specific predictions of POLS theory were not supported, genetic integration of behaviour and life history was present. This implies a major role for risky behaviours in life history evolution. © 2017 The Author(s).

How male sound pressure level influences phonotaxis in virgin female Jamaican field crickets (Gryllus assimilis

Directory of Open Access Journals (Sweden)

Karen Pacheco

2014-06-01

Full Text Available Understanding female mate preference is important for determining the strength and direction of sexual trait evolution. The sound pressure level (SPL acoustic signalers use is often an important predictor of mating success because higher sound pressure levels are detectable at greater distances. If females are more attracted to signals produced at higher sound pressure levels, then the potential fitness impacts of signalling at higher sound pressure levels should be elevated beyond what would be expected from detection distance alone. Here we manipulated the sound pressure level of cricket mate attraction signals to determine how female phonotaxis was influenced. We examined female phonotaxis using two common experimental methods: spherical treadmills and open arenas. Both methods showed similar results, with females exhibiting greatest phonotaxis towards loud sound pressure levels relative to the standard signal (69 vs. 60 dB SPL but showing reduced phonotaxis towards very loud sound pressure level signals relative to the standard (77 vs. 60 dB SPL. Reduced female phonotaxis towards supernormal stimuli may signify an acoustic startle response, an absence of other required sensory cues, or perceived increases in predation risk.

Cricket club looking for new players

CERN Multimedia

Cricket Club

2016-01-01

The CERN Cricket Club, having lost several key players, has had a very difficult season so far and is desperately in need of new players. Having qualified for the Cricket Switzerland semi-finals for the last two years (unfortunately losing both), this year we are bottom of the Western Pool, having played the last two league matches with only 10 players. If you are interested in playing cricket please join us at net practice, which takes place on the Prevessin site each Thursday evening from 18:00 to around 20:00 (weather permitting) or send me an e-mail (see below). Please have a look at the Cricket Club web site for more information: http://cern.ch/Club-Cricket/ Chris Onions, President of the CERN Cricket Club   (christopher.onions@gmail.com)

The apo structure of sucrose hydrolase from Xanthomonas campestris pv. campestris shows an open active-site groove

DEFF Research Database (Denmark)

Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe

2009-01-01

Glycoside hydrolase family 13 (GH-13) mainly contains starch-degrading or starch-modifying enzymes. Sucrose hydrolases utilize sucrose instead of amylose as the primary glucosyl donor. Here, the catalytic properties and X-ray structure of sucrose hydrolase from Xanthomonas campestris pv. campestris...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...

Cern Cricket Club

CERN Multimedia

Cern Cricket Club

2014-01-01

  Cern Cricket Club The CERN Cricket Club 2014 season has started earlier than usual, with a game scheduled for the first time ever on Easter Sunday.  Due to repair work for the damage done to the ground because of the “Bosons&More” party at the end of September, all games until June have had to be scheduled away. Net practice, which normally takes place on the ground from mid-April, will not start until mid-June. The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/Club-Cricket/    

Novel coaching cricket bat: can it be used to enhance the backlift and performance of junior cricket batsmen?

Science.gov (United States)

Noorbhai, M Habib; Woolmer, Russell C; Noakes, Timothy D

2016-01-01

In the current literature, it is questionable whether cricket bats in their current form and dimensions allow a young cricketer to hit the ball effectively. The aim of this study was to test the effectiveness of a novel coaching cricket bat among junior cricket batsmen with regard to enhancing performance and the direction of the backlift. A cross-sectional research study with analytical research methods was employed, in which 2 groups (coached: n=12 and uncoached: n=35) of participants (ages 9-13) took part in a pilot and intervention study. Participants were required to use a novel coaching cricket bat in a coaching game format. Biomechanical and video analysis was conducted in the frontal and lateral planes. Effect sizes (ES) were calculated to determine the effectiveness and the level of significance was set at pbat compared with a conventional cricket bat (p=0.003). 6 weeks postintervention (training with the coaching cricket bat), the experimental group displayed improved performance (ES=5.41). Players' backlifts had subsequently become more lateral, which may have promoted more effective ball striking as a result of this training effect. The recommendation from this study is that coaches should encourage young cricketers to use the coaching cricket bat as it is perceived to be a potentially significant training aid for enhancing their performance and the direction of their backlift when they use conventional cricket bats in match play.

Meio semi-seletivo para isolamento de Xanthomonas campestris pv. viticola

Directory of Open Access Journals (Sweden)

Peixoto Ana Rosa

2006-01-01

Full Text Available O cancro bacteriano causado por Xanthomonas campestris pv. viticola é a fitobacteriose mais importante da videira no Submédio São Francisco. O isolamento de X. campestris pv. viticola de tecidos vegetais infectados é dificultado pela presença de contaminantes bacterianos, entre os quais Microbacterium barkeri. Objetivando-se a formulação de meio de cultura semi-seletivo, 22 isolados de X. campestris pv. viticola foram testados com relação a 30 antibióticos. O meio semi-seletivo NYDAM (extrato de carne 3, peptona 5, glicose 10, extrato de levedura 5, ágar 18 e ampicilina 0,1 em g L-1 inibiu M. barkeri e bactérias fitopatogênicas podendo ser utilizado para isolar X. campestris pv. viticola de hospedeiros com infecção natural em campo.

Changes to injury profile (and recommended cricket injury definitions based on the increased frequency of Twenty20 cricket matches

Directory of Open Access Journals (Sweden)

John Orchard

2010-05-01

Full Text Available John Orchard1, Trefor James2, Alex Kountouris2, Marc Portus21School of Public Health, University of Sydney, Sydney, Australia; 2Cricket Australia, Melbourne, AustraliaAbstract: This study analyzes injuries occurring prospectively in Australian men’s cricket at the state and national levels over 11 seasons (concluding in season 2008–09. In the last four of these seasons, there was more cricket played, with most of the growth being a new form of the game – Twenty20 cricket. Since the introduction of a regular Twenty20 program, injury incidence rates in each form of cricket have been fairly steady. Because of the short match duration, Twenty20 cricket exhibits a high match injury incidence, expressed as injuries per 10,000 hours of play. Expressed as injuries per days of play, Twenty20 cricket injury rates compare more favorably to other forms of cricket. Domestic level Twenty20 cricket resulted in 145 injuries per 1000 days of play (compared to 219 injuries per 1000 days of domestic one day cricket, and 112 injuries per 1000 days of play in first class domestic cricket. It is therefore recommended that match injury incidence measures be expressed in units of injuries per 1000 days of play. Given the high numbers of injuries which are of gradual onset, seasonal injury incidence rates (which typically range from 15–20 injuries per team per defined ‘season’ are probably a superior incidence measure. Thigh and hamstring strains have become clearly the most common injury in the past two years (greater than four injuries per team per season, perhaps associated with the increased amount of Twenty20 cricket. Injury prevalence rates have risen in conjunction with an increase in the density of the cricket calendar. Annual injury prevalence rates (average proportion of players missing through injury have exceeded 10% in the last three years, with the injury prevalence rates for fast bowlers exceeding 18%. As the amount of scheduled cricket is

CERN Cricket Club

CERN Document Server

CERN Cricket Club

2018-01-01

The CERN Cricket Club 2018 season begins soon, the first net practice is scheduled (weather permitting) for Thursday April 12th, at 18.00!  The club is always looking for new players and newcomers will be made very welcome. Anyone who is interested in joining the club should sign up on our web site: http://cern.ch/cricket/ or turn up for net practice, which takes place each Thursday evening (apart from CERN official holidays) until the end of September (starting at 18:00 to around 20:00) at the CERN Prévessin site: http://cern.ch/cricket/CERN-Ground.html The first matches will be in the Geneva T20 competition on Saturday and Sunday, April 14th / 15th. 

Production and cytogenetics of Brassica campestris-alboglabra chromosome addition lines

DEFF Research Database (Denmark)

Chen, B.Y.; Cheng, B.F.; Bagger Jørgensen, Rikke

1997-01-01

Four different Brassica campestris-alboglabra monosomic addition lines (AA + 1 chromosome from C, 2n = 21) were obtained after consecutive backcrosses between resynthesized B. napus (AACC, 2n = 38) and the parental B. campestris (AA, 2n = 20) accession. The alien chromosomes of B. alboglabra (CC, 2...

African Zoology - Vol 28, No 2 (1993)

African Journals Online (AJOL)

Relationship between body temperature and air temperature in stridulating male crickets, Gryllus bimaculatus (Orthoptera: Gryllidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R.B. Toms, J.W.H. Ferguson, S Becker, 71-73 ...

MicroRNAs from the parasitic plant Cuscuta campestris target host messenger RNAs.

Science.gov (United States)

Shahid, Saima; Kim, Gunjune; Johnson, Nathan R; Wafula, Eric; Wang, Feng; Coruh, Ceyda; Bernal-Galeano, Vivian; Phifer, Tamia; dePamphilis, Claude W; Westwood, James H; Axtell, Michael J

2018-01-03

Dodders (Cuscuta spp.) are obligate parasitic plants that obtain water and nutrients from the stems of host plants via specialized feeding structures called haustoria. Dodder haustoria facilitate bidirectional movement of viruses, proteins and mRNAs between host and parasite, but the functional effects of these movements are not known. Here we show that Cuscuta campestris haustoria accumulate high levels of many novel microRNAs (miRNAs) while parasitizing Arabidopsis thaliana. Many of these miRNAs are 22 nucleotides in length. Plant miRNAs of this length are uncommon, and are associated with amplification of target silencing through secondary short interfering RNA (siRNA) production. Several A. thaliana mRNAs are targeted by 22-nucleotide C. campestris miRNAs during parasitism, resulting in mRNA cleavage, secondary siRNA production, and decreased mRNA accumulation. Hosts with mutations in two of the loci that encode target mRNAs supported significantly higher growth of C. campestris. The same miRNAs that are expressed and active when C. campestris parasitizes A. thaliana are also expressed and active when it infects Nicotiana benthamiana. Homologues of target mRNAs from many other plant species also contain the predicted target sites for the induced C. campestris miRNAs. These data show that C. campestris miRNAs act as trans-species regulators of host-gene expression, and suggest that they may act as virulence factors during parasitism.

Cricket Club

CERN Multimedia

Cricket Club

2015-01-01

CERN Cricket Club celebrates its 50th anniversary this year, with a game involving some of the ex members (but unfortunately none of the founder members) followed by dinner on Saturday, September 5th. CERN started playing cricket on various football fields in the Geneva Canton, then on the Meyrin site next to where the Kindergarten is now situated, bowling from one end only. Later, net practice took place where building 40 is now, before moving over to the Prevessin site in the early 70s. Lots of work was done to prepare a strip onto which a mat was rolled and the strip was rolled before each match using a heavy roller which required a minimum of 6 to push! This pre-match training is no longer necessary as the club invested in an artificial wicket in 2001. CERN now has one of the best grounds in the region. Last year CERN made it to the Cricket Switzerland semi-final, losing a close match in the last over, but is hoping to go one better in this year’s semi-final on September 13th, which will be...

Navigation of robotic system using cricket motes

Science.gov (United States)

Patil, Yogendra J.; Baine, Nicholas A.; Rattan, Kuldip S.

2011-06-01

This paper presents a novel algorithm for self-mapping of the cricket motes that can be used for indoor navigation of autonomous robotic systems. The cricket system is a wireless sensor network that can provide indoor localization service to its user via acoustic ranging techniques. The behavior of the ultrasonic transducer on the cricket mote is studied and the regions where satisfactorily distance measurements can be obtained are recorded. Placing the motes in these regions results fine-grain mapping of the cricket motes. Trilateration is used to obtain a rigid coordinate system, but is insufficient if the network is to be used for navigation. A modified SLAM algorithm is applied to overcome the shortcomings of trilateration. Finally, the self-mapped cricket motes can be used for navigation of autonomous robotic systems in an indoor location.

Cricket Inspired Flow-Sensor Arrays

NARCIS (Netherlands)

Jaganatharaja, R.K.

2011-01-01

Crickets, like many other arthropods, are evolved with an astonishing sensory system, which plays a vital role in their survival. Located at the rear-end of the crickets, are a pair of sensory appendages called cerci, carrying numerous mechano-receptive filiform hairs. These filiform hairs are

The host plant metabolite glucose is the precursor of diffusible signal factor (DSF) family signals in Xanthomonas campestris.

Science.gov (United States)

Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui

2015-04-01

Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous addition of host plant juice or ethanol extract to the growth medium of X. campestris pv. campestris could significantly boost DSF family signal production. It was subsequently revealed that X. campestris pv. campestris produces not only DSF but also BDSF (cis-2-dodecenoic acid) and another novel DSF family signal, which was designated DSF-II. BDSF was originally identified in Burkholderia cenocepacia to be involved in regulation of motility, biofilm formation, and virulence in B. cenocepacia. Functional analysis suggested that DSF-II plays a role equal to that of DSF in regulation of biofilm dispersion and virulence factor production in X. campestris pv. campestris. Furthermore, chromatographic separation led to identification of glucose as a specific molecule stimulating DSF family signal biosynthesis in X. campestris pv. campestris. (13)C-labeling experiments demonstrated that glucose acts as a substrate to provide a carbon element for DSF biosynthesis. The results of this study indicate that X. campestris pv. campestris could utilize a common metabolite of the host plant to enhance DSF family signal synthesis and therefore promote virulence. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

Relationship between body temperature and air temperature in ...

African Journals Online (AJOL)

Body temperatures of singing male Gryllus bimaculatus were measured for the first time. Body temperatures were strongly correlated with ambient temperature. This indicates that, unlike some other orthopterans, larger crickets are not dependent on an elevated body temperature for efficient calling. Our results confirm that it ...

Modulatory action of acetylcholine on the Na+-dependent action potentials in Kenyon cells isolated from the mushroom body of the cricket brain.

Science.gov (United States)

Terazima, E; Yoshino, M

2010-12-01

Kenyon cells, intrinsic neurons of the insect mushroom body, have been assumed to be a site of conditioning stimulus (CS) and unconditioned stimulus (US) association in olfactory learning and memory. Acetylcholine (ACh) has been implicated to be a neurotransmitter mediating CS reception in Kenyon cells, causing rapid membrane depolarization via nicotinic ACh receptors. However, the long-term effects of ACh on the membrane excitability of Kenyon cells are not fully understood. In this study, we examined the effects of ACh on Na(+) dependent action potentials (Na(+) spikes) elicited by depolarizing current injection and on net membrane currents under the voltage clamp condition in Kenyon cells isolated from the mushroom body of the cricket Gryllus bimaculatus. Current-clamp studies using amphotericin B perforated-patch recordings showed that freshly dispersed cricket Kenyon cells could produce repetitive Na(+) spikes in response to prolonged depolarizing current injection. Bath application of ACh increased both the instantaneous frequency and the amplitudes of Na(+) spikes. This excitatory action of ACh on Kenyon cells is attenuated by the pre-treatment of the cells with the muscarinic receptor antagonists, atropine and scopolamine, but not by the nicotinic receptor antagonist mecamylamine. Voltage-clamp studies further showed that bath application of ACh caused an increase in net inward currents that are sensitive to TTX, whereas outward currents were decreased by this treatment. These results indicate that in order to mediate CS, ACh may modulate the firing properties of Na(+) spikes of Kenyon cells through muscarinic receptor activation, thus increasing Na conductance and decreasing K conductance. Copyright © 2010 Elsevier Ltd. All rights reserved.

Bernoulli Runs Using 'Book Cricket' to Evaluate Cricketers

Indian Academy of Sciences (India)

both the game as well as statistical ... drowsiness in school we resorted to playing 'book cricket'. The book .... die probabilistic model to take advantage of the easy availability of the ..... enclopedia, Online; accessed 31-Dec-2010/. URL http://.

Venereal worms: sexually transmitted nematodes in the decorated cricket.

Science.gov (United States)

Luong, L T; Platzer, E G; Zuk, M; Giblin-Davis, R M

2000-06-01

The nematode, Mehdinema alii, occurs in the alimentary canal of the decorated cricket Gryllodes sigillatus. Adult nematodes occur primarily in the hindgut of mature male crickets, whereas juvenile nematodes are found in the genital chambers of mature male and female crickets. Here, we present experimental evidence for the venereal transmission of M. alii in G. sigillatus. Infectivity experiments were conducted to test for transmission via oral-fecal contamination, same-sex contact, and copulation. The infective dauers of the nematode are transferred from male to female crickets during copulation. Adult female crickets harboring infective dauers subsequently transfer the nematode to their next mates. Thus, M. alii is transmitted sexually during copulation.

Comparing Social and Intellectual Appeals to Reduce Disgust of Eating Crickets

Directory of Open Access Journals (Sweden)

Sheppard, Barry

2015-12-01

Full Text Available Objective. Research on disgust, to date, has focused on general sensitivity. This experiment looks at disgust specific to eating crickets, how it can be reduced, whether there are differences with gender and whether age correlate with that disgust. Methods. A convenience sample of 352 participants completed an online questionnaire, were randomly assigned into groups who viewed an intellectual appeal (text or a social appeal (video. They rated before and after, as a measure of disgust, their likelihood of eating a whole cricket and also a bar which contained cricket flour. Results. Members of the social appeal group had a significantly greater change in likelihood to eat a cricket bar (p = .028, BF10 = 3.92, but not a whole cricket (p = .316, BF10 = 0.13. Female participants were less likely than male participants to eat a whole cricket (p < .001, BF10 = 4828.84 or a cricket bar (p = .001, BF10 = 181.18. Older participants were less likely to eat a whole cricket (p = .01, BF10 = 4.98 or a cricket bar (p = .005, BF10 = 34.12. Conclusions. Results support the role of social influence in disgust of eating crickets.

"Neither cricketers nor ladies": towards a history of women and cricket in South Africa, 1860s-2000s.

Science.gov (United States)

Odendaal, André

2011-01-01

There is a dearth of research and writing on women's cricket in South Africa. In an attempt to enhance understanding of the nature and effects of women's involvement in the game of cricket over the past 200 years, this essay offers a chronological account of the sport and the role women played in it. It draws on readings from the international scholarship on women's early involvement in sport, the fragments that have existed to date about women's cricket in South Africa and some newly discovered primary material from the 1950s onwards. The essay aims to provide a historical context and open a window for historians and social analysts into an area few knew existed before. There is now a distinctive history and subculture of cricket with multiple social dimensions for scholars to explore; here I offer some preliminary insights.

Immunity at Cauliflower Hydathodes Controls Systemic Infection by Xanthomonas campestris pv campestris.

Science.gov (United States)

Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge; Leonhardt, Nathalie; Berthomé, Richard; Noël, Laurent D

2017-06-01

Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower ( Brassica oleracea ) and Arabidopsis ( Arabidopsis thaliana ) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris ( Xcc ), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. © 2017 American Society of Plant Biologists. All Rights Reserved.

Self-Efficacy and social support of Academy cricketers | Cowan ...

African Journals Online (AJOL)

South African Journal for Research in Sport, Physical Education and Recreation ... This article aims to provide an initial insight into the role that South African provincial cricket academies play in talent development of cricketers by reflecting on possible changes in academy cricketers' self-efficacy and perceived social ...

Contrasting the Chromosomal Organization of Repetitive DNAs in Two Gryllidae Crickets with Highly Divergent Karyotypes.

Directory of Open Access Journals (Sweden)

Octavio M Palacios-Gimenez

Full Text Available A large percentage of eukaryotic genomes consist of repetitive DNA that plays an important role in the organization, size and evolution. In the case of crickets, chromosomal variability has been found using classical cytogenetics, but almost no information concerning the organization of their repetitive DNAs is available. To better understand the chromosomal organization and diversification of repetitive DNAs in crickets, we studied the chromosomes of two Gryllidae species with highly divergent karyotypes, i.e., 2n(♂ = 29,X0 (Gryllus assimilis and 2n = 9, neo-X1X2Y (Eneoptera surinamensis. The analyses were performed using classical cytogenetic techniques, repetitive DNA mapping and genome-size estimation. Conserved characteristics were observed, such as the occurrence of a small number of clusters of rDNAs and U snDNAs, in contrast to the multiple clusters/dispersal of the H3 histone genes. The positions of U2 snDNA and 18S rDNA are also conserved, being intermingled within the largest autosome. The distribution and base-pair composition of the heterochromatin and repetitive DNA pools of these organisms differed, suggesting reorganization. Although the microsatellite arrays had a similar distribution pattern, being dispersed along entire chromosomes, as has been observed in some grasshopper species, a band-like pattern was also observed in the E. surinamensis chromosomes, putatively due to their amplification and clustering. In addition to these differences, the genome of E. surinamensis is approximately 2.5 times larger than that of G. assimilis, which we hypothesize is due to the amplification of repetitive DNAs. Finally, we discuss the possible involvement of repetitive DNAs in the differentiation of the neo-sex chromosomes of E. surinamensis, as has been reported in other eukaryotic groups. This study provided an opportunity to explore the evolutionary dynamics of repetitive DNAs in two non-model species and will contribute to the

Antagonism of yeasts to Xanthomonas campestris pv. campestris on cabbage phylloplane in field Antagonismo de leveduras a Xanthomonas campestris pv. campestris no filoplano de repolho em condições de campo

Directory of Open Access Journals (Sweden)

Sayonara M.P. Assis

1999-07-01

Full Text Available Twenty yeast isolates, obtained from cabbage phylloplane, were evaluated for antagonistic activity against Xanthomonas campestris pv. campestris, in field. Plants of cabbage cv. Midori were pulverized simultaneously with suspensions of antagonists and pathogen. After 10 days, plants were evaluated through percentage of foliar area with lesions. Percentage of disease severity reduction (DSR% was also calculated. Yeast isolates LR32, LR42 and LR19 showed, respectively, 72, 75 and 79% of DSR. These antagonists were tested in seven different application periods in relation to pathogen inoculation (T1=4 d before; T2=simultaneously; T3=4 d after; T4=4 d before + simultaneously; T5=4 d after + simultaneously; T6=4 d before + 4 d after; T7=4 d before + simultaneously + 4 d after. The highest DSRs were showed by LR42 (71%, LR42 (67%, LR35 (69% and LR19 (68% in the treatments T7, T4, T5 and T6, which significantly differed from the others. The same yeast antagonists were also tested for black rot control using different cabbage cultivars (Fuyutoyo, Master-325, Matsukaze, Midori, Sekai I and Red Winner. The DSRs varied from 58 to 61%, and there was no significant difference among cultivars.Vinte isolados de leveduras, obtidos a partir do filoplano de repolho foram avaliados pela atividade antagônica contra Xanthomonas campestris pv. campestris, em condições de campo. Plantas de repolho cv. Midori foram pulverizadas simultaneamente com suspensões do antagonista e do patógeno. Após 10 dias, as plantas foram avaliadas através da porcentagem de área foliar infectada. A porcentagem de redução da severidade da doença (DSR%, também foi calculada. Os isolados de leveduras LR32, LR42 e LR19 apresentaram, respectivamente, 72, 75 e 79% de DSR. Estes isolados foram testados em sete diferentes períodos de aplicação dos antagonistas em relação a inoculação do patógeno. (T1=4d antes; T2=simultaneamente; T3=4 d após; T4=4 d antes + simultaneamente; T5

Physiological, movement and technical demands of centre-wicket Battlezone, traditional net-based training and one-day cricket matches: a comparative study of sub-elite cricket players.

Science.gov (United States)

Vickery, Will; Dascombe, Ben; Duffield, Rob

2014-01-01

This study compared physiological, physical and technical demands of Battlezone, traditional cricket training and one-day matches. Data were initially collected from 11 amateur, male cricket players (age: 22.2 ± 3.3 year, height: 1.82 ± 0.06 m body mass: 80.4 ± 9.8 kg) during four Battlezone and four traditional cricket training sessions encompassing different playing positions. Heart rate, blood lactate concentration, rating of perceived exertion and movement patterns of players were measured. Retrospective video analysis was performed to code for technical outcomes. Similar data were collected from 42 amateur, male cricket players (23.5 ± 4.7 year, 1.81 ± 0.07 m, 81.4 ± 11.4 kg) during one-day matches. Significant differences were found between Battlezone, traditional cricket training and one-day matches within each playing position. Specifically, Battlezone invoked the greatest physiological and physical demands from batsmen in comparison to traditional cricket training and one-day matches. However, the greatest technical demand for batsmen was observed during traditional cricket training. In regards to the other playing positions, a greater physiological, physical and technical demand was observed during Battlezone and traditional training than during one-day matches. These results suggest that the use of Battlezone and traditional cricket training provides players with a suitable training stimulus for replicating the physiological, physical and technical demands of one-day cricket.

Immunity at Cauliflower Hydathodes Controls Systemic Infection by Xanthomonas campestris pv campestris1

Science.gov (United States)

Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge

2017-01-01

Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower (Brassica oleracea) and Arabidopsis (Arabidopsis thaliana) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris (Xcc), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. PMID:28184011

Nutritional effects on male calling behaviour in the variable field cricket.

Science.gov (United States)

Wagner; Hoback

1999-01-01

In the variable field cricket, Gryllus lineaticeps, females prefer higher chirp rates and longer chirp durations in male calling song. Higher chirp rates are energetically more expensive to produce, but the energetic cost of calling does not vary with chirp duration. We tested the hypothesis that nutrition affects male chirp rate and chirp duration. Full-sibling brothers of similar age were placed on high- and low-nutrition feeding regimes. There was no effect of feeding regime on male weight; neither group showed a significant change in weight, and the two groups did not differ from each other in weight change. However, males on the high-nutrition feeding regime both called more frequently and called at higher chirp rates when they did call. The two groups did not differ in chirp duration, the duration of pulses within chirps or chirp dominant frequency. These results suggest that females select mates based on one nutrition-dependent call character (chirp rate) and one nutrition-independent call character (chirp duration). In addition, because males in the two groups did not show significant differences in weight change, and because males on the high-nutrition feeding regime engaged in energetically more expensive calling, these results suggest that males invest any excess energy above their basic maintenance requirements in the production of call types that increase their attractiveness to females. The absence of a relationship between body condition and calling song structure for males in the field may be a consequence of this pattern of energy allocation. Copyright 1999 The Association for the Study of Animal Behaviour.

Perceived Injury Risk among Junior Cricketers: A Cross Sectional Survey

Directory of Open Access Journals (Sweden)

Prasanna J. Gamage

2017-08-01

Full Text Available Understanding how junior athletes perceive injury risks when participating in sport and the environment they play in is an important component of injury prevention. This study investigates how Sri Lankan junior cricketers (n = 365, aged 11–14 years, boys perceive injury risks associated with playing cricket. The study used a Sri Lankan modification of an Australian junior cricket injury risk perception survey that considered playing cricket versus other sports, different cricket playing positions and roles, and different ground conditions. The risk of playing cricket was considered to be greater than that for cycling, but lower than that for rugby and soccer. Fast-bowlers, batters facing fast-bowlers, fielding close in the field, and wicket-keeping without a helmet were perceived to pose greater risks of injury than other scenarios. Playing on hard, bumpy and/or wet ground conditions were perceived to have a high risk opposed to playing on a grass field. Fielding in the outfield and wicket-keeping to fast-bowlers whilst wearing a helmet were perceived as low risk actions. The risk perceptions of junior cricketers identified in this study, do not necessarily reflect the true injury risk in some instances. This information will inform the development of injury prevention education interventions to address these risk perceptions in junior cricketers.

Detecção, transmissão e efeito de Xanthomonas campestris pv. campestris na qualidade fisiológica de sementes de brócolis Detection, transmission and effect of Xanthomonas campestris pv. campestris in the physiological quality of broccoli seeds

Directory of Open Access Journals (Sweden)

Nilvanira Donizeti Tebaldi

2007-12-01

Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliados, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica de sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento de plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants (`Baron', `Flórida', `Hana Midori Sakata', `Precoce Piracicaba de Verão', `Ramoso Santana' and `Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight. The

Detecção, transmissão e efeito de Xanthomonas campestris pv. campestris na qualidade fisiológica de sementes de brócolis Detection, transmission and effect of Xanthomonas campestris pv. campestris in the physiological quality of broccoli seeds

Directory of Open Access Journals (Sweden)

Nilvanira Donizete Tebaldi

2007-09-01

Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliadas, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica das sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento das plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants ('Baron', 'Flórida', 'Hana Midori Sakata', 'Precoce Piracicaba de Verão', 'Ramoso Santana' and 'Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight

Glycerol as a carbon source for xantan production by Xanthomonas campestris isolates

Directory of Open Access Journals (Sweden)

Bajić Bojana Ž.

2015-01-01

Full Text Available The success of xanthan biosynthesis depends on several factors, most importantly the genetic potential of the production microorganism and cultivation media composition. Cultivation media composition affects the yield and quality of the desired product as well as production costs. This is why many studies focus on finding cheap alternative raw materials, especially carbon sources, to replace commercially used glucose and sucrose. In addition to the Xanthomonas campestris ATCC 13951 which is the primary industrial production microorganism, other Xanthomonas strains can produce xanthan as well. Under the same conditions, different strains produce different amounts of the biopolymer of varying quality. The aim of this paper is to compare producibility of phytopathogenic X. campestris strains, isolated from the environment with the reference X. campestris ATCC 13951 strain and to estimate the possibility of xanthan production using alternative glycerol-based media than the synthetic glucose-based media. Submerged cultivation on the medium based on glucose or glycerol (2.0 %w/v was performed using the reference strain and eight isolated X. campestris strains. In order to assess the success of biosynthesis, xanthan yield and rheological properties were determined. Strains isolated from the environment produced yields between 2.98 g/L and 12.17 g/L on the glucose-based medium and 1.68 g/L and 6.31 g/L on the glycerol-based medium. Additionally, X. campestris ATCC 13951 provided the highest yield when using glucose (13.24 g/L, as well as glycerol-based medium (7.44 g/L. The obtained results indicate that in the applied experimental conditions and using all tested strains, glycerol is viable as a carbon source for the production of xanthan.

Transformation in cricket: the black African experience

African Journals Online (AJOL)

Objectives: To understand the career progression of BA cricketers in South Africa .... views on the career progression and the representation of .... is one of the things that I think is a weakness. (Participant 17) ... through the different levels of cricket, but all players identified the positive ..... The case of minorities and women.

and Saccostomus campestris (Cricetomyinae) in relation to ...

African Journals Online (AJOL)

The gastric anatomy of two African cricetomyines is described and compared with that of the only African cricetine. The stomach of C. gambianus is more specialized than that of S. campestris and shows many parallels with that of M. albicaudatus. Both cricetomyines possess an oesophageal groove system which is absent ...

A Mathematical Modelling Approach to One-Day Cricket Batting Orders

Science.gov (United States)

Bukiet, Bruce; Ovens, Matthews

2006-01-01

While scoring strategies and player performance in cricket have been studied, there has been little published work about the influence of batting order with respect to One-Day cricket. We apply a mathematical modelling approach to compute efficiently the expected performance (runs distribution) of a cricket batting order in an innings. Among other applications, our method enables one to solve for the probability of one team beating another or to find the optimal batting order for a set of 11 players. The influence of defence and bowling ability can be taken into account in a straightforward manner. In this presentation, we outline how we develop our Markov Chain approach to studying the progress of runs for a batting order of non- identical players along the lines of work in baseball modelling by Bukiet et al., 1997. We describe the issues that arise in applying such methods to cricket, discuss ideas for addressing these difficulties and note limitations on modelling batting order for One-Day cricket. By performing our analysis on a selected subset of the possible batting orders, we apply the model to quantify the influence of batting order in a game of One Day cricket using available real-world data for current players. Key Points Batting order does effect the expected runs distribution in one-day cricket. One-day cricket has fewer data points than baseball, thus extreme values have greater effect on estimated probabilities. Dismissals rare and probabilities very small by comparison to baseball. Probability distribution for lower order batsmen is potentially skewed due to increased risk taking. Full enumeration of all possible line-ups is impractical using a single average computer. PMID:24357943

Incidence and prevalence of elite male cricket injuries using updated consensus definitions

Directory of Open Access Journals (Sweden)

Orchard JW

2016-12-01

Full Text Available John W Orchard, Alex Kountouris, Kevin Sims National Cricket Centre, Cricket Australia, Brisbane, Australia Background: T20 (Twenty20 or 20 over cricket has emerged in the last decade as the most popular form of cricket (in terms of spectator attendances. International consensus cricket definitions, first published in 2005, were updated in 2016 to better reflect the rise to prominence of T20 cricket.  Methods: Injury incidence and prevalence rates were calculated using the new international methods and units for elite senior male Australian cricketers over the past decade (season 2006–2007 to season 2015–2016 inclusive.  Results: Over the past 10 seasons, average match injury incidence, for match time-loss injuries, was 155 injuries/1,000 days of play, with the highest daily rates in 50-over cricket, followed by 20-over cricket and First-Class matches. Annual injury incidence was 64 injuries/100 players per season, and average annual injury prevalence was 12.5% (although fast bowlers averaged 20.6%, much higher than other positions. The most common injury was the hamstring strain (seasonal incidence 8.7 injuries/100 players per season. The most prevalent injury was lumbar stress fractures (1.9% of players unavailable at all times owing to these injuries, which represents 15% of all missed playing time.  Discussion: The hamstring strain has emerged from being one of the many common injuries in elite cricket a decade ago to being clearly the most common injury in the sport at the elite level. This is presumably in association with increased T20 cricket. Lumbar stress fractures in fast bowlers are still the most prevalent injury in the sport of cricket at the elite level, although these injuries are more associated with high workloads arising from the longer forms of the game. Domestic and international matches have very similar match injury incidence rates across the formats, but injury prevalence is higher in international players as

The Classroom Animal: Crickets.

Science.gov (United States)

Kramer, David C.

1985-01-01

Suggests using crickets for classroom activities, providing background information on their anatomy and reproduction and tips on keeping individual organisms or a breeding colony in the classroom. (JN)

Analysis of outer membrane vesicle associated proteins isolated from the plant pathogenic bacterium Xanthomonas campestris pv. campestris

Directory of Open Access Journals (Sweden)

Niehaus Karsten

2008-06-01

Full Text Available Abstract Background Outer membrane vesicles (OMVs are released from the outer membrane of many Gram-negative bacteria. These extracellular compartments are known to transport compounds involved in cell-cell signalling as well as virulence associated proteins, e.g. the cytolysine from enterotoxic E. coli. Results We have demonstrated that Xanthomonas campestris pv. campestris (Xcc releases OMVs into the culture supernatant during growth. A proteome study identified 31 different proteins that associate with the OMV fraction of which half are virulence-associated. A comparison with the most abundant outer membrane (OM proteins revealed that some proteins are enriched in the OMV fraction. This may be connected to differences in the LPS composition between the OMVs and the OM. Furthermore, a comparison of the OMV proteomes from two different culture media indicated that the culture conditions have an impact on the protein composition. Interestingly, the proteins that are common to both culture conditions are mainly involved in virulence. Conclusion Outer membrane vesicles released from the OM of Xcc contain membrane- and virulence-associated proteins. Future experiments will prove whether these structures can serve as "vehicles" for the transport of virulence factors into the host membrane.

Female field crickets incur increased parasitism risk when near preferred song.

Directory of Open Access Journals (Sweden)

Cassandra M Martin

2010-03-01

Full Text Available Female animals often prefer males with conspicuous traits because these males provide direct or indirect benefits. Conspicuous male traits, however, can attract predators. This not only increases the risk of predation for conspicuous males but also for the females that prefer them. In the variable field cricket, Gryllus lineaticeps, males that produce preferred song types provide females with greater material benefits, but they are also more likely to attract lethal parasitoid flies. First, we conducted a field experiment that tested the hypothesis that females have a greater risk of fly parasitism when in association with preferred high chirp rate males. Females were nearly twice as likely to be parasitized when caged with high chirp rate song than when caged with low chirp rate song. Females may thus be forced to trade off the quality of the benefits they receive from mating with preferred males and the risk of being killed by a predator when near these males. Second, we assessed female parasitism rates in a natural population. Up to 6% of the females were parasitized in field samples. Because the females we collected could have become parasitized had they not been collected, this provides a minimum estimate of the female parasitism rate in the field. In a laboratory study, we found no difference in the proportion of time parasitized and unparasitized females spent hiding under shelters; thus, differences in activity patterns do not appear to have biased our estimate of female parasitism rates. Overall, our results suggest that female association costs have the potential to shape the evolution of female mating preferences.

Aggregation of Cricket Activity in Response to Resource Addition Increases Local Diversity.

Directory of Open Access Journals (Sweden)

Neucir Szinwelski

Full Text Available Crickets are often found feeding on fallen fruits among forest litter. Fruits and other sugar-rich resources are not homogeneously distributed, nor are they always available. We therefore expect that crickets dwelling in forest litter have a limited supply of sugar-rich resource, and will perceive this and displace towards resource-supplemented sites. Here we evaluate how sugar availability affects cricket species richness and abundance in old-growth Atlantic forest by spraying sugarcane syrup on leaf litter, simulating increasing availability, and collecting crickets via pitfall trapping. We found an asymptotic positive association between resource addition and species richness, and an interaction between resource addition and species identity on cricket abundance, which indicates differential effects of resource addition among cricket species. Our results indicate that 12 of the 13 cricket species present in forest litter are maintained at low densities by resource scarcity; this highlights sugar-rich resource as a short-term driver of litter cricket community structure in tropical forests. When resource was experimentally increased, species richness increased due to behavioral displacement. We present evidence that the density of many species is limited by resource scarcity and, when resources are added, behavioral displacement promotes increased species packing and alters species composition. Further, our findings have technical applicability for increasing sampling efficiency of local cricket diversity in studies aiming to estimate species richness, but with no regard to local environmental drivers or species-abundance characteristics.

Boards and governance in African national cricket organisations: An ...

African Journals Online (AJOL)

Southern African Business Review ... the boards of African national cricket organisations to enhance the understanding of board involvement in ... The research reports on the composition of the boards of African cricket organisations as well as ...

Effect of Scarification, Self-Inhibition, and Sowing Depth on Seed Germination of Lupinus campestris Efecto de la Escarificación, Autoinhibición y Profundidad de Siembra sobre la Germinación de Semillas de Lupinus campestris

Directory of Open Access Journals (Sweden)

Pedro Gutiérrez Nava

2010-09-01

Full Text Available Lupinus campestris Schltdl. & Cham. grows in shallow fields and disturbed areas of Central Mexico. It has potential to improve soil fertility and as fodder. Seeds of L. campestris show dormancy, and the technology needed to increase its potential use requires information about conditions favouring seed germination. The aim of this study was to evaluate the seed germination responseof L. campestris under controlled (laboratory and natural field conditions. Under laboratory conditions, 2 yr old seeds had a maximum germination percentage (50% when they were scarified with sulphuric acid for 90 min prior to sowing and when laboratory light (0.5 µmol m-2 s-1 was maintained during the diurnal period. Without scarification, only about 3% of the seeds germinated. Light in laboratory resulted in an increased seed germination as compared to darkness condition. In the field experiment 1 yr old seeds were used testing the following treatments: (a seed scarification (seeds scarified by 30 min immersion in sulphuric acid vs. not scarified, (b presence or absence of plants of L. campestris in plots before field experiments, and (c sowing depth (on soil surface and at 3 cm deep. The scarified seeds showed a germination percentage range between 50 and 64%, whereas non-scarified seeds had 9 to 16% germination. The seeds sowed in plots with or without plants of L. campestris (before the experiment germinated similarly, indicating no evidence of self-inhibition of germination. Three conclusions come out: (1 Scarification treatment with sulphuric acid effectively breaks dormancy in L. campestris seeds; (2 Direct sowing of scarified seeds (on the soil surface or at 3 cm depth resulted in a range of 50-64% of germination under field conditions; and (3 no evidence was obtained for self-inhibition or a positive interaction between preceding vegetation and seed germination of L. campestris.Lupinus campestris Schltdl. & Cham. crece en campos en descanso y �

A MATHEMATICAL MODELLING APPROACH TO ONE-DAY CRICKET BATTING ORDERS

Directory of Open Access Journals (Sweden)

Matthews Ovens1

2006-12-01

Full Text Available While scoring strategies and player performance in cricket have been studied, there has been little published work about the influence of batting order with respect to One-Day cricket. We apply a mathematical modelling approach to compute efficiently the expected performance (runs distribution of a cricket batting order in an innings. Among other applications, our method enables one to solve for the probability of one team beating another or to find the optimal batting order for a set of 11 players. The influence of defence and bowling ability can be taken into account in a straightforward manner. In this presentation, we outline how we develop our Markov Chain approach to studying the progress of runs for a batting order of non- identical players along the lines of work in baseball modelling by Bukiet et al., 1997. We describe the issues that arise in applying such methods to cricket, discuss ideas for addressing these difficulties and note limitations on modelling batting order for One-Day cricket. By performing our analysis on a selected subset of the possible batting orders, we apply the model to quantify the influence of batting order in a game of One Day cricket using available real-world data for current players

The development of the edible cricket industry in Thailand

DEFF Research Database (Denmark)

Halloran, Afton Marina Szasz; Roos, Nanna; Flore, Roberto

2016-01-01

considered in this study: cricket farmers; wholesale traders and market vendors; tourism agents; international organisa tions; chefs; private companies; researchers; and governmental representatives. The farming and sale of crickets is still a small-scale activity which is relatively profitable...

In situ radionuclide transfers in the deep-sea Lysianassidae amphipod Eurythenes gryllus

International Nuclear Information System (INIS)

Calmet, D.; Charmasson, S.

1989-01-01

Previous studies at the NEA dumpsite confirmed the existence of the scavenging amphipod Eurythenes gryllus. The aim of this study was to inquire if, under deep-sea conditions of low temperature and high pressure, this species of crustacean would retain artificial radionuclides in the same organ as those observed in similar coastal species of the same family. This necrophagous species is easily attracted by bait. It can ingest 30 to 60% of its body weight in 30 ± 10 min. In addition, this species can store ingested food for several weeks. Thus, the ingestion of radiolabelled food over a period of several days could be considered as a single-meal contamination experiment. For all these reasons Eurythenes gryllus appeared to be a good test animal to compare laboratory experiments on coastal species with in situ radionuclide retention studies on deep-sea fauna. In order to prevent any disturbance of their physiological conditions, a special device was used to attract and feed the animals with radiolabelled baits, in situ at a depth of 4000 m, rather than recovering amphipods without decompression and keeping them alive aboard ship. Qualitatively speaking results yielded by in situ experiments support those obtained from laboratory studies with coastal animals and the same radionuclides

Over-expression of miR158 causes pollen abortion in Brassica campestris ssp. chinensis.

Science.gov (United States)

Ma, Zhiming; Jiang, Jianxia; Hu, Ziwei; Lyu, Tianqi; Yang, Yang; Jiang, Jingjing; Cao, Jiashu

2017-02-01

We identified and cloned the two precursors of miR158 and its target gene in Brassica campestris ssp. chinensis, which both had high relative expression in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility, which was caused by the degradation of pollen contents from the binucleate microspore stage. These results first suggest the role of miR158 in pollen development of Brassica campestris ssp. chinensis. MicroRNAs (miRNAs) play crucial roles in many important growth and development processes both in plants and animals by regulating the expression of their target genes via mRNA cleavage or translational repression. In this study, miR158, a Brassicaceae specific miRNA, was functionally characterized with regard to its role in pollen development of non-heading Chinese cabbage (Brassica campestris ssp. chinensis). Two family members of miR158 in B. campestris, namely bra-miR158a1 and bra-miR158a2, and their target gene bra027656, which encodes a pentatricopeptide repeat (PPR) containing protein, were identified. Then, qRT-PCR analysis and GUS-reporter system revealed that both bra-miR158 and its target gene had relatively high expression levels in the inflorescences. Further study revealed that over-expression of miR158 caused reduced pollen varbility and pollen germination ratio, and the degradation of pollen contents from the binucleate microspore stage was also found in those deformed pollen grains, which led to pollen shrinking and collapse in later pollen development stage. These results first shed light on the importance of miR158 in pollen development of Brassica campestris ssp. chinensis.

A 3-year prospective study on ocular injuries with tennis or cricket ball while playing cricket: A case series

Directory of Open Access Journals (Sweden)

Santosh Kumar Mahapatra

2018-01-01

Full Text Available Purpose: The purpose of this study is to study the clinical features, visual outcome, management, and ocular complications of ocular injury, following trauma with tennis or cricket ball. Methods: A prospective, noncomparative case study of patients having injury with tennis/cricket ball while playing cricket was conducted between January 2013 and April 2016. Seventy-six eyes of 76 patients were studied. Presenting vision, age, gender, time since injury, general and ocular examination, intraocular pressure, indirect ophthalmoscopy, B scan, and X-ray/computed tomography scan findings were noted. Patients were managed medically or surgically as per the need and followed up at least for 6 months. Results: Seventy-six eyes of 76 patients were studied. All cases were male, except two. Majority (80.2% were <25 years. Median presenting visual acuity (VA was 6/36 and median final VA was 6/18. Significant findings in the decreasing order of frequency were sphincter tear (26.3%, retinal detachment (23.6%, angle recession (18.4%, choroidal rupture (17.1%, and Berlin's edema (15.7%. Most of the cases (69.7% were managed medically. Only 30.2% cases needed surgical intervention. Final visual outcome in our study was depended on initial VA (P = 0.000. It was also correlating with presenting clinical feature (P = 0.010 and type of intervention (medical/surgical (P = 0.001. Conclusion: Cricket-related ocular injury generally has a poor prognosis with most cases being closed globe injury; retinal detachment is the most common vision-threatening presentation. In spite of being a common event, cricket-related injury is sparingly documented and hence needs further studies for proper documentation, prognostication, and formulation of definitive management plan.

Diffusible signal factor family signals provide a fitness advantage to Xanthomonas campestris pv. campestris in interspecies competition.

Science.gov (United States)

Deng, Yinyue; Wu, Jien; Yin, Wenfang; Li, Peng; Zhou, Jianuan; Chen, Shaohua; He, Fei; Cai, Jun; Zhang, Lian-Hui

2016-05-01

Diffusible signal factor (DSF) represents a new class of widely conserved quorum sensing signals, which regulates various biological functions through intra- or interspecies signaling. The previous studies identified that there is an antagonistic interaction between Xanthomonas and Bacillus species bacteria in natural ecosystem, but the detailed molecular mechanism of interspecies competition is not clear. This study showed that Xanthomonas campestris pv. campestris (Xcc) interfered with morphological transition and sporulation of Bacillus thuringiensis in mixed cultures, whereas abrogation of the DSF synthase RpfF reduced the interference. DSF inhibited B. thuringiensis cell division and sporulation through modulation of ftsZ, which encodes an important cell division protein in bacterial cells. In addition, RpfF is essential for production of six DSF-family signals in Xcc, which employ the same signaling pathways to regulate biological functions in Xcc and play similar effects on reduction of cell division, sporulation and antibiotic resistance of B. thuringiensis. Furthermore, abrogation of RpfF decreased the competitive capability of Xcc against B. thuringiensis on the surface of Chinese cabbage leaves. Our findings provide new insights into the role of DSF-family signals in interspecies competition and depict molecular mechanisms with which Xcc competes with B. thuringiensis. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

Establishment of an inducing medium for type III effector secretion in Xanthomonas campestris pv. campestris

Directory of Open Access Journals (Sweden)

Guo-Feng Jiang

2013-09-01

Full Text Available It is well known that the type III secretion system (T3SS and type III (T3 effectors are essential for the pathogenicity of most bacterial phytopathogens and that the expression of T3SS and T3 effectors is suppressed in rich media but induced in minimal media and plants. To facilitate in-depth studies on T3SS and T3 effectors, it is crucial to establish a medium for T3 effector expression and secretion. Xanthomonas campestris pv. campestris (Xcc is a model bacterium for studying plant-pathogen interactions. To date no medium for Xcc T3 effector secretion has been defined. Here, we compared four minimal media (MME, MMX, XVM2, and XOM2 which are reported for T3 expression induction in Xanthomonas spp. and found that MME is most efficient for expression and secretion of Xcc T3 effectors. By optimization of carbon and nitrogen sources and pH value based on MME, we established XCM1 medium, which is about 3 times stronger than MME for Xcc T3 effectors secretion. We further optimized the concentration of phosphate, calcium, and magnesium in XCM1 and found that XCM1 with a lower concentration of magnesium (renamed as XCM2 is about 10 times as efficient as XCM1 (meanwhile, about 30 times stronger than MME. Thus, we established an inducing medium XCM2 which is preferred for T3 effector secretion in Xcc.

Preparation, crystallization and preliminary X-ray characterization of a conserved hypothetical protein XC1692 from Xanthomonas campestris

International Nuclear Information System (INIS)

Chin, Ko-Hsin; Huang, Zhao-Wei; Wei, Kun-Chou; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Gao, Fei Philip; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho

2005-01-01

A conserved hypothetical protein XC1692 from X. campestris pv. campestris has been overexpressed in E. coli. The purified recombinant protein crystallized in a variety of forms and diffracted to a resolution of at least 1.45 Å. Xanthomonas campestris pv. campestris strain 17 is a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. Its genome contains approximately 4500 genes, one third of which have no known structure and/or function yet are highly conserved among several different bacterial genuses. One of these gene products is XC1692 protein, containing 141 amino acids. It was overexpressed in Escherichia coli, purified and crystallized in a variety of forms using the hanging-drop vapour-diffusion method. The crystals diffract to at least 1.45 Å resolution. They are hexagonal and belong to space group P6 3 , with unit-cell parameters a = b = 56.9, c = 71.0 Å. They contain one molecule per asymmetric unit

Sex-specific life history responses to nymphal diet quality and immune status in a field cricket.

Science.gov (United States)

Kelly, C D; Neyer, A A; Gress, B E

2014-02-01

Individual fitness is expected to benefit from earlier maturation at a larger body size and higher body condition. However, poor nutritional quality or high prevalence of disease make this difficult because individuals either cannot acquire sufficient resources or must divert resources to other fitness-related traits such as immunity. Under such conditions, individuals are expected to mature later at a smaller body size and in poorer body condition. Moreover, the juvenile environment can also produce longer-term effects on adult fitness by causing shifts in resource allocation strategies that could alter investment in immune function and affect adult lifespan. We manipulated diet quality and immune status of juvenile Texas field crickets, Gryllus texensis, to investigate how poor developmental conditions affect sex-specific investment in fitness-related traits. As predicted, a poor juvenile diet was related to smaller mass and body size at eclosion in both sexes. However, our results also reveal sexually dimorphic responses to different facets of the rearing environment: female life history decisions are affected more by diet quality, whereas males are affected more by immune status. We suggest that females respond to decreased nutritional income because this threatens their ability to achieve a large adult body size, whereas male fitness is more dependent on reaching adulthood and so they invest in immunity and survival to eclosion. © 2013 The Authors. Journal of Evolutionary Biology © 2013 European Society For Evolutionary Biology.

An Introductory Application of Principal Components to Cricket Data

Science.gov (United States)

Manage, Ananda B. W.; Scariano, Stephen M.

2013-01-01

Principal Component Analysis is widely used in applied multivariate data analysis, and this article shows how to motivate student interest in this topic using cricket sports data. Here, principal component analysis is successfully used to rank the cricket batsmen and bowlers who played in the 2012 Indian Premier League (IPL) competition. In…

Colonización radical por endófitos fúngicos en Trithrinax campestris (Arecaceae de ecosistemas semiáridos del centro de Argentina Root colonization by fungal endophytes in Trithrinax campestris (Arecaceae from semiarid ecosystems from Central Argentine

Directory of Open Access Journals (Sweden)

Mónica A Lugo

2011-12-01

Full Text Available En ecosistemas áridos y semiáridos las raíces de las plantas suelen formar simbiosis con hongos, los que les proporcionan nutrientes y agua. Poco se conoce sobre los hongos asociados a palmeras nativas y cómo éstos podrían estar relacionados entre ellos. Se describe y cuantifica la colonización radical de los simbiontes de Trithrinax campestris en poblaciones leve y fuertemente afectadas por el fuego. T. campestris fue colonizada por hongos micorrícico-arbusculares (HMA y endófitos septados oscuros (ESO. La colonización por HMA fue del tipo intermedio entre los tipos Arum y Paris. La colonización por HMA y ESO y la producción de pelos radicales, presentó diferencias entre las poblaciones estudiadas. Los resultados sugieren que en T. campestris la relación entre hongos simbiontes/producción de pelos radicales podrían estar relacionada con su alta tolerancia al fuego y la aridez.In arid and semiarid ecosystems, roots frequently form symbiosis with fungi that provides access to nutrients and water. Knowledge regarding the study of fungal symbionts colonizing native palms roots is still scarce. We described, quantified and compared fungal colonization in roots of Trithrinax campestris from two environmental situations: population with weak-burning-signs and population with strong-burning-signs. T. campestris was colonized by arbuscular-mycorrhizal-fungi (AMF and dark-septate-endophytes (DSE. AMF colonization was an intermediate type between Arum and Paris. The AMF and DSE colonization and root hair production differed between populations. Our results suggest that in T. campestris the relation between fungal-symbionts and root-hair-production might be related to tolerance to burning and aridity.

Production of inulinase by Xanthomonas campestris pv phaseoli using onion (Allium cepa) and garlic (Allium sativum) peels in solid state cultivation.

Science.gov (United States)

Ayyachamy, M; Khelawan, K; Pillay, D; Permaul, K; Singh, S

2007-10-01

To access inulinase production by Xanthomonas campestris pv phaseoli using the submerged and solid state cultivation (SSC) methods. Various carbon sources, inulin-rich solid substrates and pure synthetic inulin were tested for their efficiency in inulinase induction. The highest inulinase production (17.42 IU ml(-1)) in submerged cultures of X. campestris was observed with inulin as a carbon source with an initial pH, temperature and agitation of 7.0, 37 degrees C and 150 rev min(-1) respectively. Among the various substrates, garlic peels (117 IU gds(-1)) and onion peels (101 IU gds(-1)) were found to be the best for inulinase production. The inulinase production level of X. campestris was 6.7-fold higher in garlic and 5.8-fold in onion, under optimized SSC conditions compared with the submerged culture. This is the first report on inulinase production from garlic and onion peels by X. campestris using SSC. SSC is an efficient method for inulinase production by X. campestris for commercial applications.

Inbred decorated crickets exhibit higher measures of macroparasitic immunity than outbred individuals.

Science.gov (United States)

Gershman, S N; Barnett, C A; Pettinger, A M; Weddle, C B; Hunt, J; Sakaluk, S K

2010-09-01

Inbreeding is assumed to have negative effects on fitness, including the reduced ability to withstand immune challenges. We examined the immunological consequences of inbreeding in decorated crickets, Gryllodes sigillatus, by comparing lytic activity, phenoloxidase (PO) activity, and encapsulation ability of crickets from eight inbred lines with that of crickets from the outbred founder population. Surprisingly, crickets from inbred lines had a greater encapsulation ability compared with crickets from the outbred population. We suggest that because inbred crickets have reduced reproductive effort, they may, therefore, have the option of devoting more resources to this form of immunity than outbred individuals. We also found that both inbred and outbred females had higher immunity than males in PO activity and implant darkness. This result supports the hypothesis that females should devote more effort to somatic maintenance and immunity than males. PO activity and implant darkness were heritable in both males and females, but lytic activity was only heritable in females. Males and females differed in the heritability of, and genetic correlations among, immune traits, suggesting that differences in selective pressures on males and females may have resulted in a sexual conflict over optimal immune trait values.

The mental wellbeing of current and retired professional cricketers: an observational prospective cohort study.

Science.gov (United States)

Schuring, Nannet; Kerkhoffs, Gino; Gray, Janine; Gouttebarge, Vincent

2017-11-01

Scientific knowledge about symptoms of common mental disorders in professional cricket is non-existent. Consequently, the aims of the study were to determine the prevalence and the 6 months incidence of symptoms of common mental disorders (CMD: distress, anxiety/depression, sleep disturbance, adverse alcohol use) among current and former professional cricketers and to explore the association of potential stressors (significant injury, surgery, adverse life events, career dissatisfaction) and CMD. An observational prospective cohort study with a follow-up period of 6 months was conducted among current and former professional cricketers from South Africa. Using validated questionnaires to assess symptoms of common mental disorders as well as several stressors, an electronic questionnaire was set up and distributed by the South African Cricketers Association (SACA). A total of 116 participants enrolled at baseline (overall response rate of 33%) and 76 of those participants completed the 6 month follow-up (follow up rate of 66%). The prevalence of symptoms of CMD in current professional cricketers was 38% for distress, 38% for sleep disturbance, 37% for anxiety/depression and 26% for adverse alcohol use. Among former professional cricketers, baseline prevalence as was 26% for distress, 24% for anxiety/depression, 21% for sleep disturbance and 22% for adverse alcohol use. Career dissatisfaction led to an increased risk of distress, anxiety/depression and sleep disturbance in current professional cricketers. Surgeries and adverse life events led to an increase in reported symptoms of distress and anxiety/depression in current professional cricketers. It was concluded that symptoms of CMD are prevalent in both current and former professional cricketers and the association with surgery, adverse life events and cricket career dissatisfaction may provide some insight into possible mechanisms.

Carrot supplementation does not affect house cricket performance (Acheta domesticus)

NARCIS (Netherlands)

Veenenbos, M.E.; Oonincx, D.G.A.B.

2017-01-01

The demand for house crickets as a source of food or feed is increasing. Meeting this demand will require efficient production systems. House crickets are often fed a combination of dry feed and fresh plant material. Supplying fresh plant material could improve growth and development, but also

[Flavonoids of Artemisia campestris, ssp. glutinosa].

Science.gov (United States)

Hurabielle, M; Eberle, J; Paris, M

1982-10-01

Four flavanones (pinostrobin, pinocembrin, sakuranetin and naringenin), one dihydroflavonol (7-methyl aromadendrin) and one flavone (hispidulin) have been isolated from Artemisia campestris L. ssp. glutinosa Gay and identified by spectroscopic methods. Artemisia campestris L. sous-espèce glutinosa Gay est une Composée Anthémidée largement répandue sur les sables du littoral méditerranéean et abondante dans certaines régions d'Espagne et d'Italie. Dans le cadre d'une étude chimiotaxonomique du genre Artemisia Tourn., nous nous sommes intéressés à l'analyse des flavonoïdes, composés jamais décrits, à notre connaissance, dans cette espèce d' Artemisia. Les sommités fleuries d' Artemisia campestris sous-espèce glutinosa, séchées et pulvérisées, sont dégraissées à l'ether de pétrole et épuisées par le chloroforme. Le fractionnement de l'extrait chloroformique, par chromatographie sur colonne de silice, et la purification de certaines fractions conduisent à l'isolement de six génines flavoniques, à l'etat pur. L' étude des spectres UV, des spectres de masse et des spectres de RMN [1,2] et la comparaison avec des échantillons authentiques permettent de proposer, pour ces flavonoïdes, les structures de la pinostrobine [3], de la pinocembrine [4], de la sakuranétine, de la naringénine [5] (flavanones), de la méthyl-7-aromadendrine, [6, 7] (dihydroflavonol) et de l'hispiduline [8, 9] (flavone); quatre de ces génines sont méthylées. Parmi ces flavonoïdes, la pinostrobine n'a jamais été décrite, à notre connaissance, dans la famille des Composées; la pinocembrine, la sakuranétine et la naringénine ont déjà été signalées chez quelques Astéracées et Eupatoriées [10], et l'hispiduline dans la tribu des Anthémidées ( Santolina chamaecyparissus L.) [8]. Seule, la méthyl-7-aromadendrine semble décrite, à ce jour, dans le genre Artemisia Tourn. [7].

Sensitivity of the deep-sea amphipod Eurythenes gryllus to chemically dispersed oil.

Science.gov (United States)

Olsen, Gro Harlaug; Coquillé, Nathalie; Le Floch, Stephane; Geraudie, Perrine; Dussauze, Matthieu; Lemaire, Philippe; Camus, Lionel

2016-04-01

In the context of an oil spill accident and the following oil spill response, much attention is given to the use of dispersants. Dispersants are used to disperse an oil slick from the sea surface into the water column generating a cloud of dispersed oil droplets. The main consequence is an increasing of the sea water-oil interface which induces an increase of the oil biodegradation. Hence, the use of dispersants can be effective in preventing oiling of sensitive coastal environments. Also, in case of an oil blowout from the seabed, subsea injection of dispersants may offer some benefits compared to containment and recovery of the oil or in situ burning operation at the sea surface. However, biological effects of dispersed oil are poorly understood for deep-sea species. Most effects studies on dispersed oil and also other oil-related compounds have been focusing on more shallow water species. This is the first approach to assess the sensitivity of a macro-benthic deep-sea organism to dispersed oil. This paper describes a toxicity test which was performed on the macro-benthic deep-sea amphipod (Eurythenes gryllus) to determine the concentration causing lethality to 50% of test individuals (LC50) after an exposure to dispersed Brut Arabian Light (BAL) oil. The LC50 (24 h) was 101 and 24 mg L(-1) after 72 h and 12 mg L(-1) at 96 h. Based on EPA scale of toxicity categories to aquatic organisms, an LC50 (96 h) of 12 mg L(-1) indicates that the dispersed oil was slightly to moderately toxic to E. gryllus. As an attempt to compare our results to others, a literature study was performed. Due to limited amount of data available for dispersed oil and amphipods, information on other crustacean species and other oil-related compounds was also collected. Only one study on dispersed oil and amphipods was found, the LC50 value in this study was similar to the LC50 value of E. gryllus in our study. Since toxicity data are important input to risk assessment and net environmental

Temperature Effects on Cuscuta campestris Yunk. Seed Germination

Directory of Open Access Journals (Sweden)

Marija Sarić-Krsmanović

2013-01-01

Full Text Available Studies of biological characteristics of seeds and conditions for their germination havea major importance for planning and executing rational measures of weed control. Theaim of this study was to investigate the effect of different temperatures on germinationof C. campestris seeds. Three treatments (T1- storage at room temperature; T2 – exposureto 4°C for 30 days; T3 – scarification by concentrated sulphuric acid differing in manipulationwith seeds before germination were tested at different temperatures (5°C, 10°C, 15°C,20°C, 25°C, 30°C, 35°C, 40°C, 45°C. Germinated seeds were counted daily for ten days andthe length of seedlings was measured on the last day. The results showed that differencesin germination of C. campestris seeds were very prominent between temperatures, as wellas between treatments T1, T2 and T3. Seeds failed to germinate at 5°C and 45°C in all treatments(T1, T2, T3. Germination ranged from 6.25 at 10°C to 96.88%, the highest percentage,achieved at 30°C.

Strength and Power Correlates of Throwing Velocity on Subelite Male Cricket Players.

Science.gov (United States)

Freeston, Jonathan L; Carter, Thomas; Whitaker, Gary; Nicholls, Owen; Rooney, Kieron B

2016-06-01

Throwing velocity is an important aspect of fielding in cricket to affect run-outs and reduce the opponent's run-scoring opportunities. Although a relationship between strength and/or power and throwing velocity has been well established in baseball, water polo, and European handball, it has not been adequately explored in cricket. Consequently, this study aimed to determine the relationship between measures of strength and/or power and throwing velocity in cricket players. Seventeen male cricket players (mean ± SD; age, 21.1 ± 1.6 years; height, 1.79 ± 0.06 m; weight, 79.8 ± 6.4 kg) from an elite athlete program were tested for maximal throwing velocity from the stretch position and after a 3-meter shuffle. They were also assessed for strength and power using a range of different measures. Throwing velocity from the stretch position (30.5 ± 2.4 m·s) was significantly related to dominant leg lateral-to-medial jump (LMJ) distance (r = 0.71; p velocity and medicine ball chest pass (MB CP) distance (r = 0.67; p bench press strength (p = 0.90), height (p = 0.33), or weight (p = 0.29). Multiple regression analysis revealed that dominant MB Rot and MB CP explained 66% of the variance. The results were similar for velocity after a shuffle step (31.8 ± 2.1 m·s); however, VJ height reached statistical significance (r = 0.51; p ≤ 0.05). The multiple regression was also similar with MB Rot and MB CP explaining 70% of the variance. The cricketers in this study threw with greater velocity than elite junior and subelite senior cricketers but with lower velocities than elite senior cricketers and collegiate level and professional baseball players. This is the first study to demonstrate a link between strength and/or power and throwing velocity in cricket players and highlight the importance of power development as it relates to throwing velocity. Exercises that more closely simulated the speed (body weight jumps and medicine ball throws) or movement pattern (shoulder IR

Evaluation of possible head injuries ensuing a cricket ball impact.

Science.gov (United States)

Mohotti, Damith; Fernando, P L N; Zaghloul, Amir

2018-05-01

The aim of this research is to study the behaviour of a human head during the event of an impact of a cricket ball. While many recent incidents were reported in relation to head injuries caused by the impact of cricket balls, there is no clear information available in the published literature about the possible threat levels and the protection level of the current protective equipment. This research investigates the effects of an impact of a cricket ball on a human head and the level of protection offered by the existing standard cricket helmet. An experimental program was carried out to measure the localised pressure caused by the impact of standard cricket balls. The balls were directed at a speed of 110 km/h on a 3D printed head model, with and without a standard cricket helmet. Numerical simulations were carried out using advanced finite element package LS-DYNA to validate the experimental results. The experimental and numerical results showed approximately a 60% reduction in the pressure on the head model when the helmet was used. Both frontal and side impact resulted in head acceleration values in the range of 225-250 g at a ball speed of 110 km/h. There was a 36% reduction observed in the peak acceleration of the brain when wearing a helmet. Furthermore, numerical simulations showed a 67% reduction in the force on the skull and a 95% reduction in the skull internal energy when introducing the helmet. (1) Upon impact, high localised pressure could cause concussion for a player without helmet. (2) When a helmet was used, the acceleration of the brain observed in the numerical results was at non-critical levels according to existing standards. (3) A significant increase in the threat levels was observed for a player without helmet, based on force, pressure, acceleration and energy criteria, which resulted in recommending the compulsory use of the cricket helmet. (4) Numerical results showed a good correlation with experimental results and hence, the

Cricket inspired flow-sensor arrays

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Lammerink, Theodorus S.J.; Wiegerink, Remco J.; Casas, J.

2007-01-01

We report current developments in biomimetic flow-sensors based on mechanoreceptive sensory hairs of crickets. These filiform hairs are highly perceptive to lowfrequency sound with energy sensitivities close to thermal threshold. In this work we describe hair-sensors fabricated by a combination of

Preparation, crystallization and preliminary X-ray analysis of XC2382, an ApaG protein of unknown structure from Xanthomonas campestris

International Nuclear Information System (INIS)

Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho

2005-01-01

A putative ApaG gene product from X. campestris pv. campestris was overexpressed in E. coli, purified and crystallized. The crystals diffracted to a resolution of at least 2.3 Å. Xanthomonas campestris pv. campestris is the causative agent of black rot, one of the major worldwide diseases of cruciferous crops. Its genome encodes approximately 4500 proteins, roughly one third of which have unknown function. XC2382 is one such protein, with a MW of 14.2 kDa. Based on a bioinformatics study, it was annotated as an ApaG gene product that serves multiple functions. The ApaG protein has been overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method. The crystals diffracted to a resolution of at least 2.30 Å. They are tetragonal and belong to space group P4 1/3 , with unit-cell parameters a = b = 57.6, c = 122.9 Å. There are two, three or four molecules in the asymmetric unit

Inheritance of oilseed rape (Brassica napus) RAPD markers in a backcross progeny with Brassica campestris

DEFF Research Database (Denmark)

Mikkelsen, T.R.; Jensen, J.; Bagger Jørgensen, Rikke

1996-01-01

Different cultivars/transgenic lines of oilseed rape (Brassica napus) were crossed (as females) with different cultivars/populations of Brassica campestris. All cross combinations produced seed, with an average seed set per pollination of 9.8. Backcrossing of selected interspecific hybrids (as...... females) to B. campestris resulted in a much lower seed set, average 0.7 seed per pollination. In the single backcross progeny where a large enough population (92 plants) was obtained for analysis, 33 B. napus specific RAPD markers were investigated to determine the extent of transfer of oilseed rape...

Quantifying individual performance in Cricket — A network analysis of batsmen and bowlers

Science.gov (United States)

Mukherjee, Satyam

2014-01-01

Quantifying individual performance in the game of Cricket is critical for team selection in International matches. The number of runs scored by batsmen and wickets taken by bowlers serves as a natural way of quantifying the performance of a cricketer. Traditionally the batsmen and bowlers are rated on their batting or bowling average respectively. However, in a game like Cricket it is always important the manner in which one scores the runs or claims a wicket. Scoring runs against a strong bowling line-up or delivering a brilliant performance against a team with a strong batting line-up deserves more credit. A player’s average is not able to capture this aspect of the game. In this paper we present a refined method to quantify the ‘quality’ of runs scored by a batsman or wickets taken by a bowler. We explore the application of Social Network Analysis (SNA) to rate the players in a team performance. We generate a directed and weighted network of batsmen-bowlers using the player-vs-player information available for Test cricket and ODI cricket. Additionally we generate a network of batsmen and bowlers based on the dismissal record of batsmen in the history of cricket-Test (1877-2011) and ODI (1971-2011). Our results show that M. Muralitharan is the most successful bowler in the history of Cricket. Our approach could potentially be applied in domestic matches to judge a player’s performance which in turn paves the way for a balanced team selection for International matches.

Morphological and ontogenetic stratification of abyssal and hadal Eurythenes gryllus sensu lato (Amphipoda: Lysianassoidea) from the Peru-Chile Trench

Science.gov (United States)

Eustace, Ryan M.; Ritchie, Heather; Kilgallen, Niamh M.; Piertney, Stuart B.; Jamieson, Alan J.

2016-03-01

The globally ubiquitous lysianassoid amphipod, Eurythenes gryllus, has been shown to consist of multiple genetically distinct cryptic taxa, with depth considered a major driver of speciation and morphological divergence. Here we examine morphological variation of E. gryllus sensu lato through a continuous depth distribution that spans from abyssal (3000-6000 m) into hadal depths (>6000 m) in the Peru-Chile Trench (SE Pacific Ocean). Three distinct morphospecies were identified: one was confirmed as being E. magellanicus (4602-5329 m) based on DNA sequence and morphological similarity. The other two morphologically distinct species were named based upon depth of occurrence; Abyssal (4602-6173 m) and Hadal (6173-8074 m). The three Eurythenes morphospecies showed vertical ontogenetic stratification across their bathymetric range, where juveniles were found shallower in their depth range and mature females deeper. Potential ecological and evolutionary drivers that explain the observed patterns of intra and inter-specific structure, such as hydrostatic pressure and topographical isolation, are discussed.

EFFECTIVENESS OF SWISS BALL VS FLOOR EXERCISES ON CORE MUSCLE STRENGTH IN ELITE CRICKETERS

Directory of Open Access Journals (Sweden)

K. Sai sudha

2015-10-01

Full Text Available Background: Cricket is one of the most popular game in India played by men and women of all ages. The increased physical demands on the players may be associated with an increased risk of injuries. Core muscle strength is important to prevent risk of injuries in elite cricketers. The beginners in the cricket must have enough strength of core muscles, as core is the bridge between upper and lower limbs. So, it should be strong enough to prevent low back and lower limb injuries in cricketers. The aim is to determine the effectiveness of swiss ball exercises versus floor exercises on core muscle strength in elite cricketers. The objective is to study and compare the effectiveness of swiss ball exercises and floor exercises in elite cricketers in terms of back strength. Method: The total number of students in this study were 30 eilte cricketers between 16-25 years out of which 15 subjects were included each in floor exercise(n=15 and swiss ball group(n=15. Back strength was measured before and after the intervention of 6 weeks using isokinetic analyser. Results: After the analysis, the results revealed significant improvement of back strength in both the groups(p< 0.00. The swiss ball group showed significant results when compared with floor exercise group. Conclusion: Although the study showed beneficial results in both the groups, the results reflected that swiss ball group had better improvement of core muscle strength than the floor exercise group.

Forest litter crickets prefer higher substrate moisture for oviposition: Evidence from field and lab experiments.

Science.gov (United States)

de Farias-Martins, Fernando; Sperber, Carlos Frankl; Albeny-Simões, Daniel; Breaux, Jennifer Ann; Fianco, Marcos; Szinwelski, Neucir

2017-01-01

For insects, choosing a favorable oviposition site is a type of parental care, as far as it increases the fitness of its offspring. Niche theory predicts that crickets should show a bell-shaped oviposition response to substrate moisture. However, lab experiments with mole crickets showed a linear oviposition response to substrate moisture. Studies with the house cricket Acheta domesticus also showed a linear juvenile body growth response to water availability, thus adult ovipositing females should respond positively to substrate moisture. We used a field experiment to evaluate the relationship between oviposition preference and substrate moisture in forest litter-dwelling cricket species. We also evaluated oviposition responses to substrate moisture level in Ubiquepuella telytokous, the most abundant litter cricket species in our study area, using a laboratory study. We offered cotton substrate for oviposition which varied in substrate moisture level from zero (i.e., dry) to maximum water absorption capacity. We used two complementary metrics to evaluate oviposition preference: (i) presence or absence of eggs in each sampling unit as binary response variable, and (ii) number of eggs oviposited per sampling unit as count response variable. To test for non-linear responses, we adjusted generalized additive models (GAMM) with mixed effects. We found that both cricket oviposition probability and effort (i.e., number of eggs laid) increased linearly with substrate moisture in the field experiment, and for U. telytokous in the lab experiment. We discarded any non-linear responses. Our results demonstrate the importance of substrate moisture as an ecological niche dimension for litter crickets. This work bolsters knowledge of litter cricket life history association with moisture, and suggests that litter crickets may be particularly threatened by changes in climate that favor habitat drying.

Reliefs the Exposure Stress of Soils Arsenic on Brassica campestris L. Growth and Its Possible Mechanisms by Inoculation of Trichoderma asperellum SM-12F1

Directory of Open Access Journals (Sweden)

ZHANG Hong-xiang

2018-02-01

Full Text Available The over-accumulation of arsenic(Asin agricultural soils affects crop growth. Subsequently, the accumulated As can pose risk to human health via food-chain. It is urgent to develop technologies to relief the As exposure stress on crop growth and lower the As uptake by crop. In this study, Trichoderma asperellum SM -12F1, capable of As resistance and speciation transformation was used as experimental material. Pot experiments were conducted to investigate the effects of inoculation on the growth of Brassica campestris L. in As-contaminated soils. The possible mechanisms of inoculation relieving As exposure stress and lowering As uptake were revealed. The results indicated that the growth of Brassica campestris L. was significantly inhibited in soils spiked with As of 120 mg· kg-1. Inoculation could significantly improve the growth of Brassica campestris L. and significantly decreased the As uptake and bioconcentration factor(BCFof Brassica campestris L. Compared with As-contaminated soils without inoculation, the As contents in the over-and under-ground part of Brassica campestris L. declined by 12.4% and 20.2%, respectively, and the BCF declined by 7.8%. Soil available As contents decreased by 15.7% after inoculation. Methylarsonic acid(MMAand dimethylarsinic acid(DMAwere detected in water extraction of soil and the shoot of Brassica campestris L. tissues, which indicated that inoculation could trigger soil As methylation and decrease soil As availability and toxicity. Furthermore, inoculation could effectively relief the As exposure stress on Brassica campestris L. growth by the response of antioxidant enzymes. The enzymes in Brassica campestris L. such as superoxide dismutase(SODand catalase(CAT, and the contents of glutathione(GSH, ascorbic acid(AsAand malondialdehyde(MDA, capable of reactive oxygen elimination, significantly enhanced during soil As exposure. However, inoculation lessened the activities or contents of SOD, CAT, GSH, and MDA

A History of English Women’s Cricket, 1880-1939

OpenAIRE

Threlfall-Sykes, Judy

2015-01-01

This thesis is a study of the history of women’s cricket from the 1880s until 1939. Although the primary focus of this thesis is the interwar years, it explores the earliest forms of women’s cricket to provide context for the motivation of individuals to promote the game as acceptable for women, and of those who denounced its suitability. By exploring societal concerns over correct masculine and feminine behaviour and ideals, this thesis provides insight into the methods that contemporaries a...

Sex differences in metabolic rates in field crickets and their dipteran parasitoids.

Science.gov (United States)

Kolluru, G R; Chappell, M A; Zuk, M

2004-11-01

Sex differences in metabolic rate (MR) can result from dimorphism in the performance of energetically demanding activities. Male crickets (Teleogryllus oceanicus) engage in costly calling and aggressive activity not performed by females. Consistent with this difference, we found higher maximal MR, factorial scope, and fat content in males than females. T. oceanicus song is also costly because it attracts the parasitoid fly Ormia ochracea. Parasitized crickets had reduced maximal MR consistent with a metabolic cost to harboring larvae. This cost was greater for females, either because females invest more heavily into reproduction at the expense of metabolic capacity, or because males are under stronger selection to respond to infection. Little is known about O. ochracea outside of its auditory system and parasitic lifestyle. We observed greater resting MR in male flies, possibly reflecting a sex difference in the requirement for metabolic power output, because male flies perform potentially costly mating behavior not seen in females. We found a positive relationship between larval density within a cricket and pupal resting MR, suggesting that crickets in good condition are able to both harbor more larvae and produce larvae with higher resting MR. These results reveal a complex interplay between the metabolism of crickets and their fly parasitoids.

Artificial sensory hairs based on the flow sensitive receptor hairs of crickets

NARCIS (Netherlands)

Dijkstra, Marcel; van Baar, J.J.J.; Wiegerink, Remco J.; Lammerink, Theodorus S.J.; de Boer, J.H.; Krijnen, Gijsbertus J.M.

2005-01-01

This paper presents the modelling, design, fabrication and characterization of flow sensors based on the wind-receptor hairs of crickets. Cricket sensory hairs are highly sensitive to drag-forces exerted on the hair shaft. Artificial sensory hairs have been realized in SU-8 on suspended SixNy

Genome-Wide Identification, Molecular Evolution, and Expression Profiling Analysis of Pectin Methylesterase Inhibitor Genes in Brassica campestris ssp. chinensis

Directory of Open Access Journals (Sweden)

Tingting Liu

2018-05-01

Full Text Available Pectin methylesterase inhibitor genes (PMEIs are a large multigene family and play crucial roles in cell wall modifications in plant growth and development. Here, a comprehensive analysis of the PMEI gene family in Brassica campestris, an important leaf vegetable, was performed. We identified 100 Brassica campestris PMEI genes (BcPMEIs, among which 96 BcPMEIs were unevenly distributed on 10 chromosomes and nine tandem arrays containing 20 BcPMEIs were found. We also detected 80 pairs of syntenic PMEI orthologs. These findings indicated that whole-genome triplication (WGT and tandem duplication (TD were the main mechanisms accounting for the current number of BcPMEIs. In evolution, BcPMEIs were retained preferentially and biasedly, consistent with the gene balance hypothesis and two-step theory, respectively. The molecular evolution analysis of BcPMEIs manifested that they evolved through purifying selection and the divergence time is in accordance with the WGT data of B. campestris. To obtain the functional information of BcPMEIs, the expression patterns in five tissues and the cis-elements distributed in promoter regions were investigated. This work can provide a better understanding of the molecular evolution and biological function of PMEIs in B. campestris.

Convergent and divergent patterns of morphological differentiation provide more evidence for reproductive character displacement in a wood cricket Gryllus fultoni (Orthoptera: Gryllidae

Directory of Open Access Journals (Sweden)

Choe Jae

2009-02-01

Full Text Available Abstract Background In ecological character displacement, traits involved in reproductive isolation may not evolve in arbitrary directions when changes in these traits are by-products of adaptation to an ecological niche. In reproductive character displacement, however, selection acts directly on reproductive characters to enhance the degree of reproductive isolation between sympatric populations. Thus, the direction of change in reproductive characters may be arbitrary in relation to changes in other morphological characters. We characterized both tegminal characters and characters indicative of body size in sympatric and allopatric populations of Gryllus fultoni, a species displaying character displacement in its calling song characters in areas of sympatry with G. vernalis populations, to infer the nature and direction of selection acting on reproductive and morphological characters in sympatry. Results Except for mirror area, the number of teeth in a file, and ovipositor length of G. fultoni, all male and female morphological characters in G. fultoni and G. vernalis exhibited a uniform tendency to decrease in size with increasing latitude. There was no significant variation in female morphological characters between sympatric and allopatric G. fultoni populations. However, males of sympatric and allopatric G. fultoni populations significantly differed in head width, hind femur length, and mirror area even after controlling for clinal factors. Head width and hind femur length of G. fultoni were more similar to those of G. vernalis in sympatric populations than in allopatric populations, resulting in morphological convergence of G. fultoni and G. vernalis in sympatry. However, the mirror area of G. fultoni displayed the divergent pattern in relation to the sympatric G. vernalis populations. Conclusion Divergence-enhancing selection may be acting on mirror area as well as calling song characters, whereas local adaptation or clinal effects may

The effects of mental fatigue on cricket-relevant performance among elite players.

Science.gov (United States)

Veness, Darren; Patterson, Stephen David; Jeffries, Owen; Waldron, Mark

2017-12-01

This study investigated the effects of a mentally fatiguing test on physical tasks among elite cricketers. In a cross-over design, 10 elite male cricket players from a professional club performed a cricket run-two test, a Batak Lite reaction time test and a Yo-Yo-Intermittent Recovery Level 1 (Yo-Yo-IR1) test, providing a rating of perceived exertion (RPE) after completing a 30-min Stroop test (mental fatigue condition) or 30-min control condition. Perceived fatigue was assessed before and after the two conditions and motivation was measured before testing. There were post-treatment differences in the perception of mental fatigue (P performance.

Effects of Forest Regeneration on Crickets: Evaluating Environmental Drivers in a 300-Year Chronosequence

Directory of Open Access Journals (Sweden)

Neucir Szinwelski

2012-01-01

Full Text Available We evaluated the relation of cricket species richness and composition with forest regeneration time, evaluating canopy and litter depth as environmental drivers. Effects of forest patch area, nearest distance to the 300-year patch, cricket abundance, sampling sufficiency, and nestedness were also evaluated. We collected 1174 individuals (five families, 19 species. Species richness increased asymptotically with regeneration time and linearly with canopy cover and litter depth. Canopy cover increased linearly, while litter depth increased asymptotically. Richness was not affected by patch area and nearest distance to the 300-year patch. Richness increased with cricket abundance, and this explanation could not be distinguished from regeneration time, evidencing collinearity of these two explanatory variables. Rarefaction curve slopes increased with regeneration time. Species composition differed among patches, with no nested pattern. We suggest that regeneration and consequent increases in canopy and litter promote recovery of cricket biodiversity, abundance, and changes in species composition. We conclude that the recovery of cricket diversity involves an increase along the spatial scale of complementarity, together with a change in species composition.

Common attributes in retired professional cricketers that may enhance or hinder quality of life after retirement: a qualitative study.

Science.gov (United States)

Filbay, Stephanie R; Bishop, Felicity; Peirce, Nicholas; Jones, Mary E; Arden, Nigel K

2017-07-26

Retired professional cricketers shared unique experiences and may possess specific psychological attributes with potential to influence quality of life (QOL). Additionally, pain and osteoarthritis can be common in retired athletes which may negatively impact QOL. However, QOL in retired athletes is poorly understood. This study explores the following questions from the personal perspective of retired cricketers: How do retired cricketers perceive and experience musculoskeletal pain and function in daily life? Are there any psychological attributes that might enhance or hinder retired cricketers' QOL? A qualitative study using semistructured interviews, which were subject to inductive, thematic analysis. A data-driven, iterative approach to data coding was employed. All participants had lived and played professional cricket in the UK and were living in the UK or abroad at the time of interview. Eighteen male participants, aged a mean 57±11 (range 34-77) years had played professional cricket for a mean 12±7 seasons and had been retired from professional cricket on average 23±9 years. Fifteen participants reported pain or joint difficulties and all but one was satisfied with their QOL. Most retired cricketers reflected on experiences during their cricket career that may be associated with the psychological attributes that these individuals shared, including resilience and a positive attitude. Additional attributes included a high sense of body awareness, an ability to self-manage pain and adapt lifestyle choices to accommodate physical limitations. Participants felt fortunate and proud to have played professional cricket, which may have further contributed to the high QOL in this group of retired cricketers. Most retired cricketers in this study were living with pain or joint difficulties. Despite this, all but one was satisfied or very satisfied with their QOL. This may be partly explained by the positive psychological attributes that these retired cricketers

Cricket farming as a livelihood strategy in Thailand

DEFF Research Database (Denmark)

Halloran, Afton Marina Szasz; Roos, Nanna; Hanboonsong, Yupa

2017-01-01

While many important aspects of wild and farmed insects have been discussed by scholars, such as nutritional value, conservation and farming techniques, no study has addressed how insect farming contributes to rural livelihoods. Furthermore, the roles that interactions between insect farmers......, their peers and institutions play in insect farming as a livelihood strategy are even less well understood. This paper presents a preliminary assessment of cricket farming as a livelihood strategy in Thailand. Fortynine cricket farmers participated in in-depth interviews designed to gain insight into how...... capital. As such, further empirical data and case study analyses are needed in order to advance our understanding of this particular livelihood strategy....

Two steps to suicide in crickets harbouring hairworms

DEFF Research Database (Denmark)

Sanchez, M.I.; Ponton, F.; Schmidt-Rhaesa, A.

2008-01-01

predicted that hairworms should adaptively manipulate host behaviour to maximize parasite reproductive success. Our results supported the hypothesis that the host manipulation strategy of hairworms consists of at least two distinct steps, first the induction of erratic behaviour and then suicidal behaviour...... per se. Hairworms secured mating by starting to manipulate their host before being fully mature. Once induced, the cricket's suicidal behaviour was maintained until the host found water but the fecundity of worms decreased over time. As expected, the fecundity of worms was better in crickets...... with suicidal rather than erratic behaviour. (C) 2008 The Association for the Study of Animal Behaviour. Published by Elsevier Ltd. All rights reserved...

The Host Plant Metabolite Glucose Is the Precursor of Diffusible Signal Factor (DSF) Family Signals in Xanthomonas campestris

OpenAIRE

Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui

2015-01-01

Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous ad...

Identification of genes differentially expressed in Mikania micrantha during Cuscuta campestris infection by suppression subtractive hybridization.

Science.gov (United States)

Li, Dong-Mei; Staehelin, Christian; Zhang, Yi-Shun; Peng, Shao-Lin

2009-09-01

The influence of Cuscuta campestris on its host Mikania micrantha has been studied with respect to biomass accumulation, physiology and ecology. Molecular events of this parasitic plant-plant interaction are poorly understood, however. In this study, we identified novel genes from M. micrantha induced by C. campestris infection. Genes expressed upon parasitization by C. campestris at early post-penetration stages were investigated by construction and characterization of subtracted cDNA libraries from shoots and stems of M. micrantha. Three hundred and three presumably up-regulated expressed sequence tags (ESTs) were identified and classified in functional categories, such as "metabolism", "cell defence and stress", "transcription factor", "signal transduction", "transportation" and "photosynthesis". In shoots and stems of infected M. micrantha, genes associated with defence responses and cell wall modifications were induced, confirming similar data from other parasitic plant-plant interactions. However, gene expression profiles in infected shoots and stems were found to be different. Compared to infected shoots, more genes induced in response to biotic and abiotic stress factors were identified in infected stems. Furthermore, database comparisons revealed a notable number of M. micrantha ESTs that matched genes with unknown function. Expression analysis by quantitative real-time RT-PCR of 21 genes (from different functional categories) showed significantly increased levels for 13 transcripts in response to C. campestris infection. In conclusion, this study provides an overview of genes from parasitized M. micrantha at early post-penetration stages. The acquired data form the basis for a molecular understanding of host reactions in response to parasitic plants.

Physiologic profile of professional cricketers.

Science.gov (United States)

Johnstone, James A; Ford, Paul A

2010-11-01

This study aims to provide a physiologic profile of professional cricketers and note positional differences at the start of the 2007/08 competitive season. Fifteen participants (9 bowlers, 6 batsmen) aged 25.0 ± 5.0 years (mean ± SD) took part in this study. Participants (bowlers and batsmen) completed a series of field-based fitness assessments: body composition (sum of 7 skinfolds, 72.5 ± 16.5 and 65.5 ± 19.3 mm, respectively), flexibility (sit and reach 8.1 ± 10.3 and 6.0 ± 6.2 cm, respectively), predicted maximal oxygen uptake (multistage shuttle run, 54.1 ± 2.8 and 56.1 ± 4.5 ml-1·kg-1·min-1, respectively), upper- (medicine ball throw, 7.7 ± 0.6 and 7.0 ± 0.1 m, respectively) and lower-body strength (countermovement jump, 45.7 ± 5.8 and 43.9 ± 4.1 cm, respectively), speed (sprint 17.7 m, 2.76 ± 0.6 and 2.77 ± 0.1 s, respectively), and explosive power (repeated jump, 31.0 ± 2.0 and 34.1 ± 4.8 cm, respectively). The data provided the physical fitness profile for each player, which, compared with normative data, identified that this cohort of professional cricketers had some superior fitness parameters compared with the general population, and where applicable, were comparable with other professional athletes. In addition, after effect size calculations, the results showed that some physical fitness differences existed between playing positions. Cricket professionals possess a superior level of physical fitness and strength, and conditioning coaches should seek to progress these physical parameters and further identify position-specific physical requirements to progress the modern game.

Selection of the all-time best World XI Test cricket team using the TOPSIS method

Directory of Open Access Journals (Sweden)

Shankar Chakraborty

2019-01-01

Full Text Available The aim of this paper is to apply the technique for order preference by similarity to ideal solution (TOPSIS as a multi-criteria decision making tool to form the all-time best World XI Test cricket team while taking into consideration over 2600 cricketers participated in Test matches for more than 100 years of cricket history. From the voluminous database containing the performance of numerous Test cricketers, separate lists are first prepared for different positions in the batting and bowling orders consisting of manageable numbers of candidate alternatives while imposing some constraints with respect to the minimum number of innings played (for batsmen, minimum number of tests played (for wicketkeepers and bowlers, and minimum numbers of runs scored and wickets taken (for all-rounders. The TOPSIS method is later adopted to rank those shortlisted cricketers and identify the best performers for inclusion in the proposed World XI Test team. The best World Test cricket team is thus formed as Alastair Cook (ENG (c, Sunil Gavaskar (IND, Rahul Dravid (IND (vc, Sachin Tendulkar (IND, Shivnarine Chanderpaul (WI, Jacques Kallis (SA, Adam Gilchrist (AUS (wk, Glenn McGrath (AUS, Courtney Walsh (WI, Muttiah Muralitharan (SL and Shane Warne (AUS.

Injury in elite New Zealand cricketers 2002-2008: descriptive epidemiology.

Science.gov (United States)

Frost, Warren Leonard; Chalmers, David John

2014-06-01

To describe the incidence, prevalence, nature and severity of injury to elite New Zealand cricketers for the 2002/2003 to 2007/2008 seasons. Prospective cohort. Elite cricket in New Zealand. 248 elite male cricketers. Incidence and prevalence rates. The overall match injury incidence rate for the international competition (51.6 injuries per 10 000 player-hours; 95% CI 40.1 to 65.3) was almost twice that of the domestic competition (27.2; 23.5 to 31.4). The prevalence rate for the international competition (12%; 11.3% to 12.8%) was significantly higher than that for the domestic competition (9.7%; 9.4% to 10.1%). Overall, 79.5% of injuries occurred in matches and 48.7% of all injuries were sustained while bowling. The lower limb was the body region most commonly injured (43.5%), the most common specific diagnosis was hamstring strains/tears (11.1%) and the injuries contributing the highest proportion of match days lost were stress fractures to the low back (22%). The findings of this study support ongoing injury surveillance in New Zealand and other test cricket playing nations for the purpose of describing injury and monitoring the effect of interventions over time. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

Sexually transmitted parasites and host mating behavior in the decorated cricket

OpenAIRE

Lien T. Luong; Harry K. Kaya

2005-01-01

Sexually transmitted diseases play a potentially important role in the ecology and evolution of host mating behavior. Here, we use a sexually transmitted nematode-cricket (Mehdinema alii--Gryllodes sigillatus) system to examine the effects of parasitism on host mating activity and female choice. Previous work has shown that infected male crickets produce a significantly smaller nuptial gift (spermatophylax) than uninfected males. This is expected to result in reduced spermatophylax feeding du...

Prevalence of cricket-related musculoskeletal pain among ...

African Journals Online (AJOL)

Cricket is a dynamic sport that involves many abstract skills and movements. ..... bowlers, fielders and wicket-keepers) and the different types of injuries sustained. An injury .... Gender: Male. Female. Race: ... Shoulder external rotation. Cubitus ...

Helping enhances productivity in campo flicker ( Colaptes campestris) cooperative groups

Science.gov (United States)

Dias, Raphael Igor; Webster, Michael S.; Macedo, Regina H.

2015-06-01

Reproductive adults in many bird species are assisted by non-breeding auxiliary helpers at the nest, yet the impact of auxiliaries on reproduction is variable and not always obvious. In this study, we tested Hamilton's rule and evaluated the effect of auxiliaries on productivity in the facultative cooperative breeder campo flicker ( Colaptes campestris campestris). Campo flickers have a variable mating system, with some groups having auxiliaries and others lacking them (i.e., unassisted pairs). Most auxiliaries are closely related to the breeding pair (primary auxiliaries), but some auxiliaries (secondary auxiliaries) are unrelated females that joined established groups. We found no effect of breeder quality (body condition) or territory quality (food availability) on group productivity, but the presence of auxiliaries increased the number of fledglings produced relative to unassisted pairs. Nonetheless, the indirect benefit of helping was small and did not outweigh the costs of delayed breeding and so seemed insufficient to explain the evolution of cooperative breeding in campo flickers. We concluded that some ecological constraints must limit dispersal or independent breeding, making staying in the group a "best-of-a-bad-job" situation for auxiliaries.

Protein deficiency lowers resistance of Mormon crickets to the pathogenic fungus Beauveria bassiana.

Science.gov (United States)

Srygley, R B; Jaronski, S T

Little is known about the effects of dietary macronutrients on the capacity of insects to ward off a fungal pathogen. Here we tested the hypothesis that Mormon crickets fed restricted protein diets have lower enzymatic assays of generalized immunity, slower rates of encapsulation of foreign bodies, and greater mortality from infection by Beauveria bassiana, a fungal pathogen. Beginning in the last nymphal instar, Mormon crickets were fed a high, intermediate, or low protein diet with correspondingly low, intermediate, or high carbohydrate proportions. After they eclosed to adult, we drew hemolymph, topically applied B. bassiana, maintained them on diet treatments, and measured mortality for 21 days. Mormon crickets fed high protein diets had higher prophenoloxidase titers, greater encapsulation response, and higher survivorship to Beauveria fungal infection than those on low protein diets. We replicated the study adding very high and very low protein diets to the treatments. A high protein diet increased phenoloxidase titers, and those fed the very high protein diet had more circulating prophenoloxidase. Mormon crickets fed the very low protein diet were the most susceptible to B. bassiana infection, but the more concentrated phenoloxidase and prophenoloxidase associated with the highest protein diets did not confer the greatest protection from the fungal pathogen as in the first replicate. We conclude that protein-restricted diets caused Mormon crickets to have lower phenoloxidase titers, slower encapsulation of foreign bodies, and greater mortality from B. bassiana infection than those fed high protein diets. These results support the nutrition-based dichotomy of migrating Mormon crickets, protein-deficient ones are more susceptible to pathogenic fungi whereas carbohydrate-deficient ones are more vulnerable to bacterial challenge. Published by Elsevier Ltd.

"A man's game": cricket, war and masculinity, South Africa, 1899-1902.

Science.gov (United States)

Allen, Dean

2011-01-01

As practitioners of the imperial sport of the Victorian age, cricketers rallied whenever war descended upon England and its colonies. The South African War of 1899-1902 was no different. Adding to existing work on cricket's imperial development within South Africa, this study marks a significant contribution to research on the link between masculinity, war and sport during the Victorian era. A concept emerging from the English public schools of the mid- to late nineteenth century, the masculine ethos of sport and military honour had reached colonial South Africa by the outbreak of war in 1899. In its analysis of cricket and masculinity, this essay examines the events surrounding the war in South Africa and provides an example of the distinct relationship that existed between the military and the masculinity of sport and its organisation during this era.

Biological Functions of ilvC in Branched-Chain Fatty Acid Synthesis and Diffusible Signal Factor Family Production in Xanthomonas campestris

OpenAIRE

Kai-Huai Li; Yong-Hong Yu; Hui-Juan Dong; Wen-Bin Zhang; Jin-Cheng Ma; Hai-Hong Wang

2017-01-01

In bacteria, the metabolism of branched-chain amino acids (BCAAs) is tightly associated with branched-chain fatty acids (BCFAs) synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc) genome. We characte...

An explorative study of the practice of light trapping and the informal market for crickets in Cambodia

DEFF Research Database (Denmark)

Münke-Svendsen, C.; Ao, V.; Lach, T.

2018-01-01

was to describe the informal food sector for wild caught crickets in Cambodia. The information was collected in April-May 2012. Information on collection equipment and techniques, processing and trade were obtained from light trap owners, traders, market vendors and governmental representatives. Five cricket......Edible insects are an integrated part of the food sector in many South-East Asian countries. While the majority of studies focus on Thailand and its cricket farming sector, neighbouring countries like Cambodia and Laos also form a regional market for edible insects. The aim of this research...... species were identified to be the main trade object. Cricket trapping contributed to livelihoods of rural households operating in a self-governing market. As the crickets are caught from the wild, the sustainability of the market has to be questioned. The use of a framework to structure future studies...

The role of visual skills and its impact on skill performance of cricket ...

African Journals Online (AJOL)

The aim of this study was to determine the role and the impact of a visual skills training programme on the skills performance of cricket players, and whether visual training programmes are beneficial to competitive sports performance. Highly skilled cricket players (n=13) who were actively participating at a provincial level of ...

The effect of cold acclimation on active ion transport in cricket ionoregulatory tissues

Czech Academy of Sciences Publication Activity Database

Des Marteaux, Lauren E.; Khazraeenia, S.; Yerushalmi, G. Y.; Donini, A.; Li, N. G.; Sinclair, B. J.

2018-01-01

Roč. 216, FEB 01 (2018), s. 28-33 ISSN 1095-6433 Institutional support: RVO:60077344 Keywords : insect * Gryllus * malpighian tubules Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.812, year: 2016 https://www.sciencedirect.com/science/article/pii/S1095643317302519?via%3Dihub

Effect of House Cricket (Acheta domesticus) Flour Addition on Physicochemical and Textural Properties of Meat Emulsion Under Various Formulations.

Science.gov (United States)

Kim, Hyun-Wook; Setyabrata, Derico; Lee, YongJae; Jones, Owen G; Kim, Yuan H Brad

2017-12-01

The objective of this study was to determine the effect of house cricket (Acheta domesticus) flour addition on physicochemical and textural properties of meat emulsion under various formulations. As an initial marker of functionality, protein solubility, water absorption, emulsifying capacity, and gel formation ability of house cricket flour were determined at pH (2 to 10) and NaCl concentrations (0 to 2.10 M). Control emulsion was formulated with 60% lean pork, 20% back fat, and 20% ice. Six treatment emulsions were prepared with replacement of lean pork and/or back fat portions with spray-dried house cricket flour at 5% and 10% levels, based on a total sample weight. The protein solubility of house cricket flour (67 g protein/100 g) was significantly altered depending upon pH (P house cricket flour were found between 0 and 2.10 M NaCl concentration (P > 0.05). The replacement of lean meat/fat portion with house cricket flour within 10% level could fortify protein and some micronutrients (phosphorus, potassium, and magnesium) in meat emulsion, without negative impacts on cooking yield and textural properties. Our results suggest that house cricket flour can be used as an effective nonmeat functional ingredient to manufacture emulsified meat products. To better utilize house cricket flour as a food ingredient in wide application, understanding its technological properties in various pH, and ionic strength conditions is a pivotal step. Protein solubility of house cricket flour would be considerably affected by the varying pH and NaCl concentrations of applied conventional foods. In the case of meat emulsion, within 10% lean meat and/or fat portions could be successfully substituted with house cricket flour without detectable adverse impacts on technological properties associated with cooking yield and instrumental analysis of texture. Thus, our findings suggest that house cricket flour possess the necessary physical properties to be used as an alternative nonmeat

Acceleration Kinematics in Cricketers: Implications for Performance in the Field

Directory of Open Access Journals (Sweden)

G. Lockie Robert

2014-03-01

Full Text Available Cricket fielding often involves maximal acceleration to retrieve the ball. There has been no analysis of acceleration specific to cricketers, or for players who field primarily in the infield (closer to the pitch or outfield (closer to the boundary. This study analyzed the first two steps of a 10-m sprint in experienced cricketers. Eighteen males (age = 24.06 ± 4.87 years; height = 1.81 ± 0.06 m; mass = 79.67 ± 10.37 kg were defined as primarily infielders (n = 10 or outfielders (n = 8. Timing lights recorded 0-5 and 0-10 m time. Motion capture measured first and second step kinematics, including: step length; step frequency; contact time; shoulder motion; lead and rear arm elbow angle; drive leg hip and knee extension, and ankle plantar flexion; swing leg hip and knee flexion, and ankle dorsi flexion. A one-way analysis of variance (p < 0.05 determined between-group differences. Data was pooled for a Pearson’s correlation analysis (p < 0.05 to analyze kinematic relationships. There were no differences in sprint times, and few variables differentiated infielders and outfielders. Left shoulder range of motion related to second step length (r = 0.471. First step hip flexion correlated with both step lengths (r = 0.570-0.598, and frequencies (r = -0.504--0.606. First step knee flexion related to both step lengths (r = 0.528-0.682, and first step frequency (r = -0.669. First step ankle plantar flexion correlated with second step length (r = -0.692 and frequency (r = 0.726. Greater joint motion ranges related to longer steps. Cricketers display similar sprint kinematics regardless of fielding position, likely because players may field in the infield or outfield depending on match situation. Due to relationships with shoulder and leg motion, and the importance and trainability of step length, cricketers should target this variable to enhance acceleration.

Imitating cricket mechanosensory hairs: dream or reality?

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Casas, Jerome

2008-01-01

MEMS offers exciting possibilities for bio-inspired mechanosensors. Over the last years we have been working on cricket inspired hair-sensors for flow observations. In stimulating interactions within EU consortia important insights have surfaced and MEMS sensors with demonstrated acoustic

Biomimetic flow-sensor arrays based on the filiform hairs on the cerci of crickets

NARCIS (Netherlands)

Wiegerink, Remco J.; Floris, J.; Jaganatharaja, R.K.; Izadi, N.; Lammerink, Theodorus S.J.; Krijnen, Gijsbertus J.M.

2007-01-01

In this paper we report on the latest developments in biomimetic flow-sensors based on the flow sensitive mechano-sensors of crickets. Crickets have one form of acoustic sensing evolved in the form of mechanoreceptive sensory hairs. These filiform hairs are highly perceptive to low-frequency sound

A proteomic analysis of seed development in Brassica campestri L.

Directory of Open Access Journals (Sweden)

Wenlan Li

Full Text Available To gain insights into the protein dynamics during seed development, a proteomic study on the developing Brassica campestri L. seeds with embryos in different embryogenesis stages was carried out. The seed proteins at 10, 16, 20, 25 and 35 DAP (days after pollination, respectively, were separated using two-dimensional gel electrophoresis and identities of 209 spots with altered abundance were determined by matrix-assisted laser desorption ionization time-of-flight/time-of-flight mass spectrometry (MALDI-TOF/TOF MS. These proteins were classified into 16 groups according to their functions. The most abundant proteins were related to primary metabolism, indicating the heavy demand of materials for rapid embryo growth. Besides, the high amount of proteins involved in protein processing and destination indicated importance of protein renewal during seed development. The remaining were those participated in oxidation/detoxification, energy, defense, transcription, protein synthesis, transporter, cell structure, signal transduction, secondary metabolism, transposition, DNA repair, storage and so on. Protein abundance profiles of each functional class were generated and hierarchical cluster analysis established 8 groups of dynamic patterns. Our results revealed novel characters of protein dynamics in seed development in Brassica campestri L. and provided valuable information about the complex process of seed development in plants.

Management of pest mole crickets in Florida and Puerto Rico with a nematode and parasitic wasp

International Nuclear Information System (INIS)

Leppla, N.C.; Frank, J.H.; Adjei, M.B.; Vicente, N.E.

2007-01-01

Non-indigenous invasive mole crickets, Scapteriscus vicinus Scudder (Orthoptera: Gryllotalpidae) in Florida and S. didactylus (Latreille) (the 'changa') in Puerto Rico, are being managed with an entomopathogenic nematode, Steinernema scapterisci (Nguyen and Smart) (Rhabditida: Steinernematidae), and a parasitic wasp, Larra bicolor L. (Hymenoptera: Sphecidae). Pest mole cricket populations have declined by 95% in north central Florida since these specialist natural enemies were released and established in the 1980s. Commercial production of the nematode was initiated, nearly 70 billion were applied in 34 Florida counties, and their establishment, spread, and impact on mole crickets were monitored. The infected mole crickets dispersed the nematode rapidly, so that within 6 months these parasites were present in most of the insects trapped in experimental pastures. Three years later, mole cricket populations were reduced to acceptable levels and the bahiagrass had recovered. The nematode was released for the first time in Puerto Rico during 2001 and has persisted; the wasp was introduced in the late 1930s. The geographical distribution of the wasp is being expanded in Florida and Puerto Rico by planting plots of Spermacoce verticillata (L.), a wildflower indigenous to Puerto Rico and widely distributed in southern Florida. Pastures, sod farms, golf courses, landscapes, and vegetable farms in Florida and Puerto Rico are benefiting from biological control of invasive mole crickets. (author) [es

Lipid mobilization and locomotor stimulation in Gryllus bimaculatus by topically applied adipokinetic hormone

Czech Academy of Sciences Publication Activity Database

Lorenz, M. W.; Zemek, Rostislav; Kodrík, Dalibor; Socha, Radomír

2004-01-01

Roč. 29, - (2004), s. 146-151 ISSN 0307-6962 R&D Projects: GA AV ČR IAA6007202 Institutional research plan: CEZ:AV0Z5007907 Keywords : Adipokinetic hormone * cricket * Grybi-AKH Subject RIV: ED - Physiology Impact factor: 1.352, year: 2004

Exploring the potential for changing gender norms among cricket coaches and athletes in India.

Science.gov (United States)

Miller, Elizabeth; Das, Madhumita; Verma, Ravi; O'Connor, Brian; Ghosh, Sancheeta; Jaime, Maria Catrina D; McCauley, Heather L

2015-02-01

This study explored gender norms with cricket coaches and athletes in India to adapt a coach-delivered gender violence prevention program from the United States for the urban Indian context. Interviews and focus groups conducted among coaches and adolescent cricketers highlight the extent to which coaches and athletes articulate prevailing inequitable notions about gender and recognition of the power coaches wield. Adapting a violence prevention program that emphasizes gender norms change may be feasible with Indian cricket coaches but is likely to require attention to defining gender equity and challenging cultural assumptions with coaches prior to implementing the program with athletes. © The Author(s) 2014.

Cloning, expression, crystallization and preliminary X-ray analysis of a putative multiple antibiotic resistance repressor protein (MarR) from Xanthomonas campestris

International Nuclear Information System (INIS)

Tu, Zhi-Le; Li, Juo-Ning; Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Gao, Fei Philip; Wang, Andrew H.-J.; Chou, Shan-Ho

2005-01-01

A putative repressor for the multiple antibiotic resistance operon from a plant pathogen X. campestris pv. campestris has been overexpressed in E. coli, purified and crystallized. The crystals diffracted to 2.3 Å with good quality. The multiple antibiotic resistance operon (marRAB) is a member of the multidrug-resistance system. When induced, this operon enhances resistance of bacteria to a variety of medically important antibiotics, causing a serious global health problem. MarR is a marR-encoded protein that represses the transcription of the marRAB operon. Through binding with salicylate and certain antibiotics, however, MarR can derepress and activate the marRAB operon. In this report, the cloning, expression, crystallization and preliminary X-ray analysis of XC1739, a putative MarR repressor protein present in the Xanthomonas campestris pv. campestris, a Gram-negative bacterium causing major worldwide disease of cruciferous crops, are described. The XC1739 crystals diffracted to a resolution of at least 1.8 Å. They are orthorhombic and belong to space group P2 1 2 1 2 1 , with unit-cell parameters a = 39.5, b = 54.2 and c = 139.5 Å, respectively. They contain two molecules in the asymmetric unit from calculation of the self-rotation function

Growth and xanthan production of Xanthomonas campestris depending on the N-source concentration

Energy Technology Data Exchange (ETDEWEB)

Prell, A [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Lasik, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Konicek, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Sobotka, M [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology; Sys, J [Academy of Sciences of the Czech Republic, Prague (Czech Republic). Inst. of Microbiology

1995-11-01

Growth of X. campestris and production of xanthan were studied in several batch fermentations with different starting concentrations of N-source. The dependencies of growth, productivity and yields on initial N-source concentration were observed. The maximum yields in the course of cultivations were identified. (orig.)

Skin conditions of baseball, cricket, and softball players.

Science.gov (United States)

Farhadian, Joshua A; Tlougan, Brook E; Adams, Brian B; Leventhal, Jonathan S; Sanchez, Miguel R

2013-07-01

Each year in the United States over 80 million people participate in bat-and-ball sports, for example baseball and softball. Cricket, the world's second most popular sport, is enjoyed by hundreds of millions of participants in such countries as India, Pakistan, Australia, New Zealand, Bangladesh, South Africa, West Indies, Sri Lanka, United Kingdom, and Zimbabwe. Although any player can develop skin disease as a result of participation in these bat-and-ball sports, competitive team athletes are especially prone to skin problems related to infection, trauma, allergy, solar exposure, and other causes. These diseases can produce symptoms that hinder individual athletic performance and participation. In this review, we discuss the diagnosis and best-practice management of skin diseases that can develop as a result of participation in baseball, softball, and cricket.

Effects of foliar dressing of selenite and silicate alone or combined with different soil ameliorants on the accumulation of As and Cd and antioxidant system in Brassica campestris.

Science.gov (United States)

Ding, Yongzhen; Wang, Yongjiu; Zheng, Xiangqun; Cheng, Weimin; Shi, Rongguang; Feng, Renwei

2017-08-01

This study was conducted to investigate the possibility of using a combined technology to synchronously reduce As and Cd accumulation in the edible parts of Brassica campestris. The results showed that a foliar application of selenite (Se) and silicon (Si) combined with soil ameliorants (including Ca-Mg-P fertilizer, sodium silicate and red mud) showed limited effects on the growth of B. campestris. The As concentration in the leaves of B. campestris in all treatments was below the Chinese safety standard. When sodium silicate and Ca-Mg-P fertilizer were added to the soil, the additional foliar application of Se and Si could in some cases help further reduce the concentrations of As and Cd in the leaves of B. campestris. However, when red mud was applied to the soil, the foliar application of Se and Si enhanced the Cd concentration in the leaves of B. campestris. In most cases, high levels of soil ameliorants plus foliar application of Se and Si significantly enhanced the As concentrations in both the soil solution and the roots of B. campestris but reduced the soil solution Cd concentration and the leaf As concentration. Most of the treatments reduced the thiobarbituric acid reactive substances (TBARS) concentration in the leaves of B. campestris, and the foliar application of Se and Si helped the soil ameliorants alleviate the oxidative stress resulting from As and Cd exposure. In this study, several treatments significantly increased the activities of superoxide dismutase (SOD) and ascorbate peroxidase (APX). However, the enzymes peroxidase (POD) and catalase (CAT) were not induced by most treatments. In summary, the combined treatment of 1gkg -1 Ca-Mg-P fertilizer plus foliar spraying 2mmolL -1 sodium selenite was most effective in reducing the Cd concentration and a rather strong ability to reduce the As concentration and trigger the activities of SOD and APX in the leaves of B. campestris. Copyright © 2017 Elsevier Inc. All rights reserved.

Auditory orientation in crickets: Pattern recognition controls reactive steering

Science.gov (United States)

Poulet, James F. A.; Hedwig, Berthold

2005-10-01

Many groups of insects are specialists in exploiting sensory cues to locate food resources or conspecifics. To achieve orientation, bees and ants analyze the polarization pattern of the sky, male moths orient along the females' odor plume, and cicadas, grasshoppers, and crickets use acoustic signals to locate singing conspecifics. In comparison with olfactory and visual orientation, where learning is involved, auditory processing underlying orientation in insects appears to be more hardwired and genetically determined. In each of these examples, however, orientation requires a recognition process identifying the crucial sensory pattern to interact with a localization process directing the animal's locomotor activity. Here, we characterize this interaction. Using a sensitive trackball system, we show that, during cricket auditory behavior, the recognition process that is tuned toward the species-specific song pattern controls the amplitude of auditory evoked steering responses. Females perform small reactive steering movements toward any sound patterns. Hearing the male's calling song increases the gain of auditory steering within 2-5 s, and the animals even steer toward nonattractive sound patterns inserted into the speciesspecific pattern. This gain control mechanism in the auditory-to-motor pathway allows crickets to pursue species-specific sound patterns temporarily corrupted by environmental factors and may reflect the organization of recognition and localization networks in insects. localization | phonotaxis

Cultivar Variation in Hormonal Balance Is a Significant Determinant of Disease Susceptibility to Xanthomonas campestris pv. campestris in Brassica napus

Directory of Open Access Journals (Sweden)

Md. Tabibul Islam

2017-12-01

Full Text Available This study aimed to directly elucidate cultivar variation in disease susceptibility and disease responses in relation to hormonal status in the interaction of Brassica napus cultivars and Xanthomonas campestris pv. campestris (Xcc, the causal agent of black rot disease. Fully expanded leaves of six B. napus cultivars (cvs. Capitol, Youngsan, Saturnin, Colosse, Tamra, and Mosa were inoculated with Xcc. At 14 days post-inoculation with Xcc, cultivar variation in susceptibility or resistance was interpreted with defense responses as estimated by redox status, defensive metabolites, and expression of phenylpropanoid synthesis-related genes in relation to endogenous hormonal status. Disease susceptibility of six cultivars was distinguished by necrotic lesions in the Xcc-inoculated leaves and characterized concurrently based on the higher increase in reactive oxygen species and lipid peroxidation. Among these cultivars, as the susceptibility was higher, the ratios of abscisic acid (ABA/jasmonic acid (JA and salicylic acid (SA/JA tended to increase with enhanced expression of SA signaling regulatory gene NPR1 and transcriptional factor TGA1 and antagonistic suppression of JA-regulated gene PDF 1.2. In the resistant cultivar (cv. Capitol, accumulation of defensive metabolites with enhanced expression of genes involved in flavonoids (chalcone synthase, proanthocyanidins (anthocyanidin reductase, and hydroxycinnamic acids (ferulate-5-hydroxylase biosynthesis and higher redox status were observed, whereas the opposite results were obtained for susceptible cultivars (cvs. Mosa and Tamra. These results clearly indicate that cultivar variation in susceptibility to infection by Xcc was determined by enhanced alteration of the SA/JA ratio, as a negative regulator of redox status and phenylpropanoid synthesis in the Brasica napus–Xcc pathosystem.

Factors Affecting the Result of Matches in the One Day Format of Cricket

Directory of Open Access Journals (Sweden)

Ananda Bandulasiri

2016-01-01

Full Text Available Factors contributing to winning games are imperative, as the ultimate objective in a game is victory. The aim of this study was to identify the factors that characterize the game of cricket, and to investigate the factors that truly influence the result of a game using the data collected from the Champions Trophy cricket tournament. According to the results, this cricket tournament can be characterized using the factors of batting, bowling, and decision-making. Further investigation suggests that the rank of the team and the number of runs they score have the most significant influence on the result of games. As far as the effectiveness of assigning bowlers is concerned, the Australian team has done a fabulous job compared to the rest of the teams. (original abstract

Structure of XC6422 from Xanthomonas campestris at 1.6 Å resolution: a small serine α/β-hydrolase

Energy Technology Data Exchange (ETDEWEB)

Yang, Chao-Yu; Chin, Ko-Hsin [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China); Chou, Chia-Cheng; Wang, Andrew H.-J. [Institute of Biological Chemistry, Academia Sinica, Nankang, Taipei,Taiwan (China); Core Facility for Protein Crystallography, Academia Sinica, Nankang, Taipei,Taiwan (China); Chou, Shan-Ho, E-mail: shchou@nchu.edu.tw [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China)

2006-06-01

The crystal structure of a conserved hypothetical protein from X. campestris has been determined to a resolution of 1.6 Å. The determined X. campestris structure shows that it belongs to the superfamily of serine α/β hydrolase, with an extra strand preceding the first β-strand to lead to extensive subunit interactions in the crystal. XC6422 is a conserved hypothetical protein from Xanthomonas campestris pathovar campestris (Xcc), a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. The protein consists of 220 amino acids and its structure has been determined to 1.6 Å resolution using the multi-wavelength anomalous dispersion (MAD) method. Although it has very low sequence identity to protein sequences in the PDB (less than 20%), the determined structure nevertheless shows that it belongs to the superfamily of serine α/β-hydrolases, with an active site that is fully accessible to solvent owing to the absence of a lid domain. Modelling studies with the serine esterase inhibitor E600 indicate that XC6422 adopts a conserved Ser-His-Asp catalytic triad common to this superfamily and has a preformed oxyanion hole for catalytic activation. These structural features suggest that XC6422 is most likely to be a hydrolase active on a soluble ester or a small lipid. An extra strand preceding the first β-strand in the canonical α/β-hydrolase fold leads to extensive subunit interactions between XC6422 monomers, which may explain why XC6422 crystals of good diffraction quality can grow to dimensions of up to 1.5 mm in a few days.

Elite Cricket Coach Education: A Bourdieusian Analysis

Science.gov (United States)

Townsend, Robert C.; Cushion, Christopher

2017-01-01

The social structures within coach education have been largely unexplored, undiscussed, and treated as unproblematic in contributing to coach learning, both in research and practice. The study used semi-structured, in-depth interviews with 11 elite cricket coaches to gather their perceptions of an elite coach education programme. In particular,…

Estimation of squeeze film damping in artificial hair-sensor towards the detection-limit of crickets' hairs

NARCIS (Netherlands)

Dagamseh, A.M.K.

2014-01-01

The filliform hairs of crickets are among the most sensitive flow sensing elements in nature. The high sensitivity of these hairs enables crickets in perceiving tiny air-movements which are only just distinguishable from noise. This forms our source of inspiration to design highly-sensitive array

Adaptation, translation and reliability of the Australian 'Juniors Enjoying Cricket Safely' injury risk perception questionnaire for Sri Lanka.

Science.gov (United States)

Gamage, Prasanna J; Fortington, Lauren V; Finch, Caroline F

2018-01-01

Cricket is a very popular sport in Sri Lanka. In this setting there has been limited research; specifically, there is little knowledge of cricket injuries. To support future research possibilities, the aim of this study was to cross-culturally adapt, translate and test the reliability of an Australian-developed questionnaire for the Sri Lankan context. The Australian 'Juniors Enjoying Cricket Safely' (JECS-Aus) injury risk perception questionnaire was cross-culturally adapted to suit the Sri Lankan context and subsequently translated into the two main languages (Sinhala and Tamil) based on standard forward-back translation. The translated questionnaires were examined for content validity by two language schoolteachers. The questionnaires were completed twice, 2 weeks apart, by two groups of school cricketers (males) aged 11-15 years (Sinhala (n=24), Tamil (n=30)) to assess reliability. Test-retest scores were evaluated for agreement. Where responses were statistics were calculated. Questions with moderate-to-poor test-retest reliability (κAus questionnaire for use in a different population, providing an outcome measure for assessing injury risk perceptions in Sri Lankan junior cricketers.

Health impact and noise exposure assessment in the cricket bat industry of Kashmir, India.

Science.gov (United States)

Manzoor, Javid; Mamta; Jaganadha Rao, Rayavarapu; Wani, Khursheed Ahmad

2016-12-01

The aim of the present study was to identify and evaluate predominant noise sources in the cricket bat industry of Kashmir, India. Sound levels were measured at operator's ear level in the working zone of the workers of seven cricket bat factories. The impact assessment was made through personal interviews with each worker separately during their period of rest. On average, 62.5% of the workers reported difficulty in hearing and 24.1% of the workers have become patients for hypertension. Only 58.1% of the workers complained of headache due to high noise level. The workers engaged in the cricket bat industry of Kashmir are exposed to high noise levels. It is suggested that personal protective equipment like ear plugs and ear muffs be used by these workers as a protection against this hazard.

Distribution and harmfulness of field dodder (Cuscuta campestris Yuncker at sugar beet fields in Slovakia

Directory of Open Access Journals (Sweden)

Tóth Peter

2006-01-01

Full Text Available During 2002-2004, field surveys of field dodder (Cuscuta campestris Yunck e r in croplands were done in southwestern Slovakia. From among 150 localities surveyed, 80 were found infested by the field dodder. Within crop plants, C. campestris infested sugar beet (Beta vulgaris, alfalfa (Medicago sativa tobacco (Nicotiana tabacum, potato (Solanum tuberosum, lentil (Lens esculenta, parsley (Pastinaca sativa and onion (Allium cepa. Besides the crops, 18 weed species were also recorded. The species from the genus Polygonum (Polygonaceae were the most important and acted as a significant reservoir of field dodder in cropland. C. campestris was not found in cold climatic regions with altitude higher than 240 m. The impact of field dodder infestation on sugar beet yield was studied during the year of 2004 in two localities (Šalov and Žitavce in southwestern Slovakia. The presence of field dodder markedly reduced both, quantity and quality of sugar beet yield. Weight of heavily infested beets was reduced from 21.6 to 37.4% and sugar content from 12.0 to 15.2%. Such decline of both parameters was also recorded when field dodder was removed together with leaves of sugar beet during growing season at the end of July. The aim of the infested leaves removal was to decrease mass of field dodder seeds. Although the leaf area of sugar beet regenerates, the decrease of quality and quantity was observed. The decline was the same at both localities, no matter whether the fields were irrigated (Šalov or not (Žitavce.

Cadmium-Induced Hydrogen Accumulation Is Involved in Cadmium Tolerance in Brassica campestris by Reestablishment of Reduced Glutathione Homeostasis.

Science.gov (United States)

Wu, Qi; Su, Nana; Chen, Qin; Shen, Wenbiao; Shen, Zhenguo; Xia, Yan; Cui, Jin

2015-01-01

Hydrogen gas (H2) was recently proposed as a therapeutic antioxidant and signaling molecule in clinical trials. However, the underlying physiological roles of H2 in plants remain unclear. In the present study, hydrogen-rich water (HRW) was used to characterize the physiological roles of H2 in enhancing the tolerance of Brassica campestris against cadmium (Cd). The results showed that both 50 μM CdCl2 and 50%-saturated HRW induced an increase of endogenous H2 in Brassica campestris seedlings, and HRW alleviated Cd toxicity related to growth inhibition and oxidative damage. Seedlings supplied with HRW exhibited increased root length and reduced lipid peroxidation, similar to plants receiving GSH post-treatment. Additionally, seedlings post-treated with HRW accumulated higher levels of reduced glutathione (GSH) and ascorbic acid (AsA) and showed increased GST and GPX activities in roots. Molecular evidence illustrated that the expression of genes such as GS, GR1 and GR2, which were down-regulated following the addition of Cd, GSH or BSO, could be reversed to varying degrees by the addition of HRW. Based on these results, it could be proposed that H2 might be an important regulator for enhancing the tolerance of Brassica campestris seedlings against Cd, mainly by governing reduced glutathione homeostasis.

Learning from Crickets: Artificial Hair-Sensor Array Developments

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Lammerink, Theodorus S.J.; Wiegerink, Remco J.

2010-01-01

We have successfully developed biomimetic flowsensitive hair-sensor arrays taking inspiration from mechanosensory hairs of crickets. Our current generation of sensors achieves sub mm/s threshold air-flow sensitivity for single hairs operating in a bandwidth of a few hundred Hz and is the result of a

Identification of Isolates that Cause a Leaf Spot Disease of Brassicas as Xanthomonas campestris pv. raphani and Pathogenic and Genetic Comparison with Related Pathovars.

Science.gov (United States)

Vicente, J G; Everett, B; Roberts, S J

2006-07-01

ABSTRACT Twenty-five Xanthomonas isolates, including some isolates received as either X. campestris pv. armoraciae or pv. raphani, caused discrete leaf spot symptoms when spray-inoculated onto at least one Brassica oleracea cultivar. Twelve of these isolates and four other Xanthomonas isolates were spray- and pin-inoculated onto 21 different plant species/cultivars including horseradish (Armoracia rusticana), radish (Raphanus sativus), and tomato (Lycopersicon esculentum). The remaining 13 leaf spot isolates were spray-inoculated onto a subset of 10 plant species/cultivars. The leaf spot isolates were very aggressive on several Brassica spp., radish, and tomato causing leaf spots and dark sunken lesions on the middle vein, petiole, and stem. Based on the differential reactions of several Brassica spp. and radish cultivars, the leaf spot isolates were divided into three races, with races 1 and 3 predominating. A differential series was established to determine the race-type of isolates and a gene-for-gene model based on the interaction of two avirulence genes in the pathogen races and two matching resistance genes in the differential hosts is proposed. Repetitive-DNA polymerase chain reaction-based fingerprinting was used to assess the genetic diversity of the leaf spot isolates and isolates of closely related Xanthomonas pathovars. Although there was variability within each race, the leaf spot isolates were clustered separately from the X. campestris pv. campestris isolates. We propose that X. campestris isolates that cause a nonvascular leaf spot disease on Brassica spp. should be identified as pv. raphani and not pv. armoraciae. Race-type strains and a neopathotype strain for X. campestris pv. raphani are proposed.

Effect of seed-irradiation on morphological characters yield components of brassica campestris var. sarson

International Nuclear Information System (INIS)

Bokhari, F.S.; Ahmad, S.

1996-01-01

Seed of Brassica campestris (var. Sarson) were used to study the effect of radiation of different morphological and yield parameters. Survival percentage showed drastic decrease at higher doses (75 Kr and 100 Kr). Similarly all characters showed a trend of decrease with increasing dose. LD50 for Brassica was about 50 Kr. (author)

Microbial dynamics during industrial rearing, processing, and storage of the tropical house cricket (Gryllodes sigillatus) for human consumption.

Science.gov (United States)

Vandeweyer, Dries; Wynants, Enya; Crauwels, Sam; Verreth, Christel; Viaene, Nikolaas; Claes, Johan; Lievens, Bart; Van Campenhout, Leen

2018-04-06

In this study, the microbiota during industrial rearing, processing, and storage of the edible tropical house cricket, Gryllodes sigillatus , was investigated. To this end, samples were analyzed of the cricket feed, before feeding as well as taken from the cages, and the crickets during rearing, after harvest, and after processing into frozen, oven-dried, and smoked and subsequently oven-dried end products. Although the feed contained lower microbial numbers than the crickets, both were dominated by the same species-level operational taxonomic units as determined by Illumina Miseq sequencing. They corresponded, among others, to members of Porphyromonadaceae, Fusobacterium , Parabacteroides and Erwinia The harvested crickets contained high microbial numbers, but none of the investigated food pathogens Salmonella spp., Listeria monocytogenes , Bacillus cereus , and coagulase-positive staphylococci. However, some possible mycotoxin-producing fungi were isolated from the crickets. A post-harvest heat treatment, shortly boiling the crickets, reduced microbial numbers, but an endospore load of 2.4 log cfu/g remained. After processing, an increase in microbial counts was observed for dried and smoked plus dried crickets. Additionally, in the smoked plus dried crickets, a high abundance of a Bacillus sp. was observed. Considering the possible occurrence of food-pathogenic species from this genus, it is advised to apply a heat treatment which is sufficient to eliminate spores. Nevertheless, the microbial numbers remained constant over a six-month storage period, frozen (frozen end product) or at ambient temperature (oven-dried and smoked plus dried end products). Importance. The need for sustainable protein sources has led to the emergence of a new food sector, producing and processing edible insects into foods. However, insight into the microbial quality of this new food and into the microbial dynamics during rearing, processing and storage of edible insects is still

Conformational changes associated with the binding of zinc acetate at the putative active site of XcTcmJ, a cupin from Xanthomonas campestris pv. campestris

International Nuclear Information System (INIS)

Axelrod, Herbert L.; Kozbial, Piotr; McMullan, Daniel; Krishna, S. Sri; Miller, Mitchell D.; Abdubek, Polat; Acosta, Claire; Astakhova, Tamara; Carlton, Dennis; Caruthers, Jonathan; Chiu, Hsiu-Ju; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Elias, Ylva; Feuerhelm, Julie; Grzechnik, Slawomir K.; Grant, Joanna C.; Han, Gye Won; Jaroszewski, Lukasz; Jin, Kevin K.; Klock, Heath E.; Knuth, Mark W.; Kumar, Abhinav; Marciano, David; Morse, Andrew T.; Murphy, Kevin D.; Nigoghossian, Edward; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Reyes, Ron; Rife, Christopher L.; Tien, Henry J.; Trout, Christina V.; Bedem, Henry van den; Weekes, Dana; White, Aprilfawn; Xu, Qingping; Zubieta, Chloe; Hodgson, Keith O.; Wooley, John; Elsliger, Marc-André; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.

2009-01-01

The crystal structure of an RmlC-type cupin with zinc acetate bound at the putative active site reveals significant differences from a previous structure without any bound ligand. The functional implications of the ligand-induced conformational changes are discussed. In the plant pathogen Xanthomonas campestris pv. campestris, the product of the tcmJ gene, XcTcmJ, encodes a protein belonging to the RmlC family of cupins. XcTcmJ was crystallized in a monoclinic space group (C2) in the presence of zinc acetate and the structure was determined to 1.6 Å resolution. Previously, the apo structure has been reported in the absence of any bound metal ion [Chin et al. (2006 ▶), Proteins, 65, 1046–1050]. The most significant difference between the apo structure and the structure of XcTcmJ described here is a reorganization of the binding site for zinc acetate, which was most likely acquired from the crystallization solution. This site is located in the conserved metal ion-binding domain at the putative active site of XcTcmJ. In addition, an acetate was also bound within coordination distance of the zinc. In order to accommodate this binding, rearrangement of a conserved histidine ligand is required as well as several nearby residues within and around the putative active site. These observations indicate that binding of zinc serves a functional role in this cupin protein

A situation analysis of the competitive schools based cricket coaching programmes at u/19 level in the Gauteng province

OpenAIRE

2014-01-01

M.Phil. (Sport Management) The purpose of this study was to investigate the management of cricket coaching programmes at u/19 level in the Gauteng Province. Specifically, this study attempted to determine the current situation regarding management of coaching programmes and the delivery of in-school driven programmes in the province. Data was collected from schools offering cricket as a sport from both the Gauteng Lions and Northerns Cricket Union franchises. There were 10 schools in the N...

Caracterização de isolados de Xanthomonas campestris pv campestris de sistemas de produção orgânico e reação de brássicas à podridão-negra Characterization of strains of Xanthomonas campestris pv campestris from organic farming systems and reaction of brassicas to black rot

Directory of Open Access Journals (Sweden)

Liliana Andréa dos Santos

2008-12-01

Full Text Available Noventa isolados de Xanthomonas campestris pv. campestris (Xcc de brássicas oriundas de sistemas de produção orgânico das Zonas da Mata e Agreste de Pernambuco foram caracterizados com base na sensibilidade a antibióticos e sulfato de cobre e atividade de esterase. A maioria apresentou alta sensibilidade à tetraciclina (76,6%, eritromicina (63,3% e estreptomicina (63,3%, resistência à amoxicilina (70%, gentamicina (40,0% e norfloxacin (45,5% e média sensibilidade (44,4% ou resistência (44,4% à neomicina. Cinqüenta e cinco isolados de Xcc foram resistentes ao sulfato de cobre na concentração de 50 mg/mL e todos foram sensíveis ao produto na concentração de 200 mg/mL. Atividade de esterase foi apresentada por 92,22% dos isolados. A análise Euclidiana por ligação simples evidenciou variabilidade entre os isolados separando-os em sete grupos de similaridade. Foi estudada também a reação de 14 cultivares de brássicas à podridão-negra, utilizando o isolado "B21" de Xcc. As cultivares diferiram significativamente entre si em relação ao período de incubação, incidência e severidade final da doença. Os maiores valores de severidade final da doença foram verificados em brócolos "Ramoso", couve-flor "Bola de Neve" e "Piracicaba de Verão", e repolho "Chato de Quintal". Os híbridos de couve-chinesa "AF 70", "AF 72", "AF 69" e "AF 66" mostraram-se altamente resistentes à doença, enquanto que brócolos "Ramoso" e "Precoce Piracicaba", couve-flor "Piracicaba de Verão" e "Híbrido Cindy" e repolho "60 Dias" foram medianamente resistentes.Ninety strains of Xanthomonas campestris pv. campestris (Xcc from brassicas grown under organic farming systems in the "Mata" and "Agreste" regions of Pernambuco, Brazil, were characterized based upon sensitivity to antibiotics and copper sulfate, and esterase activity. Most of the strains showed high sensitivity to tetracycline (76.6%, erythromycin (63.3% and streptomycin (63

Comparison of the Physical and Technical Demands of Cricket Players During Training and Match-Play.

Science.gov (United States)

Vickery, Will; Duffield, Rob; Crowther, Rian; Beakley, David; Blanch, Peter; Dascombe, Ben J

2018-03-01

Vickery, W, Duffield, R, Crowther, R, Beakley, D, Blanch, P, and Dascombe, BJ. Comparison of the physical and technical demands of cricket players during training and match-play. J Strength Cond Res 32(3): 821-829, 2018-This study aimed to determine which training method (net-based sessions or center-wicket simulations) currently used in national level and U19 male players cricket provided a more physical and technical match-specific training response. The heart rate, rating of perceived exertion, and movement patterns of 42 male cricket players were measured across the various training and match formats. Video analysis was coded retrospectively to quantify technical loads based on the cricket skills performed. Magnitude-based inferences were based on the standardization of effect and presented with ±90% confidence intervals. Regardless of playing position, differences in physiological demands between training modes and match-play were unclear, with the exception of higher heart rates in fielders during traditional net sessions (mean heart rate: d = -2.7 [-4.7 to -0.7]; 75% of maximum heart rate: d = -1.7 [-3.2 to -0.2]). Typically, the movement demands of center-wicket simulations were similar or greater than match-play, which was most evident in the distance traveled at a high intensity within each playing position (batsmen: d = 6.4 [3.7-9.2]; medium-fast bowlers: d = 1.71 [0.1-3.3]; spin bowlers: d = 6.5 [0.01-13.0]; fielders: d = 0.8 [-0.2 to 1.7]). The technical demands of traditional net cricket training exceeded that of a typical match for each playing position. Specifically, fast bowlers delivered a greater number of balls during net-bowling compared with a match (d = -2.2 [-3.6 to 0.9]). In conclusion, center-wicket simulations more closely matched the physical demands of a One-Day match within batsmen and spin bowlers, whereas traditional cricket training often exceeded match-specific demands.

PECTATE LYASE-LIKE 9 from Brassica campestris is associated with intine formation.

Science.gov (United States)

Jiang, Jingjing; Yao, Lina; Yu, Youjian; Liang, Ying; Jiang, Jianxia; Ye, Nenghui; Miao, Ying; Cao, Jiashu

2014-12-01

Brassica campestris pectate lyase-like 9 (BcPLL9) was previously identified as a differentially expressed gene both in buds during late pollen developmental stage and in pistils during fertilization in Chinese cabbage. To characterize the gene's function, antisense-RNA lines of BcPLL9 (bcpll9) were constructed in Chinese cabbage. Self- and cross-fertilization experiments harvested half seed yields when bcpll9 lines were used as pollen donors. In vivo and in vitro pollen germination assays showed that nearly half of the pollen tubes in bcpll9 were irregular with shorter length and uneven surface. Aniline blue staining identified abnormal accumulation of a specific bright blue unknown material in the bcpll9 pollen portion. Scanning electron microscopy observation verified the abnormal outthrust material to be near the pollen germinal furrows. Transmission electron microscopy observation revealed the internal endintine layer was overdeveloped and predominantly occupied the intine. This abnormally formed intine likely induced the wavy structure and growth arrest of the pollen tube in half of the bcpll9 pollen grains, which resulted in less seed yields. Collectively, this study presented a novel PLL gene that has an important function in B. campestris intine formation. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Rhizosphere competent Mesorhizobiumloti MP6 induces root hair curling, inhibits Sclerotinia sclerotiorum and enhances growth of Indian mustard (Brassica campestris Mesorhizobium loti MP6 rizosférico competente induz encurvamento do pelo daraiz, inibe Sclerotinia sclerotiorum e estimula o crescimento de mostarda indiana (Brassica campestris

Directory of Open Access Journals (Sweden)

Shikha Chandra

2007-03-01

Full Text Available The bacterial strain Mesorhizobium loti MP6, isolated from root nodules of Mimosa pudica induced growth and yield of Brassica campestris. The isolate MP6 secreted hydroxamate type siderophore in Chrom-Azurol Siderophore (CAS agar medium. Production of hydrocyanic acid (HCN, indole acetic acid (IAA and phosphate solubilizing ability was also recorded under normal growth conditions. Root hair curling was observed through simple glass-slide technique. In vitro study showed a significant increase in population of M. loti MP6 in rhizosphere due to root exudates of B. campestris. In dual culture technique the strain showed a strong antagonistic effect against Sclerotinia sclerotiorum, a white rot pathogen of Brassica campestris. The growth of S. sclerotiorum was inhibited by 75% after prolonged incubation. Efficient root colonization of mustard seedlings was confirmed by using a streptomycin-resistant marker M. loti MP6strep+. The M. loti MP6 coated seeds proved enhanced seed germination, early vegetative growth and grain yield as compared to control. Also, a drastic decline (99% in the incidence of white rot was observed due to application of M. loti MP6.A cepa bacteriana Mesorhizobium loti MP6 isolada de nódulos de raiz de Mimosa pudica induziu o crescimento e o rendimento de Brassica campestris. A cepa MP6 secretou sideróforo do tipo hidroxamato em meio sólido Chrom-Azurol Siderophore (CAS. Em condições normais de crescimento, a cepa foi também capaz de produzir de ácido cianídrico (HCN e acido indolacético (AIA e solubilizar fosfato. O encurvamento do pelo da raiz foi observado usando a simples técnica de lâmina e lamínula. Estudos in vitro mostraram um aumento significativo na população de M. loti MP6 na rizosfera devido aos exsudatos de B. campestris. Empregando-se técnica de co-cultura, a cepa mostrou um grande efeito antagônico contra o fungo Sclerotinia sclerotiorum, o patógeno da podridão branca de Brassica campestris. Ap

A biomimetic accelerometer inspired by the cricket's clavate hair

NARCIS (Netherlands)

Droogendijk, H.; de Boer, Meint J.; Sanders, Remco G.P.; Krijnen, Gijsbertus J.M.

2014-01-01

Crickets use so-called clavate hairs to sense (gravitational) acceleration to obtain information on their orientation. Inspired by this clavate hair system, a one-axis biomimetic accelerometer has been developed and fabricated using surface micromachining and SU-8 lithography. An analytical model

Preferential exclusion of hybrids in mixed pollinations between oilseed rape (Brassica napus) and weedy B. campestris (Brassicaceae)

DEFF Research Database (Denmark)

Hauser, T.P.; Bagger Jørgensen, Rikke; Østergård, Hanne

1997-01-01

amplified polymorphic DNA analysis. Using data on the proportion of fully developed seeds and the proportion of these seeds that were hybrids, a statistical model was constructed to estimate the fitness of conspecific and heterospecific pollen and the survival of conspecific and heterospecific zygotes...... for competition between male gametophytes and/or seeds within pods. To test whether competition influences the success of hybridization, pollen from the two species was mixed in different proportions and applied to stigmas of both species. The resulting seeds were scored for paternity by isozyme and randomly...... to seeds. B. campestris pollen in B. napus styles had a significantly lower fitness than the conspecific pollen, whereas no difference between pollen types was found in B. campestris styles. Hybrid zygotes survived to significantly lower proportions than conspecific zygotes in both species, with the lowest...

Chemical characterization of Xanthan biopolymers synthesized by Xanthomonas campestris pv pruni strains; Caracterizacao quimica de biopolimeros sintetizados por Xanthomonas campestris pv pruni

Energy Technology Data Exchange (ETDEWEB)

Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia [Universidade Federal de Pelotas, RS (Brazil). Centro de Biotecnologia]. E-mail: angelita@ufpel.tche.br; claire@ufpel.tche.br; ligia@ufpel.tche.br; Galland, Griselda [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Inst. de Qumica

2001-07-01

In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The {sup 13}C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)

Crickets as bio-inspiration for MEMS-based flow-sensing

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Droogendijk, H.; Dagamseh, A.M.K.; Jaganatharaja, R.K.; Casas, Jerome

2014-01-01

MEMS offers exciting possibilities for the fabrication of bio-inspired mechanosensors. Over the last few years, we have been working on cricket- inspired hair-sensor arrays for spatio-temporal flow-field observations (i.e. flow camera) and source localisation. Whereas making flow-sensors as energy

Antihypertensive and vasorelaxant effects of aqueous extract of Artemisia campestris L. from Eastern Morocco.

Science.gov (United States)

Dib, Ikram; Tits, Monique; Angenot, Luc; Wauters, Jean Noel; Assaidi, Asmae; Mekhfi, Hassane; Aziz, Mohammed; Bnouham, Mohammed; Legssyer, Abdelkhaleq; Frederich, Michel; Ziyyat, Abderrahim

2017-07-12

Artemisia campestris L. (Asteraceae) has many traditional uses, among which treatment of diabetes and hypertension. This study was conducted in order to confirm the antihypertensive and hypotensive effects of A. campestris L. aqueous extract (AcAE) and to explore the underlying mechanism of action of its vasorelaxant effect, besides the acute toxicity. Also, the chemical composition of AcAE was investigated. the chemical content of AcAE was determined by using HPLC and NMR techniques. The antihypertensive effect was assessed indirectly by tail-cuff method on L-NAME induced hypertensive rats, while the hypotensive action was monitored intravenously by invasive method on normotensive rats. The vasorelaxant effect and vascular mechanism of action were studied in the presence of antagonists and blockers on aorta isolated from normotensive rats. On the other side, the acute toxicity was studied by oral feeding of extract to the mice. The global phytochemical profile of AcAE reveals the presence of several polyphenols as main components. A. campestris L. infusion was characterized by mono- and di-cinnamoyl compounds, with 3,5-dicaffeoylquinic (isochlorogenic A) acid being the main compound, followed by 5-caffeoylquinic (chlorogenic) acid. Vicenin-2 (apigenin 6,8-di-C-glucoside) appeared to be the most abundant compound among flavonoids. The daily treatment with AcAE at 150mg/kg/day prevented the installation of hypertension on L-NAME hypertensive rats, and reduced SBP from 172mmHg up to 144mmHg. At the dose 40mg/kg, AcAE provoked reduction of systolic (SBP), diastolic (DBP) and mean arterial pressure (MAP), without affecting the heart rate. Also, AcAE (10 -2 -2mg/ml) relaxed the precontracted aorta by 95.8±1.3%. The denudation and preincubation of aorta with atropine, calmidazolium, L-NAME, hydroxycobalamin, ODQ, 8-RP-Br-PET-cGMP, thapsigargin and verapamil attenuated the vasorelaxant response, while the pre-treatment with 4-AP, TEA, glibenclamide and BaCl 2 did not

Network centrality based team formation: A case study on T-20 cricket

Directory of Open Access Journals (Sweden)

Paramita Dey

2017-07-01

Full Text Available This paper proposes and evaluates the novel utilization of small world network properties for the formation of team of players with both best performances and best belongingness within the team network. To verify this concept, this methodology is applied to T-20 cricket teams. The players are treated as nodes of the network, whereas the number of interactions between team members is denoted as the edges between those nodes. All intra country networks form the cricket network for this case study. Analysis of the networks depicts that T-20 cricket network inherits all characteristics of small world network. Making a quantitative measure for an individual performance in the team sports is important with respect to the fact that for team selection of an International match, from pool of best players, only eleven players can be selected for the team. The statistical record of each player considered as a traditional way of quantifying the performance of a player. But the other criteria such as performing against a strong opponent or performance as an effective team member such as fielding, running between the wickets, good partnership deserves more credential. In this paper a revised method based on social networking is presented to quantify the quality of team belongingness and efficiency of each player. The application of Social Network Analysis (SNA is explored to measure performances and the rank of the players. A bidirectional weighted network of players is generated using the information collected from T-20 cricket (2014–2016 and used for network analysis. Thus team was formed based on that ranking and compared with their IPL (Indian Premier League performances of 2016.

Timing of Environmental Enrichment Affects Memory in the House Cricket, Acheta domesticus.

Directory of Open Access Journals (Sweden)

Heather S Mallory

Full Text Available Learning appears to be ubiquitous among animals, as it plays a key role in many behaviors including foraging and reproduction. Although there is some genetic basis for differences in learning ability and memory retention, environment also plays an important role, as it does for any other trait. For example, adult animals maintained in enriched housing conditions learn faster and remember tasks for longer than animals maintained in impoverished conditions. Such plasticity in adult learning ability has often been linked to plasticity in the brain, and studies aimed at understanding the mechanisms, stimuli, and consequences of adult behavioral and brain plasticity are numerous. However, the role of experiences during post-embryonic development in shaping plasticity in adult learning ability and memory retention remain relatively unexplored. Using the house cricket (Acheta domesticus as a model organism, we developed a protocol to allow the odor preference of a large number of crickets to be tested in a short period of time. We then used this new protocol to examine how enrichment or impoverishment at two developmental stages (either the last nymphal instar or young adult affected adult memory. Our results show that regardless of nymphal rearing conditions, crickets that experienced an enriched rearing condition as young adults performed better on a memory task than individuals that experienced an impoverished condition. Older adult crickets (more than 1 week post adult molt did not demonstrate differences in memory of the odor task, regardless of rearing condition as a young adult. Our results suggest that environmentally-induced plasticity in memory may be restricted to the young adult stage.

Franjas marginales de Brassica campestris L. (nabo) en cultivo de repollo. Efecto sobre pulgones y sus parasitoides: Título abreviado: Franjas marginales de Brassica campestris L. ....

OpenAIRE

Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I

2014-01-01

La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...

A Taxonomic Review of the Sword-tailed Cricket Subfamily Trigonidiinae (Orthoptera: Ensifera: Gryllidae from Korea

Directory of Open Access Journals (Sweden)

Tae-Woo Kim

2013-01-01

Full Text Available The Korean population of the sword-tailed cricket subfamily Trigonidiinae is reviewed for the first time. Four members of the crickets are confirmed based on the examined material, those are Metioche japonica (Ichikawa, 2001, Svistella bifasciata (Shiraki, 1911, Homoeoxipha obliterata (Caudell, 1927 and Natula matsuurai Sugimoto, 2001, each of them belonging to a different genera. Among them, the former two are reconfirmed since earlier records, and latter two are newly recognized genera and species from the far southern provinces Jeollanam-do and Jeju-do Island in Korea. The type locality of both crickets is Japan, and are also only previously referred to in Japan, but their distributional ranges include neighboring South Korea. A key to the species, descriptions, photographs, figures, and oscillograms of male’s calling sounds are provided to aid their identification.

Identifying the greatest team and captain—A complex network approach to cricket matches

Science.gov (United States)

Mukherjee, Satyam

2012-12-01

We consider all Test matches played between 1877 and 2010 and One Day International (ODI) matches played between 1971 and 2010. We form directed and weighted networks of teams and also of their captains. The success of a team (or captain) is determined by the ‘quality’ of the wins, not simply by the number of wins. We apply the diffusion-based PageRank algorithm to the networks to assess the importance of the wins, and rank the respective teams and captains. Our analysis identifies Australia as the best team in both forms of cricket, Test and ODI. Steve Waugh is identified as the best captain in Test cricket and Ricky Ponting is the best captain in the ODI format. We also compare our ranking scheme with an existing ranking scheme, the Reliance ICC ranking. Our method does not depend on ‘external’ criteria in the ranking of teams (captains). The purpose of this paper is to introduce a revised ranking of cricket teams and to quantify the success of the captains.

Análisis comparativo de los caracteres epidérmicos en Flourensia campestris y F. oolepis (Asteraceae Comparative analysis of the epidermal characters in Flourensia campestris and F. oolepis (Asteraceae

Directory of Open Access Journals (Sweden)

Natalia Delbón

Full Text Available En el presente estudio se examinaron y compararon cuantitativamente las epidermis foliares de Flourensia campestris Griseb. y F. oolepis S. F. Blake, especies endémicas que crecen en las sierras de Córdoba, Argentina. Para ello, se seleccionaron cinco variables: número de células epidérmicas propiamente dichas, estomas, tricomas glandulares y eglandulares e índice estomático. Los resultados obtenidos se evaluaron por métodos estadísticos; ellos indican que hay diferencias significativas entre ambas especies en las variables frecuencia de estomas, de células propiamente dichas, de tricomas glandulares e índice estomático. Estos datos podrían ser de interés para su reconocimiento cuando se dispone de muestras pequeñas o fragmentos.This study provides comparative analyses of foliar epidermis in Flourensia campestris Griseb. and F. oolepis S. F. Blake, endemic species that grow in Córdoba, Argentina. Five variables were selected: number of epidermal cells, stomata, glandular and eglandular trichomes and stomatal index. Results were evaluated by statistical methods; they show that there are significant differences between the variables of both species; these data could be of interest for their identification, when only are available small samples and fragments.

More winged females of the cricket Gryllodes supplicans (Walker ...

African Journals Online (AJOL)

The cosmotropical cricket Gryllodes supplicans occurs in two forms, a common micropterous form and a rare micropterous form. The unusual macropterous form occurs naturally in Sri Lanka and Bermuda, but has also been produced by laboratory manipulation of environmental conditions. This article is a preliminary report ...

Chronic social defeat induces long-term behavioral depression of aggressive motivation in an invertebrate model system.

Science.gov (United States)

Rose, Jacqueline; Rillich, Jan; Stevenson, Paul A

2017-01-01

Losing a fight against a conspecific male (social defeat) induces a period of suppressed aggressiveness and general behaviour, often with symptoms common to human psychiatric disorders. Agonistic experience is also discussed as a potential cause of consistent, behavioral differences between individuals (animal "personality"). In non-mammals, however, the impact of single agonistic encounters typically last only hours, but then again studies of repeated intermittent defeat (chronic social defeat) are seldom. We report the effect of chronic social defeat in adult male crickets (Gryllus bimaculatus), for which all known behavioral effects of defeat last only 3 h. Firstly, after 48 h social isolation, crickets that experienced 5 defeats at 24 h intervals against the same, weight-matched opponent exhibited suppressed aggressiveness lasting >24 h, which was still evident when the animals were matched against an unfamiliar opponent at the last trial. Secondly, this longer-term depression of aggression also occurred in 48 h isolated crickets that lost 6 fights at 1 h intervals against unfamiliar opponents at each trial. Thirdly, crickets isolated as larvae until adult maturity (>16 days) were significantly more aggressive, and less variable in their aggressiveness at their very first fight than 48 h isolates, and also significantly more resilient to the effects of chronic social defeat. We conclude that losing an aggressive encounter in crickets has a residual effect, lasting at least 24 h, that accumulates when repeated defeats are experienced, and leads to a prolonged depression of aggressive motivation in subordinates. Furthermore, our data indicate that social interactions between young adults and possibly larvae can have even longer, possibly lifelong influences on subsequent behavior. Social subjugation is thus likely to be a prime determinant of inter-individual behavioral differences in crickets. Our work also opens new avenues for investigating proximate

Hydration benefits to courtship feeding in crickets

OpenAIRE

Ivy, T. M.; Johnson, J. C.; Sakaluk, S. K.

1999-01-01

The spermatophore transferred by male decorated crickets (Gryllodes sigillatus) at mating includes a large gelatinous spermatophylax that the female consumes after copulation. Although previous studies have shown that G. sigillatus females gain no nutritional benefits from consuming food gifts, there may be other benefits to their consumption. We examined potential hydration benefits to females by experimentally manipulating both the availability of water and the number of food gifts that fem...

Signaling pathway underlying the octopaminergic modulation of myogenic contraction in the cricket lateral oviduct.

Science.gov (United States)

Tamashiro, Hirotake; Yoshino, Masami

2014-12-01

Octopamine (OA), a biogenic monoamine, is a neurotransmitter and neuromodulator in invertebrates. Here, we report the effect of OA on the spontaneous rhythmic contractions (SRCs) of the lateral oviduct of the cricket Gryllus bimaculatus and the possible signaling pathway involved. Application of OA increased both the frequency and amplitude of SRCs in a dose-dependent manner. The effect of OA was inhibited by subsequent application of the OA receptor antagonist epinastine, indicating that the action of OA is mediated by OA receptor. To investigate the predominant signaling pathway underlying the action of OA, we first examined a possible involvement of the cAMP/cAMP-dependent protein kinase A (PKA) signaling pathway. Application of the membrane-permeable cAMP analog 8-Br-cAMP had little effect on SRCs and the effect of OA was not influenced by subsequent application of the PKA inhibitor H89, indicating that the cAMP/PKA signaling pathway is not the predominant pathway in the action of OA. Next, we examined a possible involvement of the second messenger inositol 1,4,5-trisphosphate in the action of OA. The effect of OA on SRCs was inhibited by subsequent application of the phosphoinositide-specific phospholipase C (PLC) inhibitor U73122, indicating that the PLC pathway is involved in the action of OA. The OA-induced increase in the frequency of SRCs was inhibited by pretreatment of the cell with the ryanodine receptor antagonist tetracaine but was not significantly affected by the IP3 receptor antagonist 2-aminoethoxydiphenyl borate (2-APB). On the other hand, the OA-induced increase in the amplitude of SRCs was inhibited by pretreatment of the cells with 2-APB but was not significantly affected by tetracaine. Taken together, these results suggest that the OA-induced excitatory effect on SRCs is mediated by the PLC signaling pathway: Ca2+ release from IP3 receptors may contribute to the modulation of the amplitude of SRCs, whereas Ca2+ release from ryanodine

Cricket club

CERN Multimedia

Cricket club

2011-01-01

CERN CC JOINS IN THREE DAYS OF GOODWILL FOR UK JOURNALISTS   22 24 July vs FLEET STREET STROLLERS Fleet Street Strollers Cricket Club, a 17-strong group of professional journalists and friends from the UK Home Counties, visited CERN for the first time on 22-24 July. On Friday 22 July, CERN's Visitor Centre provided their usual polished tour and information services.  Before the visit the Strollers had hoped to stroll underground to the Atlas detector.  Forewarned that this was not possible they hid any disappointment, judging by the acuteness and variety of the question-and-answer sessions.  And the cash register of the Visitor Shop was busy. On Saturday 23 July, Strollers won the toss and batted first in a 35-over game.  D'Mello and Campbell bowled tightly for CERN and Strollers were 13 for 2 after 6 overs.  CERN released the pressure with a few overs from L. Osborne and Curtis but, at the point where Strollers were looking...

CRICKET CLUB

CERN Multimedia

CRICKET CLUB

2010-01-01

CERN CC VERSUS TRAFFORD SOLICITORS CC IN BELLINGHAN ON JUNE 26th/27th 2010 The CERN cricket club traveled to the North of England for their first tour of the season, playing two games over the course of the weekend of 26-27th June against Trafford Solicitors CC (TSCC).   The sunny weather was almost unprecedented in the history of this fixture.  The first game on Saturday saw the CERN team rewarded for their accurate bowling, as they restricted TSCC to 130 all out: T. Goodyear the pick of the bowlers with 4-7, with three wickets for Stucki.  Despite losing three wickets, the runs were comfortable chased down in 26 overs, with Elvin top scoring on 34, and K. Goodyear hitting the winning runs to finish on 32 not out. The second match saw TSCC setting a challenging target of 179 from their 30 overs, Hoburn scoring 61, and Barrett taking 3-40.  Osborne very narrowly failed to take a hat-trick in the final over.   CERN CC’s reply started w...

Experience-based typology of spectators at an international cricket ...

African Journals Online (AJOL)

This innovative research on managing and marketing team sport events was completed for the first time at an international Cricket Sixes tournament held in South Africa (SA). A visitor survey was conducted at SuperSport Park in Centurion during the Global Softech Sixes Tournament in 2014. Finally, spectators, who were ...

A review of cricket injuries and the effectiveness of strategies to ...

African Journals Online (AJOL)

national cricket teams, with more injuries having occurred when the ... r A Stretch (D Phil). Sport Bureau, Nelson Mandela Metropolitan University, Port Elizabeth ..... spine disk degeneration, but more specific and intense individual coaching ...

Cricket pace bowling: The trade-off between optimising knee angle ...

African Journals Online (AJOL)

Knee angle and ball release (BR) speed of injury-free premier league (club level) cricket .... variables as follows: r=0.00 - 0.25 (little or no. L heel. Ball marker. L shoulder ..... Sequential motions of body segments in striking and throwing skills:.

The Effect of Field Dodder (Cuscuta campestris Yunck. on Morphological and Fluorescence Parameters of Giant Ragweed (Ambrosia trifida L.

Directory of Open Access Journals (Sweden)

Sava Vrbničanin

2013-01-01

Full Text Available The effect of the parasitic flowering plant known as field dodder (Cuscuta campestrisYunck. on morphological and fluorescence parameters of infested giant ragweed(Ambrosia trifida L. plants was examined under controlled conditions. The parameters ofchlorophyll fluorescence (Fo, Fv/Fm, ΦPSII, Fv, Fm, ETR and IF were measured on infested (Iand non-infested (N A. trifida plants over a period of seven days, beginning with the day ofinfestation. Morphological parameters (plant height, dry and fresh weight were measuredon the last day of fluorescence measurements. C. campestris was found to affect the height,fresh and dry weight of the infested A. trifida plants, causing significant reduction in plantheight and dry weight. Field dodder also affected several parameters of chlorophyll fluorescence(Fo, Fv/Fm, ΦPSII and Fv in infested A. trifida plants.

Defatting and Sonication Enhances Protein Extraction from Edible Insects.

Science.gov (United States)

Choi, Byoung Deug; Wong, Nathan A K; Auh, Joong-Hyuck

2017-01-01

Edible insects are attracting growing interest as a sustainable source of protein for addition to processed meat and dairy products. The current study investigated the optimal method for protein extraction from mealworm larvae ( Tenebrio molitor ), cricket adults ( Gryllus bimaculatus ), and silkworm pupae ( Bombyx mori ), for use in further applications. After defatting with n-hexane for up to 48 h, sonication was applied for 1-20 min and the protein yield was measured. All samples showed a total residual fat percentage below 1.36%, and a 35% to 94% improvement in protein yield (%). In conclusion, defatting with n-hexane combined with sonication improves the protein yield from insect samples.

Comparisons of eccentric knee flexor strength and asymmetries across elite, sub-elite and school level cricket players

Directory of Open Access Journals (Sweden)

Wade J. Chalker

2016-02-01

Full Text Available Background. There has been a continual increase in injury rates in cricket, with hamstring strain injuries (HSIs being the most prominent. Eccentric knee flexor weakness and bilateral asymmetries are major modifiable risk factors for future HSIs. However, there is a lack of data relating to eccentric hamstring strength in cricket at any skill level. The objective of this study was to compare eccentric knee flexor strength and bilateral asymmetries in elite, sub-elite and school level cricket players; and to determine if playing position and limb role influenced these eccentric knee flexor strength indices. Methods. Seventy four male cricket players of three distinct skill levels performed three repetitions of the Nordic hamstring exercise on the experimental device. Strength was assessed as the absolute and relative mean peak force output for both limbs, with bilateral asymmetries. Differences in mean peak force outputs between skill level and playing positions were measured. Results. There were no significant differences between elite, sub-elite and school level athletes for mean peak force and bilateral asymmetries of the knee flexors. There were no significant differences observed between bowler’s and batter’s mean peak force and bilateral asymmetries. There were no significant differences between front and back limb mean peak force outputs. Discussion. Skill level, playing position and limb role appeared to have no significant effect on eccentric knee flexor strength and bilateral asymmetries. Future research should seek to determine whether eccentric knee flexor strength thresholds are predictive of HSIs in cricket and if specific eccentric knee flexor strengthening can reduce these injuries.

Effect of enzymatic hydrolysis on bioactive properties and allergenicity of cricket (Gryllodes sigillatus) protein.

Science.gov (United States)

Hall, Felicia; Johnson, Philip E; Liceaga, Andrea

2018-10-01

Food-derived bioactive peptides have gained attention for their role in preventing chronic diseases. Edible insects are viable sources of bioactive peptides owing to their high protein content and sustainable production. In this study, whole crickets (Gryllodes sigillatus) were alcalase-hydrolyzed to a degree of hydrolysis (DH) ranging from 15 to 85%. Antioxidant activity, angiotensin converting enzyme (ACE), and dipeptidyl peptidase-4 (DPP-IV)- inhibition of the cricket protein hydrolysates (CPH) were evaluated before and after simulated gastrointestinal digestion (SGD). Antioxidant activity was similar among CPH, whereas ACE and DPP-IV inhibition was greater (p < 0.05) in CPH with 60-85% DH. Bioactivity improved after SGD. CPH allergenicity was evaluated using human shrimp-allergic sera. All sera positively reacted to tropomyosin in the unhydrolyzed cricket and CPH with 15-50% DH, whereas 60-85% DH showed no reactivity. In conclusion, CPH (60-85% DH) had the greatest bioactive potential and lowest reactivity to tropomyosin, compared with other CPH and the unhydrolyzed control. Copyright © 2018 Elsevier Ltd. All rights reserved.

Infective Juveniles of the Entomopathogenic Nematode Steinernema scapterisci Are Preferentially Activated by Cricket Tissue.

Directory of Open Access Journals (Sweden)

Dihong Lu

Full Text Available Entomopathogenic nematodes are a subgroup of insect-parasitic nematodes that are used in biological control as alternatives or supplements to chemical pesticides. Steinernema scapterisci is an unusual member of the entomopathogenic nematode guild for many reasons including that it is promiscuous in its association with bacteria, it can reproduce in the absence of its described bacterial symbiont, and it is known to have a narrow host range. It is a powerful comparative model within the species and could be used to elucidate parasite specialization. Here we describe a new method of efficiently producing large numbers of S. scapterisci infective juveniles (IJs in house crickets and for quantifying parasitic activation of the IJs upon exposure to host tissue using morphological features. We found that parasite activation is a temporal process with more IJs activating over time. Furthermore, we found that activated IJs secrete a complex mixture of proteins and that S. scapterisci IJs preferentially activate upon exposure to cricket tissue, reaffirming the description of S. scapterisci as a cricket specialist.

Random amplified polymorphic DNA markers of the Brassica alboglabra chromosome of a B. campestris-alboglabra addition line

DEFF Research Database (Denmark)

Bagger Jørgensen, Rikke; Chen, B.Y.; Cheng, B.F.

1996-01-01

The alien C-genome chromosome in a Brassica campestris-alboglabra monosomic addition line was characterized by random amplified polymorphic DNA (RAPD) analysis. The alien chromosome carried three loci, E(c), W-c and Lap-1C, controlling synthesis of erucic acid, white flower colour and a fast...

Hair-based flow-sensing inspired by the cricket cercal system

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Droogendijk, H.; Steinmann, T.; Dagamseh, A.M.K.; Jaganatharaja, R.K.; Casas, J.

2014-01-01

Micro Electro Mechanical Systems (MEMS) offer exciting possibilities for the fabri­cation of bioinspired mechanosensors. Over the last years we have been working on cricket inspired hair-sensor arrays for spatio-temporal flow-field observations (i.e., flow-cameras) and source localization. Whereas

Corollary discharge inhibition of wind-sensitive cercal giant interneurons in the singing field cricket

Science.gov (United States)

Hedwig, Berthold

2014-01-01

Crickets carry wind-sensitive mechanoreceptors on their cerci, which, in response to the airflow produced by approaching predators, triggers escape reactions via ascending giant interneurons (GIs). Males also activate their cercal system by air currents generated due to the wing movements underlying sound production. Singing males still respond to external wind stimulation, but are not startled by the self-generated airflow. To investigate how the nervous system discriminates sensory responses to self-generated and external airflow, we intracellularly recorded wind-sensitive afferents and ventral GIs of the cercal escape pathway in fictively singing crickets, a situation lacking any self-stimulation. GI spiking was reduced whenever cercal wind stimulation coincided with singing motor activity. The axonal terminals of cercal afferents showed no indication of presynaptic inhibition during singing. In two ventral GIs, however, a corollary discharge inhibition occurred strictly in phase with the singing motor pattern. Paired intracellular recordings revealed that this inhibition was not mediated by the activity of the previously identified corollary discharge interneuron (CDI) that rhythmically inhibits the auditory pathway during singing. Cercal wind stimulation, however, reduced the spike activity of this CDI by postsynaptic inhibition. Our study reveals how precisely timed corollary discharge inhibition of ventral GIs can prevent self-generated airflow from triggering inadvertent escape responses in singing crickets. The results indicate that the responsiveness of the auditory and wind-sensitive pathway is modulated by distinct CDIs in singing crickets and that the corollary discharge inhibition in the auditory pathway can be attenuated by cercal wind stimulation. PMID:25318763

The effect of central contracts on the stability and performance of the England Test cricket team. [El efecto de contratos centrales sobre la estabilidad y el desempeño del equipo inglés de Test cricket].

Directory of Open Access Journals (Sweden)

Steven Bullough

2014-01-01

Full Text Available In 1999 the England and Wales Cricket Board (ECB decided to implement central contracts for elite player management to give them control over a group of players to represent the England national team in Test cricket. The purpose of this paper is to investigate the impact that this change in policy has had on the stability and performance of the England Test team, and discuss implications thereof. Using a sample of 13 seasons pre-central contracts (1987-1999 and 13 seasons post-central contracts (2000-2012, the results, from secondary analysis of England’s Test match scorecards from both sample periods, allowed investigation of team performance and stability. To gain a greater understanding of how central contracts impacted on the England Test side, eight interviews were also organised with key stakeholders in English cricket. The results showed that both the stability and performance of the England Test side improved considerably in the sample period post-central contracts (2000-2012 with a much greater consistency of selection (fewer changes per match alongside an improvement in England’s on-field performance (better win ratio and points per match. The paper identifies two key challenges facing the current player management system in England from domestic and external sources. Resumen En 1999 El Consejo de Cricket en Inglaterra y Gales (ECB – England and Wales Cricket Board decidió implementar contratos centrales para la dirección de jugadores de élite, con el fin de darle control sobre el grupo de jugadores que representan el equipo nacional de Inglaterra de Test cricket. El objetivo de este artículo es investigar el impacto que este cambio ha tenido sobre la estabilidad y el desempeño del equipo inglés de Test cricket y considerar sus implicaciones. Tras emplear una muestra de 13 temporadas antes de la firma de los contratos centrales (entre 1987 y 1999 y otras 13 temporadas después de su implementación (entre 2000 y 2012, los

Effect of alcoholic extract of guaco (Mikania glomerata on the control of dark rot (Xanthomonas campestris pv. campestris in cauliflower/ Avaliação da eficácia da tintura etanólica de guaco (Mikania glomerata no controle da podridão negra (Xanthomonas campestris pv. campestris em couve-flor

Directory of Open Access Journals (Sweden)

Kátia Regina Freitas Schwan-Estrada

2006-06-01

Full Text Available With the use of irrigation and new hybrids of cauliflower, it is possible to get production during all the year with hight yield. However, the crop has been affected by diseases, as the dark rot caused by X. campestris pv. campestris. The objective of this research work was to study the potential of Mikania glomerata for the control of this disease. Alcoholic extract 50 ºGL of M. glomerata was evaluated regarding to: in vitro antimicrobial activity through bacterial growth in 100, 250, 500 and 1000 mg L-1 of the alcoholic extract; induction of local or systemic resistance in 25 days old cauliflower, with spray of alcoholic extract concomitantly and three days before the inoculation with the pathogen (water and bordeau mixture were used as control; peroxidases activity in leaves of cauliflower treated and not treated, and harvested concomitantly, 24, 48 and 72 hours after spraying the alcoholic extract and also after inoculation. The alcoholic extract of M. glomerata showed inhibition of the bacterial growth in vitro at the concentrations of 250, 500 and 1000 mg L-1. The concentrations of 500 mg L-1 and 1000 mg L-1 inhibited 24% and 38% of the bacterial growth. This inhibition could be due to antibacterial compounds in the alcoholic extract. An inhibition of the disease in vivo occurred only in the leaves treated with 100 and 500 mg L-1 of alcoholic extract when applied concomitantly with the bacteria. This result was similar to bordeau mixture, indicating a control by direct antimicrobial activity. There was no systemic resistence induction for all treatments. The peroxidases induction was due to infectious pathogen process and not to the treatments with alcoholic extract. The results indicate the potential of M. glomerata alcoholic extract for the preventive control of cauliflower dark rot disease.Com a prática da irrigação e novos híbridos de couve-flor, é possível produzir durante todo o ano e com alta produtividade. Mas, a cultura tem

Functional properties of tropical banded cricket (Gryllodes sigillatus) protein hydrolysates.

Science.gov (United States)

Hall, Felicia G; Jones, Owen G; O'Haire, Marguerite E; Liceaga, Andrea M

2017-06-01

Recently, the benefits of entomophagy have been widely discussed. Due to western cultures' reluctance, entomophagy practices are leaning more towards incorporating insects into food products. In this study, whole crickets (Gryllodes sigillatus) were hydrolyzed with alcalase at 0.5, 1.5, and 3.0% (w/w) for 30, 60, and 90min. Degree of hydrolysis (DH), amino acid composition, solubility, emulsion and foaming properties were evaluated. Hydrolysis produced peptides with 26-52% DH compared to the control containing no enzyme (5% DH). Protein solubility of hydrolysates improved (p30% soluble protein at pH 3 and 7 and 50-90% at alkaline pH, compared with the control. Emulsion activity index ranged from 7 to 32m 2 /g, while foamability ranged from 100 to 155% for all hydrolysates. These improved functional properties demonstrate the potential to develop cricket protein hydrolysates as a source of functional alternative protein in food ingredient formulations. Copyright © 2016 Elsevier Ltd. All rights reserved.

Life-history evolution and the microevolution of intermediary metabolism: activities of lipid-metabolizing enzymes in life-history morphs of a wing-dimorphic cricket.

Science.gov (United States)

Zera, Anthony J; Zhao, Zhangwu

2003-03-01

Although a considerable amount of information is available on the ecology, genetics, and physiology of life-history traits, much more limited data are available on the biochemical and genetic correlates of life-history variation within species. Specific activities of five enzymes of lipid biosynthesis and two enzymes of amino acid catabolism were compared among lines selected for flight-capable (LW[f]) versus flightless (SW) morphs of the cricket Gryllus firmus. These morphs, which exist in natural populations, differ genetically in ovarian growth (100-400% higher in SW) and aspects of flight capability including the size of wings and flight muscles, and the concentration of triglyceride flight fuel (40% greater in LW[f]). Consistently higher activity of each enzyme in LW(f) versus SW-selected lines, and strong co-segregation between morph and enzyme activity, demonstrated genetically based co-variance between wing morph and enzyme activity. Developmental profiles of enzyme activities strongly paralleled profiles of triglyceride accumulation during adulthood and previous measures of in vivo lipid biosynthesis. These data strongly imply that genetically based elevation in activities of lipogenic enzymes, and enzymes controlling the conversion of amino acids into lipids, is an important cause underlying the elevated accumulation of triglyceride in the LW(f) morph, a key biochemical component of the trade-off between elevated early fecundity and flight capability. Global changes in lipid and amino-acid metabolism appear to have resulted from microevolutionary alteration of regulators of metabolism. Finally, strong genotype x environment (diet) interactions were observed for most enzyme activities. Future progress in understanding the functional causes of life-history evolution requires a more detailed synthesis of the fields of life-history evolution and metabolic biochemistry. Wing polymorphism is a powerful experimental model in such integrative studies.

Preservation Methods Alter Carbon and Nitrogen Stable Isotope Values in Crickets (Orthoptera: Grylloidea).

Science.gov (United States)

Jesus, Fabiene Maria; Pereira, Marcelo Ribeiro; Rosa, Cassiano Sousa; Moreira, Marcelo Zacharias; Sperber, Carlos Frankl

2015-01-01

Stable isotope analysis (SIA) is an important tool for investigation of animal dietary habits for determination of feeding niche. Ideally, fresh samples should be used for isotopic analysis, but logistics frequently demands preservation of organisms for analysis at a later time. The goal of this study was to establish the best methodology for preserving forest litter-dwelling crickets for later SIA analysis without altering results. We collected two cricket species, Phoremia sp. and Mellopsis doucasae, from which we prepared 70 samples per species, divided among seven treatments: (i) freshly processed (control); preserved in fuel ethanol for (ii) 15 and (iii) 60 days; preserved in commercial ethanol for (iv) 15 and (v) 60 days; fresh material frozen for (vi) 15 and (vii) 60 days. After oven drying, samples were analyzed for δ15N, δ13C values, N(%), C(%) and C/N atomic values using continuous flow isotope ratio mass spectrometry. All preservation methods tested, significantly impacted δ13C and δ15N and C/N atomic values. Chemical preservatives caused δ13C enrichment as great as 1.5‰, and δ15N enrichment as great as 0.9‰; the one exception was M. doucasae stored in ethanol for 15 days, which had δ15N depletion up to 1.8‰. Freezing depleted δ13C and δ15N by up to 0.7 and 2.2‰, respectively. C/N atomic values decreased when stored in ethanol, and increased when frozen for 60 days for both cricket species. Our results indicate that all preservation methods tested in this study altered at least one of the tested isotope values when compared to fresh material (controls). We conclude that only freshly processed material provides adequate SIA results for litter-dwelling crickets.

Preservation Methods Alter Carbon and Nitrogen Stable Isotope Values in Crickets (Orthoptera: Grylloidea.

Directory of Open Access Journals (Sweden)

Fabiene Maria Jesus

Full Text Available Stable isotope analysis (SIA is an important tool for investigation of animal dietary habits for determination of feeding niche. Ideally, fresh samples should be used for isotopic analysis, but logistics frequently demands preservation of organisms for analysis at a later time. The goal of this study was to establish the best methodology for preserving forest litter-dwelling crickets for later SIA analysis without altering results. We collected two cricket species, Phoremia sp. and Mellopsis doucasae, from which we prepared 70 samples per species, divided among seven treatments: (i freshly processed (control; preserved in fuel ethanol for (ii 15 and (iii 60 days; preserved in commercial ethanol for (iv 15 and (v 60 days; fresh material frozen for (vi 15 and (vii 60 days. After oven drying, samples were analyzed for δ15N, δ13C values, N(%, C(% and C/N atomic values using continuous flow isotope ratio mass spectrometry. All preservation methods tested, significantly impacted δ13C and δ15N and C/N atomic values. Chemical preservatives caused δ13C enrichment as great as 1.5‰, and δ15N enrichment as great as 0.9‰; the one exception was M. doucasae stored in ethanol for 15 days, which had δ15N depletion up to 1.8‰. Freezing depleted δ13C and δ15N by up to 0.7 and 2.2‰, respectively. C/N atomic values decreased when stored in ethanol, and increased when frozen for 60 days for both cricket species. Our results indicate that all preservation methods tested in this study altered at least one of the tested isotope values when compared to fresh material (controls. We conclude that only freshly processed material provides adequate SIA results for litter-dwelling crickets.

PECTATE LYASE-LIKE10 is associated with pollen wall development in Brassica campestris.

Science.gov (United States)

Jiang, Jingjing; Yao, Lina; Yu, Youjian; Lv, Meiling; Miao, Ying; Cao, Jiashu

2014-11-01

PECTATE LYASE-LIKE10 (PLL10) was previously identified as one of the differentially expressed genes both in microspores during the late pollen developmental stages and in pistils during the fertilization process in Chinese cabbage (Brassica campestris ssp. chinensis). Here, antisense-RNA was used to study the functions of BcPLL10 in Chinese cabbage. Abnormal pollen was identified in the transgenic lines (bcpll10-4, -5, and -6). In fertilization experiments, fewer seeds were harvested when the antisense-RNA lines were used as pollen donor. In vivo and in vitro pollen germination assays less germinated pollen tubes were observed in bcpll10 lines. Scanning electron microscopy observation verified that the tryphine materials were over accumulated around the pollen surface and sticked them together in bcpll10. Moreover, transmission electron microscopy observation revealed that the internal endintine was overdeveloped and predominantly occupied the intine, and disturbed the normal proportional distribution of the two layers in the non-germinal furrow region; and no obvious demarcation existed between them in the germinal furrow region in the bcpll10 pollen. Collectively, this study presented a novel PLL gene that played an important role during the pollen wall development in B. campestris, which may also possess potential importance for male sterility usage in agriculture. © 2014 Institute of Botany, Chinese Academy of Sciences.

Pyranose Dehydrogenase from Agaricus campestris and Agaricus xanthoderma: Characterization and Applications in Carbohydrate Conversions

Directory of Open Access Journals (Sweden)

Clemens K. Peterbauer

2013-08-01

Full Text Available Pyranose dehydrogenase (PDH is a flavin-dependent sugar oxidoreductase that is limited to a rather small group of litter-degrading basidiomycetes. The enzyme is unable to utilize oxygen as an electron acceptor, using substituted benzoquinones and (organo metal ions instead. PDH displays a broad substrate specificity and intriguing variations in regioselectivity, depending on substrate, enzyme source and reaction conditions. In contrast to the related enzyme pyranose 2-oxidase (POx, PDHs from several sources are capable of oxidizing α- or β-1→4-linked di- and oligosaccharides, including lactose. PDH from A. xanthoderma is able to perform C-1 and C-2 oxidation, producing, in addition to lactobionic acid, 2-dehydrolactose, an intermediate for the production of lactulose, whereas PDH from A. campestris oxidizes lactose nearly exclusively at the C-1 position. In this work, we present the isolation of PDH-encoding genes from A. campestris (Ac and A. xanthoderma (Ax and a comparison of other so far isolated PDH-sequences. Secretory overexpression of both enzymes in Pichia pastoris was successful when using their native signal sequences with yields of 371 U·L−1 for AxPDH and 35 U·L−1 for AcPDH. The pure enzymes were characterized biochemically and tested for applications in carbohydrate conversion reactions of industrial relevance.

The social context of cannibalism in migratory bands of the Mormon cricket.

Directory of Open Access Journals (Sweden)

Sepideh Bazazi

Full Text Available Cannibalism has been shown to be important to the collective motion of mass migratory bands of insects, such as locusts and Mormon crickets. These mobile groups consist of millions of individuals and are highly destructive to vegetation. Individuals move in response to attacks from approaching conspecifics and bite those ahead, resulting in further movement and encounters with others. Despite the importance of cannibalism, the way in which individuals make attack decisions and how the social context affects these cannibalistic interactions is unknown. This can be understood by examining the decisions made by individuals in response to others. We performed a field investigation which shows that adult Mormon crickets were more likely to approach and attack a stationary cricket that was side-on to the flow than either head- or abdomen-on, suggesting that individuals could reduce their risk of an attack by aligning with neighbours. We found strong social effects on cannibalistic behaviour: encounters lasted longer, were more likely to result in an attack, and attacks were more likely to be successful if other individuals were present around a stationary individual. This local aggregation appears to be driven by positive feedback whereby the presence of individuals attracts others, which can lead to further crowding. This work improves our understanding of the local social dynamics driving migratory band formation, maintenance and movement at the population level.

An integrated approach to the biomechanics and motor control of cricket fast bowling techniques.

Science.gov (United States)

Glazier, Paul S; Wheat, Jonathan S

2014-01-01

To date, scientific investigations into the biomechanical aspects of cricket fast bowling techniques have predominantly focused on identifying the mechanical factors that may predispose fast bowlers to lower back injury with a relative paucity of research being conducted on the technical features that underpin proficient fast bowling performance. In this review paper, we critique the scientific literature examining fast bowling performance. We argue that, although many published investigations have provided some useful insights into the biomechanical factors that contribute to a high ball release speed and, to a lesser extent, bowling accuracy, this research has not made a substantive contribution to knowledge enhancement and has only had a very minor influence on coaching practice. To significantly enhance understanding of cricket fast bowling techniques and, therefore, have greater impact on practice, we recommend that future scientific research adopts an interdisciplinary focus, integrating biomechanical measurements with the analytical tools and concepts of dynamical systems motor control theory. The use of qualitative (topological) analysis techniques, in particular, promises to increase understanding of the coordinative movement patterns that define 'technique' in cricket fast bowling and potentially help distinguish between functional and dysfunctional aspects of technique for individual fast bowlers.

Different tissue type categories of overuse injuries to cricket fast ...

African Journals Online (AJOL)

Background. Cricket fast bowlers have a high incidence of injury and have been the subject of previous research investigating the effects of previous injury, workload and technique. Bone stress injuries are of particular concern as they lead to prolonged absences from the game, with younger bowlers appearing to be at ...

Media exposure and sponsor recall: Cricket World Cup 2003 | Van ...

African Journals Online (AJOL)

This paper reports on a study into the relationship between media exposure and sponsor recall relating to an international event, namely the Cricket World Cup 2003 (CWC 2003). The application of sponsorship as a communication construct and recall as a media vehicle effect is investigated. Recall has been widely ...

Isokinetic strength of shoulder internal and external rotators in cricket bowlers

Directory of Open Access Journals (Sweden)

X.M. Mabasa

2002-02-01

Full Text Available The strength of the shoulder internal and external rotators incricket bowlers, may not be sufficient to cope with the demands of bowling.As very little research has been done on cricketers, this study was done to establish the isokinetic strength profile of the shoulder internal andexternal rotators in cricket bowlers.Isokinetic, shoulder rotational strength was evaluated in thirty malecricket volunteers with a mean age of 23.9 years and mean body weight of 70.3 kgs. The Cybex 340 dynamometer multi joint system was used to collect data on shoulder rotation strength in a standing neutral position. Data were collected at four different speeds (60,90,180 and 300deg/sec and were computed for peak torque values for internal and external ratios for both dominant and non dominant shoulders.The results showed no statistically significant difference in the mean shoulder rotational torque between the bowlingand non-bowling shoulders for external rotation (p>0.05, and indicated statistically significant differences in themean shoulder rotational torque between the bowling and non-bowling shoulders for internal rotation (p<0.05. Therewas a significant decrease in isokinetic peak torque production for the external/internal rotator muscles as the speedof contraction increased (p<0.05. The peak torque ratio for the external/internal rotator muscles of the bowling armwere significantly less than of the non-bowling arm (p<0.05. These findings suggest that the strength ratios of thebowling arm need to be considered when managing young cricketers and their injuries.

Irradiation of mushrooms (Agaricus campestris L) to extend their shelf-life

International Nuclear Information System (INIS)

Lescano, G.

1990-01-01

Mushrooms (Agaricus campestris L) were irradiated with 1.0; 2.0 and 3.0 kGy, being then stored either at 10 deg C ± 1 deg C or at room temperature (20 deg C ± 2 deg C), with the purpose of determining the most convenient condition to extend their shelf-life. It is concluded that 3.0 kGy and 10 deg C are the most suitable for that, leading to the inhibition of cap opening and stem elongation, less darkening and no evidence of fungal development until 17th day. Subsequentely almost a duplication of their shelf-life was obtained. (Author) [es

Induced polyploidization in Brassica campestris L. (Brassicaceae).

Science.gov (United States)

Kumar, G; Dwivedi, K

2014-01-01

Present experimental design has been made up to obtain crop with higher ploidy level via synthetic polyploidization. Since ploidy manipulation is generally associated with the obtainment of some increased enviable traits of the crop and also provides them greater adaptability to unfavorable or harsh circumstances as compared to its diploids counterparts. Thus, herein present research autotetraploids of Brassica campestris L. have been lucratively achieved by the application of colchicine. Two methods of treatment were utilized i.e. seed treatment and seedling treatment. No polyploidy could be obtained through seed treatment while seedling treatment responded well towards polyploidy. However, the status of autotetraploidy has been confirmed by cytomorphological investigations of treated plants as against its diploids counterparts. For the purpose, morphological parameters such as increased stomata size, pollen diameter, flower size, reproductive organs whereas reduction in plant height, leaf length, leaf breadth, stomata frequency, number of flowers/inflorescence etc. were appraised. Further, cytological observations were made that had clearly revealed the doubling of genome in the autotetraploids as compared to diploids. Meanwhile, pollen fertility and size of pollen grains were evaluated as well.

STOCHASTIC DOMINANCE AND ANALYSIS OF ODI BATTING PERFORMANCE: THE INDIAN CRICKET TEAM, 1989-2005

Directory of Open Access Journals (Sweden)

Uday Damodaran

2006-12-01

Full Text Available Relative to other team games, the contribution of individual team members to the overall team performance is more easily quantifiable in cricket. Viewing players as securities and the team as a portfolio, cricket thus lends itself better to the use of analytical methods usually employed in the analysis of securities and portfolios. This paper demonstrates the use of stochastic dominance rules, normally used in investment management, to analyze the One Day International (ODI batting performance of Indian cricketers. The data used span the years 1989 to 2005. In dealing with cricketing data the existence of 'not out' scores poses a problem while processing the data. In this paper, using a Bayesian approach, the 'not-out' scores are first replaced with a conditional average. The conditional average that is used represents an estimate of the score that the player would have gone on to score, if the 'not out' innings had been completed. The data thus treated are then used in the stochastic dominance analysis. To use stochastic dominance rules we need to characterize the 'utility' of a batsman. The first derivative of the utility function, with respect to runs scored, of an ODI batsman can safely be assumed to be positive (more runs scored are preferred to less. However, the second derivative needs not be negative (no diminishing marginal utility for runs scored. This means that we cannot clearly specify whether the value attached to an additional run scored is lesser at higher levels of scores. Because of this, only first-order stochastic dominance is used to analyze the performance of the players under consideration. While this has its limitation (specifically, we cannot arrive at a complete utility value for each batsman, the approach does well in describing player performance. Moreover, the results have intuitive appeal

Big Hitters: Important Factors Characterizing Team Effectiveness in Professional Cricket

Directory of Open Access Journals (Sweden)

Leonie V. Webster

2017-07-01

Full Text Available While organizational psychology attests to the multidimensional nature of team effectiveness, insight regarding the most important factors contributing to the effectiveness of sports teams, especially elite teams, is lacking. An abductive method of qualitative enquiry was adopted to capture participants' construal of team effectiveness, drawing on the extant literature in both sport and organizational psychology. Semi-structured interviews were conducted with 21 players, coaches, and psychologists involved in elite cricket, with resultant data analyzed inductively initially, before being reanalyzed deductively. Although, the narratives endorsed the value of many of the deductively derived factors, other constructs more prominent in organizational psychology (e.g., trust and intra-group conflict appeared to be more important than traditional sport psychology group factors. The results revealed six broad themes; culture and environment, values, communication, understanding, leadership, and unique individuals, with some gender differences apparent throughout. Based on our elite sample's construal of team effectiveness, we propose a new model representing a practical, parsimonious, and novel conceptualization of the most important attributes of team effectiveness in cricket, with conceivable transferability to other team sports.

The cricket and the ant : Organizational trade-offs in changing environments

NARCIS (Netherlands)

Peli, Gabor; Bruggeman, Jeroen

2007-01-01

Organizations face trade-offs when they adopt strategies in changing resource environments. The type of trade-off depends on the type of resource change. This paper offers an organizational trade-off model for quantitative resource changes. We call it the "Cricket and Ant" (CA) model, because the

Tranformasi Fragmen Dna Kromosom Xanthomonas Campestris ke dalam Escherichia Coli

Directory of Open Access Journals (Sweden)

Wibowo Mangunwardoyo

2002-04-01

Full Text Available Research on DNA transformation of Xanthomonas campestris into Escherichia coli DH5αα using plasmid vector Escherichia coli (pUC19. was carried out. DNA chromosome was isolated using CTAB method, alkali lysis method was used to isolate DNA plasmid. Both of DNA plasmid and chromosome were digested using restriction enzyme EcoRI. Competent cell was prepared with CaCl2 and heat shock method for transformation procedure. The result revealed transformation obtain 5 white colonies, with transformation frequency was 1,22 x 10-8 colony/competent cell. Electrophoresis analysis showed the DNA fragment (insert in range 0.5 – 7,5 kb. Further research should be carried out to prepare the genomic library to obtain better result of transformant.

Effect of Ball Weight on Speed, Accuracy, and Mechanics in Cricket Fast Bowling

Directory of Open Access Journals (Sweden)

Katharine L. Wickington

2017-02-01

Full Text Available The aims of this study were: (1 to quantify the acute effects of ball weight on ball release speed, accuracy, and mechanics in cricket fast bowling; and (2 to test whether a period of sustained training with underweight and overweight balls is effective in increasing a player’s ball release speed. Ten well-trained adult male cricket players performed maximum-effort deliveries using balls ranging in weight from 46% to 137% of the standard ball weight (156 g. A radar gun, bowling target, and 2D video analysis were used to obtain measures of ball speed, accuracy, and mechanics. The participants were assigned to either an intervention group, who trained with underweight and overweight balls, or to a control group, who trained with standard-weight balls. We found that ball speed decreased at a rate of about 1.1 m/s per 100 g increase in ball weight. Accuracy and bowling mechanics were not adversely affected by changes in ball weight. There was evidence that training with underweight and overweight balls might have produced a practically meaningful increase in bowling speed (>1.5 m/s in some players without compromising accuracy or increasing their risk of injury through inducing poor bowling mechanics. In cricket fast bowling, a wide range of ball weight might be necessary to produce an effective modified-implement training program.

Inducible Expression of the De-Novo Designed Antimicrobial Peptide SP1-1 in Tomato Confers Resistance to Xanthomonas campestris pv. vesicatoria.

Directory of Open Access Journals (Sweden)

Areli Herrera Diaz

Full Text Available Antimicrobial peptides (AMPs are small peptides with less than 50 amino acids and are part of the innate immune response in almost all organisms, including bacteria, vertebrates, invertebrates and plants. AMPs are active against a broad-spectrum of pathogens. The inducible expression of AMPs in plants is a promising approach to combat plant pathogens with minimal negative side effects, such as phytotoxicity or infertility. In this study, inducible expression of the de-novo designed AMP SP1-1 in Micro Tom tomato protected tomato fruits against bacterial spot disease caused by Xanthomonas campestris pv. vesicatoria. The peptide SP1-1 was targeted to the apoplast which is the primary infection site for plant pathogens, by fusing SP1-1 peptide to the signal peptide RsAFP1 of radish (Raphanus sativus. The pathogen inducibility of the expression was enabled by using an optimized inducible 4XW2/4XS promoter. As a result, the tomato fruits of independently generated SP1-1 transgenic lines were significantly more resistant to X. campestris pv. vesicatoria than WT tomato fruits. In transgenic lines, bacterial infection was reduced up to 65% in comparison to the infection of WT plants. Our study demonstrates that the combination of the 4XW2/4XS cis-element from parsley with the synthetic antimicrobial peptide SP1-1 is a good alternative to protect tomato fruits against infections with X. campestris pv. vesicatoria.

Development of immunofluorescence colony staining (IFC) for detection of Xanthomonas campestris pv. vesicatoria and Clavibacter michiganensis subsp michiganensis in tomato seeds

NARCIS (Netherlands)

Nemeth, J.; Vuurde, van J.W.L.

2006-01-01

Immunofluorescence colony-staining (IFC) is based on sample pour plating in combination with immunofluorescence staining for recognition of the target colony. IFC was optimised for detecting Xanthomonas campestris pv. vesicatoria (Xcv) and Clavibacter michiganensis subsp. michiganensis (Cmm) in

Arabinogalactan Proteins Accumulate in the Cell Walls of Searching Hyphae of the Stem Parasitic Plants, Cuscuta campestris and Cuscuta japonica.

Science.gov (United States)

Hozumi, Akitaka; Bera, Subhankar; Fujiwara, Daiki; Obayashi, Takeshi; Yokoyama, Ryusuke; Nishitani, Kazuhiko; Aoki, Koh

2017-11-01

Stem parasitic plants (Cuscuta spp.) develop a specialized organ called a haustorium to penetrate their hosts' stem tissues. To reach the vascular tissues of the host plant, the haustorium needs to overcome the physical barrier of the cell wall, and the parasite-host interaction via the cell wall is a critical process. However, the cell wall components responsible for the establishment of parasitic connections have not yet been identified. In this study, we investigated the spatial distribution patterns of cell wall components at a parasitic interface using parasite-host complexes of Cuscuta campestris-Arabidopsis thaliana and Cuscuta japonica-Glycine max. We focused on arabinogalactan proteins (AGPs), because AGPs accumulate in the cell walls of searching hyphae of both C. campestris and C. japonica. We found more AGPs in elongated haustoria than in pre haustoria, indicating that AGP accumulation is developmentally regulated. Using in situ hybridization, we identified five genes in C. campestris that encode hyphal-expressed AGPs that belong to the fasciclin-like AGP (FLA) family, which were named CcFLA genes. Three of the five CcFLA genes were expressed in the holdfast, which develops on the Cuscuta stem epidermis at the attachment site for the host's stem epidermis. Our results suggest that AGPs are involved in hyphal elongation and adhesion to host cells, and in the adhesion between the epidermal tissues of Cuscuta and its host. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

How females of chirping and trilling field crickets integrate the 'what' and 'where' of male acoustic signals during decision making.

Science.gov (United States)

Gabel, Eileen; Gray, David A; Matthias Hennig, R

2016-11-01

In crickets acoustic communication serves mate selection. Female crickets have to perceive and integrate male cues relevant for mate choice while confronted with several different signals in an acoustically diverse background. Overall female decisions are based on the attractiveness of the temporal pattern (informative about the 'what') and on signal intensity (informative about the 'where') of male calling songs. Here, we investigated how the relevant cues for mate choice are integrated during the decision process by females of five different species of chirping and trilling field crickets. Using a behavioral design, female preferences in no-choice and choice situations for male calling songs differing in pulse rate, modulation depth, intensities, chirp/trill arrangements and temporal shifts were examined. Sensory processing underlying decisions in female field crickets is rather similar as combined evidence suggested that incoming song patterns were analyzed separately by bilaterally paired networks for pattern attractiveness and pattern intensity. A downstream gain control mechanism leads to a weighting of the intensity cue by pattern attractiveness. While remarkable differences between species were observed with respect to specific processing steps, closely related species exhibited more similar preferences than did more distantly related species.

A measure for the batting performance of cricket players : research ...

African Journals Online (AJOL)

A single measure that can be used to assess the performance of batsmen in cricket is defined. This study shows how it can be used to rank batsmen. The batting ability of a batsman is generally measured by means of his average. His strike rate is, however, also very important and is often looked at as well. It will furthermore ...

The inheritance of resistance to bacterial leaf spot of lettuce caused by Xanthomonas campestris pv. vitians in three lettuce cultivars

Science.gov (United States)

Lettuce yields can be reduced by the disease bacterial leaf spot (BLS) caused by the pathogen Xanthomonas campestris pv. vitians (Xcv) and host resistance is the most feasible method to reduce disease losses. The cultivars La Brillante, Pavane, and Little Gem express an incompatible host-pathogen in...

Acoustic comunication systems and sounds in three species of crickets from central Italy: musical instruments for a three-voices composition

Science.gov (United States)

Monacchi, David; Valentini, Laura

2016-04-01

Natural soundscape has always constituted a reference in cognitive and emotional processes. The imitation of natural sounds contributed to the origin of the verbal language, which has been then subjected to an even more refined process of abstraction throughout history. The musical language also evolved along the same path of imitation. Among the many sonic elements of a natural environment, the stridulation of crickets is one of the most consistent for its timbre, articulation, diffusion and intrinsic emotional power. More than 900 species of crickets, in fact, have been described. They can be found in all parts of the world with the exception of cold regions at latitudes higher than 55° North and South. Among the many species we're working on (Order Orthoptera and Suborder Ensifera), we refer here of a comparison between the morphology of the acoustic emission systems and the corresponding waveforms/spectral patterns of sound in three widespread species from central Italy: Gryllus Bimaculatus, Acheta Domesticus (Gryllidae), and Ruspolia Nitidula (Conocephalidae). The samples of the acoustic apparatus of the target individuals, stored in ethanol, were observed under a Field Emission Gun Environmental Electron Scanning Microscope (FEG-ESEM, Quanta 200, FEI, The Netherlands). The use of this type of microscope allowed to analyze the samples without any kind of manipulation (dehydration and/or metallization), while maintaining the morphological features of the fragile acoustic apparatus. The observations were made with different sensors (SE: secondary-electron sensor and BSE: backscattered-electron sensor), and performed at low-medium vacuum with energies varying from c.ca 10 to 30kV. Male individuals have an acoustic apparatus consisting in two cuticular structures (tegmina) positioned above wings, while both male and females have receiving organs (tympanum) in forelegs. Stridulation mechanism is produced when the file and the scraper (plectrum) scrub one another

Biological Functions of ilvC in Branched-Chain Fatty Acid Synthesis and Diffusible Signal Factor Family Production in Xanthomonas campestris

Directory of Open Access Journals (Sweden)

Kai-Huai Li

2017-12-01

Full Text Available In bacteria, the metabolism of branched-chain amino acids (BCAAs is tightly associated with branched-chain fatty acids (BCFAs synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc genome. We characterized gene functions in BCFAs biosynthesis and production of the diffusible signal factor (DSF family signals. Disruption of ilvC caused Xcc to become auxotrophic for valine and isoleucine, and lose the ability to synthesize BCFAs via carbohydrate metabolism. Furthermore, ilvC mutant reduced the ability to produce DSF-family signals, especially branched-chain DSF-family signals, which might be the main reason for Xcc reduction of pathogenesis toward host plants. In this report, we confirmed that BCFAs do not have major functions in acclimatizing Xcc cells to low temperatures.

Deduction of upstream sequences of Xanthomonas campestris flagellar genes responding to transcription activation by FleQ

International Nuclear Information System (INIS)

Hu, R.-M.; Yang, T.-C.; Yang, S.-H.; Tseng, Y.-H.

2005-01-01

Xanthomonas campestris pv. campestris (Xcc), a close relative to Pseudomonas aeruginosa, is the pathogen causing black rot in cruciferous plants. In P. aeruginosa, FleQ serves as a cognate activator of σ 54 in transcription from several σ 54 -dependent promoters of flagellar genes. These P. aeruginosa promoters have been analyzed for FleQ-binding sequences; however, no consensus was deduced. Xcc, although lacks fleSR, has a fleQ homologue residing among over 40 contiguously clustered flagellar genes. A fleQ mutant, Xc17fleQ, constructed by insertional mutation is deficient in FleQ protein, non-flagellated, and immobile. Transcriptional fusion assays on six putative σ 54 -dependent promoters of the flagellar genes, fliE, fliQ, fliL, flgG, flgB, and flhF, indicated that each of them is also FleQ dependent. Each of these promoters has a sequence with weak consensus to 5'-gaaacCCgccgCcgctTt-3', immediately upstream of the predicted σ 54 -binding site, with an imperfect inverted repeat containing a GC-rich center flanked by several A and T at 5'- and 3'-ends, respectively. Replacing this region in fliE promoter with a HindIII recognition sequence abolished the transcription, indicating that this region responds to transcription activation by FleQ

Static and dynamic balance ability, lumbo-pelvic movement control and injury incidence in cricket pace bowlers.

Science.gov (United States)

Olivier, B; Stewart, A V; Olorunju, S A S; McKinon, W

2015-01-01

This study aimed to establish the difference in lumbo-pelvic movement control, static and dynamic balance at the start and at the end of a cricket season in pace bowlers who sustained an injury during the season and those who did not. This is a longitudinal, observational study. Thirty-two, healthy, injury free, male premier league fast, fast-medium and medium pace bowlers between the ages of 18 and 26 years (mean age 21.8 years, standard deviation 1.8 years) participated in the study. The main outcome measures were injury incidence, lumbo-pelvic movement control, static and dynamic balance ability. Fifty-three percent of the bowlers (n=17) sustained injuries during the reviewed cricket season. Lumbo-pelvic movement control tests could not discriminate between bowlers who sustained an injury during the cricket season and bowlers who did not. However, performance in the single leg balance test (p=0.03; confidence interval 4.74-29.24) and the star excursion balance test (p=0.02; confidence interval 1.28-11.93) as measured at the start of the season was better in bowlers who did not sustain an injury during the season. The improvement in the lumbo-pelvic movement control and balance tests suggests that the intensity and type of physical conditioning that happens throughout the season may have been responsible for this improvement. Poor performance in the single leg balance test and the star excursion balance test at the start of the cricket season may be an indication that a bowler is at heightened risk of injury. Copyright © 2013 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

Volatiles and Nonvolatiles in Flourensia campestris Griseb. (Asteraceae), How Much Do Capitate Glandular Trichomes Matter?

Science.gov (United States)

Piazza, Leonardo A; López, Daniela; Silva, Mariana P; López Rivilli, Marisa J; Tourn, Mónica G; Cantero, Juan J; Scopel, Ana L

2018-03-01

The distribution and ultrastructure of capitate glandular trichomes (GTs) in Flourensia species (Asteraceae) have been recently elucidated, but their metabolic activity and potential biological function remain unexplored. Selective nonvolatile metabolites from isolated GTs were strikingly similar to those found on leaf surfaces. The phytotoxic allelochemical sesquiterpene (-)-hamanasic acid A ((-)-HAA) was the major constituent (ca. 40%) in GTs. Although GTs are quaternary ammonium compounds (QACs)-accumulating species, glycine betaine was not found in GTs; it was only present in the leaf mesophyll. Two (-)-HAA accompanying surface secreted products: compounds 4-hydroxyacetophenone (piceol; 1) and 2-hydroxy-5-methoxyacetophenone (2), which were isolated and fully characterized (GC/MS, NMR), were present in the volatiles found in GTs. The essential oils of fresh leaves revealed ca. 33% monoterpenes, 26% hydrocarbon- and 30% oxygenated sesquiterpenes, most of them related to cadinene and bisabolene derivatives. Present results suggest a main role of GTs in determining the volatile and nonvolatile composition of F. campestris leaves. Based on the known activities of the compounds identified, it can be suggested that GTs in F. campestris would play key ecological functions in plant-pathogen and plant-plant interactions. In addition, the strikingly high contribution of compounds derived from cadinene and bisabolene pathways, highlights the potential of this species as a source of high-valued bioproducts. © 2018 Wiley-VHCA AG, Zurich, Switzerland.

Understanding the link between sexual selection, sexual conflict and aging using crickets as a model.

Science.gov (United States)

Archer, C Ruth; Hunt, John

2015-11-01

Aging evolved because the strength of natural selection declines over the lifetime of most organisms. Weak natural selection late in life allows the accumulation of deleterious mutations and may favor alleles that have positive effects on fitness early in life, but costly pleiotropic effects expressed later on. While this decline in natural selection is central to longstanding evolutionary explanations for aging, a role for sexual selection and sexual conflict in the evolution of lifespan and aging has only been identified recently. Testing how sexual selection and sexual conflict affect lifespan and aging is challenging as it requires quantifying male age-dependent reproductive success. This is difficult in the invertebrate model organisms traditionally used in aging research. Research using crickets (Orthoptera: Gryllidae), where reproductive investment can be easily measured in both sexes, has offered exciting and novel insights into how sexual selection and sexual conflict affect the evolution of aging, both in the laboratory and in the wild. Here we discuss how sexual selection and sexual conflict can be integrated alongside evolutionary and mechanistic theories of aging using crickets as a model. We then highlight the potential for research using crickets to further advance our understanding of lifespan and aging. Copyright © 2015 Elsevier Inc. All rights reserved.

Baby leaf lettuce germplasm enhancement: developing diverse populations with resistance to bacterial leaf spot caused by Xanthomonas campestris pv. vitians

Science.gov (United States)

Baby leaf lettuce cultivars with resistance to bacterial leaf spot (BLS) caused by Xanthomonas campestris pv. vitians (Xcv) are needed to reduce crop losses. The objectives of this research were to assess the genetic diversity for BLS resistance in baby leaf lettuce cultivars and to select early gen...

Structure of the afferent terminals in terminal ganglion of a cricket and persistent homology.

Directory of Open Access Journals (Sweden)

Jacob Brown

Full Text Available We use topological data analysis to investigate the three dimensional spatial structure of the locus of afferent neuron terminals in crickets Acheta domesticus. Each afferent neuron innervates a filiform hair positioned on a cercus: a protruding appendage at the rear of the animal. The hairs transduce air motion to the neuron signal that is used by a cricket to respond to the environment. We stratify the hairs (and the corresponding afferent terminals into classes depending on hair length, along with position. Our analysis uncovers significant structure in the relative position of these terminal classes and suggests the functional relevance of this structure. Our method is very robust to the presence of significant experimental and developmental noise. It can be used to analyze a wide range of other point cloud data sets.

Chemical characterization of Xanthan biopolymers synthesized by Xanthomonas campestris pv pruni strains

International Nuclear Information System (INIS)

Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia; Galland, Griselda

2001-01-01

In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The 13 C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)

Which Extrinsic and Intrinsic Factors are Associated with Non-Contact Injuries in Adult Cricket Fast Bowlers?

Science.gov (United States)

Olivier, Benita; Taljaard, Tracy; Burger, Elaine; Brukner, Peter; Orchard, John; Gray, Janine; Botha, Nadine; Stewart, Aimee; Mckinon, Warrick

2016-01-01

The high prevalence of injury amongst cricket fast bowlers exposes a great need for research into the risk factors associated with injury. Both extrinsic (environment-related) and intrinsic (person-related) risk factors are likely to be implicated within the high prevalence of non-contact injury amongst fast bowlers in cricket. Identifying and defining the relative importance of these risk factors is necessary in order to optimize injury prevention efforts. The objective of this review was to assess and summarize the scientific literature related to the extrinsic and intrinsic factors associated with non-contact injury inherent to adult cricket fast bowlers. A systematic review was performed in compliance with the PRISMA guidelines. This review considered both experimental and epidemiological study designs. Studies that included male cricket fast bowlers aged 18 years or above, from all levels of play, evaluating the association between extrinsic/intrinsic factors and injury in fast bowlers were considered for inclusion. The three-step search strategy aimed at finding both published and unpublished studies from all languages. The searched databases included MEDLINE via PubMed, Cumulative Index to Nursing and Allied Health Literature (CINAHL), the Cochrane Controlled Trials Register in the Cochrane Library, Physiotherapy Evidence Database (PEDro), ProQuest 5000 International, ProQuest Health and Medical Complete, EBSCO MegaFile Premier, Science Direct, SPORTDiscus with Full Text and SCOPUS (prior to 28 April 2015). Initial keywords used were 'cricket', 'pace', 'fast', 'bowler', and 'injury'. Papers which fitted the inclusion criteria were assessed by two independent reviewers for methodological validity prior to inclusion in the review using standardized critical appraisal instruments from the Joanna Briggs Institute Meta Analysis of Statistics Assessment and Review Instrument (JBI-MAStARI). A total of 16 studies were determined to be suitable for inclusion in this

Pupation Behavior and Predation on Drosophila suzukii (Diptera: Drosophilidae) Pupae in Maine Wild Blueberry Fields.

Science.gov (United States)

Ballman, Elissa S; Collins, Judith A; Drummond, Francis A

2017-12-05

Drosophila suzukii (Matsumura; Diptera: Drosophilidae) is an invasive vinegar fly and pest of soft fruits in North America, including wild blueberries (Vaccinium angustifolium Aiton) in Maine. Despite its presence in the continental United States for 9 yr, little is known about its natural enemy complex. Here we report the results of a 3-yr study designed to identify naturally-occurring predators in Maine's wild blueberry fields. Experiments were conducted to determine pupation site and pupation depth to understand D. suzukii's predation vulnerability. Predation rates in the field of fully-exposed, caged, and buried pupae were measured. Pitfall traps were deployed to identify the potential predator assemblage, and laboratory experiments were conducted to determine how many pupae were consumed by commonly occurring ground beetle species (Carabidae) and field crickets (Gryllus pennsylvanicus Burmeister). The most commonly collected predators were ants, ground beetles, harvestmen, and field crickets. Significantly more pupae were found to occur in the soil compared to blueberry fruit, with most pupae in the top 0.5 cm layer of soil. Pupal predation rates in the field were high, with higher rates of predation on exposed pupae compared to buried pupae. Laboratory studies revealed that ground beetles and field crickets are likely predators of D. suzukii pupae. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Influence of agitation and aeration in xanthan production by Xanthomonas campestris pv pruni strain 101 Influencia de la agitación y la aireación en la producción de xantano por Xanthomonas campestris pv. pruni cepa 101

Directory of Open Access Journals (Sweden)

C. D. Borges

2008-06-01

Full Text Available Production, viscosity, and chemical composition of xanthan synthesized by bacterium Xanthomonas campestris pv pruni strain 101 were evaluated in bioreactor systems. During the process, the volumetric oxygen mass transfer coefficient (kLa and the biomass were determined and the pH was monitored. The cultures were grown in a 3 l bioreactor, with aeration and agitation varying as follows: conditions (A 300 rpm, 3 vvm and (B 200 rpm, 2 vvm, at 28 °C. Our results showed that gum production was dependent on kLa, with a maximum yield of 8.15 g/l at 300 rpm, 3 vvm, 54 h of fermentation, kLa 21.4/h, while biomass was not affected. All aqueous solutions of 3% (w/v xanthans synthesized showed a pseudoplastic behavior. The highest viscosity was reached under the strongest aeration/agitation conditions. All xanthan samples contained glucose, mannose, rhamnose, and glucuronic acid as their main components. The highest agitation and aeration rates used under condition A (300 rpm and 3 vvm favorably influenced the yield and viscosity of the xanthan produced by bacterium X. campestris pv pruni 101 at different fermentation times.Se evaluó la producción, viscosidad y composición química del xantano sintetizado por la bacteria Xanthomonas campestris pv. pruni cepa 101 en un fermentador. Durante el proceso se controló el pH y se determinaron el coeficiente de transferencia de masa de oxígeno (kLa y la producción de masa celular seca. Los cultivos se realizaron en un fermentador de 3 l variando la aireación y la agitación, en las siguientes condiciones: (A 300 rpm, 3 vvm y (B 200 rpm, 2 vvm; a 28 °C. Nuestros resultados mostraron que la producción de goma fue dependiente del kLa, con un rendimiento máximo de 8,15 g/l a 300 rpm y 3 vvm a las 54 h de fermentación, kLa de 21,4/h, mientras que la producción de biomasa no se afectó. Todas las soluciones acuosas de xantano al 3% (m/v sintetizadas presentaron comportamiento pseudoplástico. La mayor

Constant illumination reduces circulating melatonin and impairs immune function in the cricket Teleogryllus commodus

Directory of Open Access Journals (Sweden)

Joanna Durrant

2015-07-01

Full Text Available Exposure to constant light has a range of negative effects on behaviour and physiology, including reduced immune function in both vertebrates and invertebrates. It is proposed that the associated suppression of melatonin (a ubiquitous hormone and powerful antioxidant in response to the presence of light at night could be an underlying mechanistic link driving the changes to immune function. Here, we investigated the relationship between constant illumination, melatonin and immune function, using a model invertebrate species, the Australian black field cricket, Teleogryllus commodus. Crickets were reared under either a 12 h light: 12 h dark regimen or a constant 24 h light regimen. Circulating melatonin concentration and immune function (haemocyte concentration, lytic activity and phenoloxidase (PO activity were assessed in individual adult crickets through the analysis of haemolymph. Constant illumination reduced melatonin and had a negative impact on haemocyte concentrations and lytic activity, but its effect on PO activity was less apparent. Our data provide the first evidence, to our knowledge, of a link between exposure to constant illumination and variation in haemocyte concentration in an invertebrate model, while also highlighting the potential complexity of the immune response following exposure to constant illumination. This study provides insight into the possible negative effect of artificial night-time lighting on the physiology of invertebrates, but whether lower and potentially more ecologically relevant levels of light at night produce comparable results, as has been reported in several vertebrate taxa, remains to be tested.

Effects of hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) metabolites on cricket (Acheta domesticus) survival and reproductive success

Energy Technology Data Exchange (ETDEWEB)

Zhang Baohong [Institute of Environmental and Human Health (TIEHH), and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States); Freitag, Christina M. [Institute of Environmental and Human Health (TIEHH), and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States); Canas, Jaclyn E. [Institute of Environmental and Human Health (TIEHH), and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States); Cheng Qiuqiong [Institute of Environmental and Human Health (TIEHH), and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States); Anderson, Todd A. [Institute of Environmental and Human Health (TIEHH), and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)]. E-mail: todd.anderson@tiehh.ttu.edu

2006-11-15

The effect of two major hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) metabolites, hexahydro-1-nitroso-3,5-dinitro-1,3,5-triazine (MNX) and hexahydro-1,3,5-trinitroso-1,3,5-triazine (TNX), on cricket (Acheta domesticus) survival and reproduction was studied. RDX metabolites did not have adverse effects on cricket survival, growth, and egg production. However, MNX and TNX did affect egg hatching. MNX and TNX were more toxic in spiked-sand than in topical tests. TNX was more toxic to egg than MNX. Developmental stage and exposure time affected hatching. After 30 days exposure to MNX or TNX, the EC{sub 2}, EC{sub 5}, and EC{sub 95} were 47, 128, and 247 {mu}g/g for TNX, and 65, 140, and 253 {mu}g/g for MNX in topical tests. The ECs for 20, 50, and 95 were 21, 52, and 99 {mu}g/g for MNX, and 12, 48, and 97 {mu}g/g for TNX in sand. No gross abnormalities in cricket nypmhs were observed in all experiments indicating that neither TNX or MNX is teratogenic in this assay. - RDX metabolites did not have adverse effects on cricket survival, growth, and egg production, but adversely affected egg hatching.

Effects of hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) metabolites on cricket (Acheta domesticus) survival and reproductive success

International Nuclear Information System (INIS)

Zhang Baohong; Freitag, Christina M.; Canas, Jaclyn E.; Cheng Qiuqiong; Anderson, Todd A.

2006-01-01

The effect of two major hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) metabolites, hexahydro-1-nitroso-3,5-dinitro-1,3,5-triazine (MNX) and hexahydro-1,3,5-trinitroso-1,3,5-triazine (TNX), on cricket (Acheta domesticus) survival and reproduction was studied. RDX metabolites did not have adverse effects on cricket survival, growth, and egg production. However, MNX and TNX did affect egg hatching. MNX and TNX were more toxic in spiked-sand than in topical tests. TNX was more toxic to egg than MNX. Developmental stage and exposure time affected hatching. After 30 days exposure to MNX or TNX, the EC 2 , EC 5 , and EC 95 were 47, 128, and 247 μg/g for TNX, and 65, 140, and 253 μg/g for MNX in topical tests. The ECs for 20, 50, and 95 were 21, 52, and 99 μg/g for MNX, and 12, 48, and 97 μg/g for TNX in sand. No gross abnormalities in cricket nypmhs were observed in all experiments indicating that neither TNX or MNX is teratogenic in this assay. - RDX metabolites did not have adverse effects on cricket survival, growth, and egg production, but adversely affected egg hatching

Hepatoprotective Effect of Cuscuta campestris Yunck. Whole Plant on Carbon Tetrachloride Induced Chronic Liver Injury in Mice.

Science.gov (United States)

Peng, Wen-Huang; Chen, Yi-Wen; Lee, Meng-Shiou; Chang, Wen-Te; Tsai, Jen-Chieh; Lin, Ying-Chih; Lin, Ming-Kuem

2016-12-07

Cuscuta seeds and whole plant have been used to nourish the liver and kidney. This study was aimed to investigate the hepatoprotective activity of the ethanol extract of Cuscuta campestris Yunck. whole plant (CC EtOH ). The hepatoprotective effect of CC EtOH (20, 100 and 500 mg/kg) was evaluated on carbon tetrachloride (CCl₄)-induced chronic liver injury. Serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol were measured and the fibrosis was histologically examined. CC EtOH exhibited a significant inhibition of the increase of serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol. Histological analyses showed that fibrosis of liver induced by CCl₄ were significantly reduced by CC EtOH . In addition, 20, 100 and 500 mg/kg of the extract decreased the level of malondialdehyde (MDA) and enhanced the activities of anti-oxidative enzymes including superoxide dismutase (SOD), glutathione peroxidase (GPx) and glutathione reductase (GRd) in the liver. We demonstrate that the hepatoprotective mechanisms of CC EtOH were likely to be associated to the decrease in MDA level by increasing the activities of antioxidant enzymes such as SOD, GPx and GRd. In addition, our findings provide evidence that C. campestris Yunck. whole plant possesses a hepatoprotective activity to ameliorate chronic liver injury.

Hepatoprotective Effect of Cuscuta campestris Yunck. Whole Plant on Carbon Tetrachloride Induced Chronic Liver Injury in Mice

Directory of Open Access Journals (Sweden)

Wen-Huang Peng

2016-12-01

Full Text Available Cuscuta seeds and whole plant have been used to nourish the liver and kidney. This study was aimed to investigate the hepatoprotective activity of the ethanol extract of Cuscuta campestris Yunck. whole plant (CCEtOH. The hepatoprotective effect of CCEtOH (20, 100 and 500 mg/kg was evaluated on carbon tetrachloride (CCl4-induced chronic liver injury. Serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol were measured and the fibrosis was histologically examined. CCEtOH exhibited a significant inhibition of the increase of serum alanine aminotransferase, aspartate aminotransferase, triglyceride and cholesterol. Histological analyses showed that fibrosis of liver induced by CCl4 were significantly reduced by CCEtOH. In addition, 20, 100 and 500 mg/kg of the extract decreased the level of malondialdehyde (MDA and enhanced the activities of anti-oxidative enzymes including superoxide dismutase (SOD, glutathione peroxidase (GPx and glutathione reductase (GRd in the liver. We demonstrate that the hepatoprotective mechanisms of CCEtOH were likely to be associated to the decrease in MDA level by increasing the activities of antioxidant enzymes such as SOD, GPx and GRd. In addition, our findings provide evidence that C. campestris Yunck. whole plant possesses a hepatoprotective activity to ameliorate chronic liver injury.

Lumbar spinal loading during bowling in cricket: a kinetic analysis using a musculoskeletal modelling approach.

Science.gov (United States)

Zhang, Yanxin; Ma, Ye; Liu, Guangyu

2016-01-01

The objective of the study was to evaluate two types of cricket bowling techniques by comparing the lumbar spinal loading using a musculoskeletal modelling approach. Three-dimensional kinematic data were recorded by a Vicon motion capture system under two cricket bowling conditions: (1) participants bowled at their absolute maximal speeds (max condition), and (2) participants bowled at their absolute maximal speeds while simultaneously forcing their navel down towards their thighs starting just prior to ball release (max-trunk condition). A three-dimensional musculoskeletal model comprised of the pelvis, sacrum, lumbar vertebrae and torso segments, which enabled the motion of the individual lumbar vertebrae in the sagittal, frontal and coronal planes to be actuated by 210 muscle-tendon units, was used to simulate spinal loading based on the recorded kinematic data. The maximal lumbar spine compressive force is 4.89 ± 0.88BW for the max condition and 4.58 ± 0.54BW for the max-trunk condition. Results showed that there was no significant difference between the two techniques in trunk moments and lumbar spine forces. This indicates that the max-trunk technique may not increase lower back injury risks. The method proposed in this study could be served as a tool to evaluate lower back injury risks for cricket bowling as well as other throwing activities.

Morphological, molecular and biological characterization of Mehdinema alii (Nematoda: Diplogasterida) from the decorated cricket (Gryllodes sigillatus).

Science.gov (United States)

Luong, L T; Platzer, E G; De Ley, P; Thomas, W K

1999-12-01

The nematode Mehdinema alii was recovered from the decorated cricket Gryllodes sigillatus (Walker). Morphometric comparisons are presented from 3 populations. The nematode is characterized by dense arrays of spines on the cuticle of the anterior half of the body and a highly elongate, tubular stoma with a dorsal denticle in the glottoid region. Females have a protruding vulva. Young females are amphidelphic, but the anterior ovary disappears in older females bearing multiple developing juveniles. The male is monorchic with asymmetrically placed genital papillae, distally fused spicules, and a highly complex gubernaculum bearing 2 cuticularized thorns that protrude through a separate, postcloacal opening. Adult nematodes are located primarily in the hindgut, whereas juveniles or dauers occur mainly in the genital chamber of both male and female crickets. Male crickets are significantly more likely to be infected than females. This male-biased infection may be linked to the venereal transmission mechanism of the dauers. Although morphologically unusual in many respects, placement of M. alii in Diplogasterida is supported by both the morphology of the anterior digestive tract as well as analysis of its 18S rDNA sequence. These sequence data suggest that M. alii groups most closely with members of the Cylindrocorporidae.

New high yielding mutant varieties of mustard (Brassica campestris L. var. yellow sarson)

International Nuclear Information System (INIS)

Rahman, A.; Das, M.L.; Pathan, A.J.

1992-01-01

Mutation breeding work at the Bangladesh Institute of Nuclear Agriculture has been successful with the development of a number of promising mutants and with the release of two mutant varieties of mustard (Brassica campestris L. var. Yellow Sarson), Agrani and Safal, for commercial cultivation in Bangladesh. The mutant varieties have higher seed and oil yield with higher biomass production, tolerance to Alternaria blight and aphid under field conditions. The average seed yield of the varieties is 1726 and 1754 kg/ha as compared to 1447 kg/ha of the best check Sonali. These varieties have 42-43 per cent oil in the seed. (author). 7 refs., 3 tabs

Acceptability of biscuits containing 10% cricket (Acheta domesticus) compared to milk biscuits among 5-10-year-old Kenyan schoolchildren

DEFF Research Database (Denmark)

Homann, A M; Ayieko, M A; Konyole, S O

2017-01-01

of the study was to develop a recipe for cricket biscuits suitable for school feeding programmes and test acceptability of the biscuits in Kenyan schoolchildren, in comparison with a similar biscuit with milk. The study was randomised and parallel. Fifty-four children aged 5-10 years were served 100 g (range...... 98-102 g) biscuits containing either 10% cricket powder or 10% milk powder during school days for four weeks. At baseline anthropometry (weight, height, mid upper arm circumference) was measured and information on insect consumption and allergies collected. Daily, weight of biscuits eaten...

"In Loco Parentis"? Public-School Authority, Cricket and Manly Character, 1855-62

Science.gov (United States)

Boddice, Rob

2009-01-01

This article considers the responsibility for schoolboys' behaviour and character when in liminal spaces between home and school, in an historical account of the annual cricket matches in London between Eton, Harrow and Winchester in the late 1850s. The episode is situated in the context of the Clarendon Commission's discussions on school sports,…

Design, fabrication and characterisation of a biomimetic accelerometer inspired by the cricket's clavate hair

NARCIS (Netherlands)

Droogendijk, H.; de Boer, Meint J.; Sanders, Remco G.P.; Krijnen, Gijsbertus J.M.

2013-01-01

Crickets use so-called clavate hairs to sense (gravitational) acceleration to obtain information on their orientation. Inspired by this clavate hair system, a biomimetic accelerometer has been developed and fabricated using surface micromachining and SU-8 lithography. First measurements indicate

Cricket’s Contribution to India’s National Solidification

Science.gov (United States)

2009-03-01

much of the institutions and behaviors from British colonialism. “The British in India created the basic state architecture : political unity and...my thesis, doing so through the medium of the other great pillar of Indian popular culture, cinema . Having shown a variety of material evidence...the confluence of two central pillars of Indian popular culture; cinema and cricket. Set in 1893, the fictional story of Lagaan tells the tale of an

Genetic diversity analysis for agro-morphological and seed quality traits in rapeseed (brassica campestris l.)

International Nuclear Information System (INIS)

Yousuf, M.; Ajmal, S.U.; Munir, M.; Ghafoor, A.

2011-01-01

One hundred fourteen accessions of rapeseed (Brassica campestris L.) were evaluated at National Agricultural Research Centre, Islamabad, Pakistan using cluster and principal component analyses during 2005 and 2006. Cluster analysis based on fifteen agro-morphological and six seed quality traits, divided 114 accessions into six and five clusters during 2005 and 2006, respectively. The first seven and five PCs with eigenvalues > 1 contributed 74.09% and 66.08% of the variability amongst accessions during 2005 and 2006, respectively. Nine important characters contributed positively to first two PCs during both the years 2005 and 2006. (author)

Analysis of patient load data for teams competing in the 2003 cricket ...

African Journals Online (AJOL)

teams taking part in 10 warm-up matches and 46 matches during the 2003 Cricket World Cup played in South Africa, .... Medical support was provided from the time that the teams arrived in the country, and the medical staff were ..... Melbourne: Blackwell, 1995, 674 - 8. 5. Orchard J, James T, Alcott E, Carter S, Farhart P.

Optimisation of a cheap and residential small-scale production of edible crickets with local by-products as an alternative protein-rich human food source in Ratanakiri Province, Cambodia.

Science.gov (United States)

Caparros Megido, Rudy; Alabi, Taofic; Nieus, Clément; Blecker, Christophe; Danthine, Sabine; Bogaert, Jan; Haubruge, Éric; Francis, Frédéric

2016-01-30

The health status of the indigenous people of Ratanakiri Province, Cambodia, is significantly lower compared with that of the rest of the nation. The domestication and mass production of insects may represent a sustainable, cost effective and high quality alternative source of protein to traditional livestock. This study aimed to optimise a cheap and residential cricket breeding system based on unused wild resources. The development of crickets, Teleogryllus testaceus (Walker), under seven diets composed of taro aerial parts, young cassava leaves, young cashew leaves and brown rice flour (with or without banana slices), versus a traditionally used broiler feed diet was studied. Cricket mortality was low in all diets, except the two cashew-based diets. Total biomass was significantly higher under the broiler feed, in addition to the two diets containing a combination of cassava leaf powder and brown rice. Yet, crickets fed with the taro diet had the highest percentage of protein. Concerning the breeding system cost, units using cassava leaves were the cheapest. Diets based on cassava leaves seem to be the most promising. Nevertheless, to produce crickets with a high body mass and a high protein level, a new experiments must be devised in which cassava leaf maturity will be adapted to fit with the cricket growth stage. Moreover, to reduce the cost of the breeding units, handmade local products should be used instead of purchased components. © 2015 Society of Chemical Industry.

Immune challenge and pre- and post-copulatory female choice in the cricket Teleogryllus commodus

NARCIS (Netherlands)

Drayton, Jean M.; Boeke, J. E. Kobus; Jennions, Michael D.

Life history theory predicts a trade off between the expression of male sexual traits and the immune system. To test for this trade off, male crickets Teleogryllus commodus were injected with bacterial lipopolysaccharides (LPS) to induce an immune response and their subsequent pre- and

Folk knowledge of invertebrates in Central Europe - folk taxonomy, nomenclature, medicinal and other uses, folklore, and nature conservation.

Science.gov (United States)

Ulicsni, Viktor; Svanberg, Ingvar; Molnár, Zsolt

2016-10-11

There is scarce information about European folk knowledge of wild invertebrate fauna. We have documented such folk knowledge in three regions, in Romania, Slovakia and Croatia. We provide a list of folk taxa, and discuss folk biological classification and nomenclature, salient features, uses, related proverbs and sayings, and conservation. We collected data among Hungarian-speaking people practising small-scale, traditional agriculture. We studied "all" invertebrate species (species groups) potentially occurring in the vicinity of the settlements. We used photos, held semi-structured interviews, and conducted picture sorting. We documented 208 invertebrate folk taxa. Many species were known which have, to our knowledge, no economic significance. 36 % of the species were known to at least half of the informants. Knowledge reliability was high, although informants were sometimes prone to exaggeration. 93 % of folk taxa had their own individual names, and 90 % of the taxa were embedded in the folk taxonomy. Twenty four species were of direct use to humans (4 medicinal, 5 consumed, 11 as bait, 2 as playthings). Completely new was the discovery that the honey stomachs of black-coloured carpenter bees (Xylocopa violacea, X. valga) were consumed. 30 taxa were associated with a proverb or used for weather forecasting, or predicting harvests. Conscious ideas about conserving invertebrates only occurred with a few taxa, but informants would generally refrain from harming firebugs (Pyrrhocoris apterus), field crickets (Gryllus campestris) and most butterflies. We did not find any mythical creatures among invertebrate folk taxa. Almost every invertebrate species was regarded as basically harmful. Where possible, they were destroyed or at least regarded as worth eradicating. However, we could find no evidence to suggest any invertebrate species had suffered population loss as a result of conscious destruction. Sometimes knowledge pertaining to the taxa could have more

Evaluation of in vitro anticancer activity of Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris.

Science.gov (United States)

Behbahani, Mandana

2014-01-01

The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.

Evaluation of in vitro anticancer activity of Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris.

Directory of Open Access Journals (Sweden)

Mandana Behbahani

Full Text Available The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231 and normal breast cell line (MCF 10A. The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.

Sexually transmitted nematodes affect spermatophylax production in the cricket, Gryllodes sigillatus

OpenAIRE

Lien T. Luong; Harry K. Kaya

2005-01-01

Parasites can influence various aspects of host reproduction and mating, including spermatophore production. In the cricket, Gryllodes sigillatus, males transfer to females a two-part spermatophore containing a sperm-filled ampulla and a gelatinous spermatophylax (nuptial gift). Here we investigate the effects of a sexually transmitted nematode on male spermatophylax production. Sexually transmitted diseases (STDs) have the potential to reduce host fertility or fecundity in insect hosts. To o...

"Violence" in Sport and the Violenti non fit Iniuria Defence: A Perspective on the Death of the Cricket Player Phil Hughes

Directory of Open Access Journals (Sweden)

Pieter Labuschagne

2018-03-01

Full Text Available This article evaluates the defence of violenti non fit inuiria in sport with specific reference to the principle of bonos mores or the “good morals” in society to tolerate injuries in sport. The increased prevalence of serious injuries in sport in the professional era, in which sportsmen earn their livelihood from sport, necessitate a review of the existing situation. The death of the Australian cricket player, Phil Hughes, as a result of fast, short-pitched bowling in cricket, has again put the spotlight on the aggressive and excessive use of "violence" in sport. The malicious intent in sport, to harm or even to kill an opponent, has made it necessary to ask if there should be any difference in the manner in which the perpetrator of violence in sport should be treated as against ordinary criminal law assault and murder offenders. A two-pronged approach is suggested in the article as a possible way of dealing with wrongfulness in cricket.

Produção de goma xantana por cepas nativas de Xanthomonas campestris a partir de casca de cacau ou soro de leite Production of xanthan gum by Xanthomonas campestris strains native from bark cocoa or whey

Directory of Open Access Journals (Sweden)

Denis de M. Diniz

2012-01-01

Full Text Available Foi estudada a otimização do processo de produção de goma xantana a partir de casca de cacau ou soro de leite como fonte de carbono, e determinou-se o rendimento da goma obtida pela bioconversão de casca de cacau e soro de leite com a Xanthomonas campestris 1182. A goma foi produzida em meios com potássio e nitrogênio a 25 °C, 250 rpm por 120 horas. Os rendimentos foram: 2,335 g.L-1 para a sacarose; 4,995 g.L-1 para a casca de cacau seca e 12,01 g.L-1 utilizando soro de leite. Portanto, é viável a produção de goma xantana utilizando fontes de carbono como a casca de cacau e o soro de leite.The optimization of the production process of xanthan gum from cocoa husks or milk whey as carbon source was studied, and the production rate of gum obtained by the bioconversion of cocoa pods and whey was determined, using Xanthomonas campestris 1182. The gum was produced in a medium with potassium and nitrogen at 25 °C, 250 rpm for 120 hours. The results were: 2.335 g.L-1 for sucrose; 4.995 g.L-1 for cocoa dry pods and 12.01 g.L-1 using whey. Therefore, the production of xanthan gum is feasible upon using carbon sources such as cocoa hulls and whey.

New records of nematomorph parasites (Nematomorpha: Gordiida) of ground beetles (Coleoptera: Carabidae) and camel crickets (Orthoptera: Rhaphidophoridae) in Washington State.

Science.gov (United States)

Looney, Chris; Hanelt, Ben; Zack, Richard S

2012-06-01

From 1998 to 2003, beetles and crickets infected with hairworms were collected from 4 localities within the Hanford Nuclear Site and the Hanford Reach National Monument, located in a shrub-steppe region of Washington State along the Columbia River. Infected hosts comprised 6 species of carabid beetles within 5 genera and 2 camel crickets within 1 genus; all are newly documented insect-nematomorph associations. A large proportion of the infected hosts (48%) were collected from a single site during a single collecting period. Of the 38 infected hosts, 32 contained a single worm, 4 hosts contained 2 worms, and 2 hosts contained 3 worms. Five of the hosts with multiple infections contained at least 1 male and 1 female worm. Camel crickets were infected with Neochordodes occidentalis while carabids were infected with an undescribed species of Gordionus . As the majority of hairworms are collected in the post-parasitic adult phase, host data and hairworm-arthropod associations remain poorly documented and our work adds new data to this area of nematomorph biology.

Acute toxicity of Headline® fungicide to Blanchard's cricket frogs (Acris blanchardi).

Science.gov (United States)

Cusaac, J Patrick W; Morrison, Shane A; Belden, Jason B; Smith, Loren M; McMurry, Scott T

2016-04-01

Previous laboratory studies have suggested that pyraclostrobin-containing fungicide formulations are toxic to amphibians at environmentally relevant concentrations. However, it is unknown if all pyraclostrobin formulations have similar toxicity and if toxicity occurs in different amphibian species. We investigated the acute toxicity of two formulations, Headline(®) fungicide and Headline AMP(®) fungicide, to Blanchard's cricket frogs (Acris blanchardi) based on a direct overspray scenario. In addition, we examined body residues of fungicide active ingredients in A. blanchardi following direct exposure to Headline AMP fungicide. Headline fungicide and Headline AMP fungicide had similar toxicity to A. blanchardi with calculated median lethal doses of 2.1 and 1.7 µg pyraclostrobin/cm(2), respectively, which are similar to the suggested maximum label rate in North American corn (2.2 and 1.52 µg pyraclostrobin/cm(2), respectively). Tissue concentrations of pyraclostrobin were lower than predicted based on full uptake of a direct dose, and did not drop during the first 24 h after exposure. Headline fungicides at corn application rates are acutely toxic to cricket frogs, but acute toxicity in the field will depend on worst-case exposure.

Cloning of a two-component signal transduction system of Xanthomonas campestris pv. phaseoli var. fuscans strain BXPF65

DEFF Research Database (Denmark)

Chan, JWYF; Maynard, Scott; Goodwin, PH

1998-01-01

A putative two-component signal transduction system was amplified and cloned from the plant pathogenic bacterium Xanthomonas campestris pv. phaseoli var. fuscans isolate BXPF65. The 620 bp amplified fragment was sequenced and analyzed with the BLAST Enhanced Alignment Utility (BEAUTY). BEAUTY...... that the putative histidine kinase has homology with conserved “transmitter” domains of sensor proteins in two-component signal transduction systems. RFLP analysis using the putative signal transduction system showed polymorphisms among the strains....

Limpeza clonal de mudas de videira infectadas por Xanthomonas campestris pv. viticola Clonal cleaning of grapevine plants infected by Xanthomonas campestris pv. viticola

Directory of Open Access Journals (Sweden)

Adriano Márcio Freire Silva

2013-03-01

Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.Bacterial canker is caused by Xanthomonas campestris pv. viticola (Xcv. In order to eliminate Xcv from 'Red Globe' plants it was studied: optimal size of meristem tips and axillary buds for cultivation in modified Galzy's medium (MGM; effects of thermotherapy (38ºC/30 days; and action of antibiotics in the elimination of Xcv in infected grapevines. The percentages of contamination by Xcv and regeneration were analyzed and plants obtained were indexed using the semi-selective culture medium nutrient agar-dextrose-yeast extract-ampicilin (NYDAM followed by a pathogenicity test. The cultivation of 3 mm explants permitted to obtain plants free of bacteria with regeneration 14.3 times higher than 1 mm explants. The thermotherapy of infected plants associated to the in vitro culture

Purine derivate content and amino acid profile in larval stages of three edible insects.

Science.gov (United States)

Bednářová, Martina; Borkovcová, Marie; Komprda, Tomáš

2014-01-15

Considering their high content of protein, insects are a valuable alternative protein source. However, no evaluation of their purine content has so far been done. High content of purine derivates may lead to the exclusion of such food from the diet of people with specific diseases. The aim of this study was to analyse the content of selected purine derivates and amino acid profile in the three insect species most often used for entomophagy in Europe and compare them with the purine content in egg white and chicken breast. The content of individual purine derivates and their total content were significantly dependent on insect species. The purine content in all three species was significantly higher (P < 0.05) than in egg white, but some values were significantly lower (P < 0.05) than in chicken breast. The total protein content was 548.9 g kg(-1) dry matter (DM) in mealworm (Tenebrio molitor), 551.6 g kg(-1) DM in superworm (Zophobas atratus) and 564.9 g kg(-1) DM in cricket (Gryllus assimilis). Larvae of mealworm and superworm are protein-rich and purine-low meat alternatives. In contrast, cricket nymphs are protein-rich and purine-rich and cannot be recommended for people with hyperuricemia or gout. © 2013 Society of Chemical Industry.

Optimization of medium composition for the production of compounds effective against Xanthomonas campestris by bacillus subtilis

Directory of Open Access Journals (Sweden)

Rončević Zorana Z.

2014-01-01

Full Text Available The biocontrol agents are a very promising alternative to synthetic pesticides that are presently used to control plant diseases caused by phytopathogenic microorganisms. Members of the Bacillus genera are soil bacteria that produce significant quantities of agriculturally important bioactive compounds. Production of these compounds can be improved by changing the nutritional and environmental conditions. The aim of this study was the optimization of medium composition, using response surface methodology, for the production of compounds effective against Xanthomonas campestris ATCC 13951 by Bacillus subtilis ATCC 6633. To study the production of antimicrobial compounds by selected Bacillus strain, the producing microorganisms were cultivated on nutrient broth. The inhibition zone diameter of 18.0 mm obtained by the diffusion-disc method indicated that the used Bacillus subtilis strain produces compounds with antimicrobial activity against Xanthomonas campestris ATCC 13951. To optimize the composition of the cultivation medium in terms of glycerol, sodium nitrite and phosphates content, experiments were carried out in accordance with Box-Behnken design, and optimization of multiple responses was performed using the concept of desirability function. The developed model predicted that the maximum inhibition zone diameter (26.23 mm against tested phytopathogen is achieved when the initial content of glycerol, sodium nitrite and phosphate were 50.00 g/L, 2.85 g/L and 11.00 g/L, respectively. To minimize the consumption of medium components and costs of effluents processing, additional optimization set was made. The techno-economic analysis of the obtained results has to be done to select optimal medium composition for industrial production of antimicrobial compounds.

Evaluation of In Vitro Anticancer Activity of Ocimum Basilicum, Alhagi Maurorum, Calendula Officinalis and Their Parasite Cuscuta Campestris

OpenAIRE

Behbahani, Mandana

2014-01-01

The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative ...

Acoustic evolution in crickets: need for phylogenetic study and a reappraisal of signal effectiveness

Directory of Open Access Journals (Sweden)

Laure Desutter-Grandcolas

2004-06-01

Full Text Available Cricket stridulums and calls are highly stereotyped, except those with greatly modified tegmina and/or vena-tion, or ''unusual'' frequency, duration and/or intensity. This acoustic diversity remained unsuspected until recently, and current models of acoustic evolution in crickets erroneously consider this clade homogeneous for acoustic features. The few phylogenetic studies analyzing acoustic evolution in crickets demonstrated that acoustic behavior could be particularly labile in some clades. The ensuing pattern for cricket evolution is consequently extremely complex. We argue that: (1 phylogeny should always be considered when analyzing acoustic evolution, whatever characters are considered (signals, stridulums or behaviors. Consequently, future studies should be devoted to entire clades, and not consider isolated taxa; character and character state definitions should allow significant reconstructions of character evolutionary transformations; and homologies should be carefully defined for all characters, including behavior. (2 The factors responsible for song effectiveness should be reconsidered and hypotheses on their potential influence on signal evolution tested jointly by phylogenies (for example, to assess correlated transformations of acoustic and ecological features, and population studies (for example, to correlate call range and population structure, or test the predation risk associated with a signal structure. Better understanding these points should help clarifying acoustic evolution in crickets.Os aparelhos estridulatórios e os chamados dos grilos são altamente estereotipados, exceto aqueles com áreas e/ou venação tegminais fortemente modificadas ou com freqüência, duração e/ou intensidade fora do ''normal''. Esta diversidade acústica ficou insuspeita até recentemente, e os modelos correntes de evolução acústica em grilos consideram erroneamente este clado como homogêneo para as características acústicas. Os

It’s Not [Just] Cricket: The Art and Politics of the Popular – Cultural Imperialism, ‘Sly Civility’ & Postcolonial Incorporation

Directory of Open Access Journals (Sweden)

Andrew Jones

2013-01-01

Full Text Available Ashutosh Gowariker’s critically acclaimed Lagaan (2001, is a marvellous piece of cinematic troubling, which, via an astute use of allegory, reflects upon identity politics and power relations in both colonial and postcolonial contexts. Bringing two cornerstones of Indian popular culture together, namely cricket and Hindi formulae films, Gowariker produces an engagingly, affective alchemy of image and sound, which intervenes critically in the discourses of British colonial rule. This article’s intention is to demonstrate the mimetic devices inherent in Lagaan’s narrative, and how they mirror the regional resilience evident in the global success of both popular Indian cinema and the Indian performance of cricket. The sport of cricket and its role and effectiveness within a larger colonial project, is contextualized and reconsidered by tracing some resistant tangents in the sports evolution and performance in the Asia Pacific region. Making the most of the South Asian diaspora, which has exploited the networks and routes of the former British Empire, Indian popular cinema, likewise, serves to illustrate the point that local cultural dynamics can add their own nuances to global media flows. Interdisciplinary approaches are required to traverse within and between cultures, and to underscore the deep currents of contestation, as well as the radical and often surprising politics that characterise popular culture. In this respect, a range of scholars from different fields of study are consulted; Ashis Nandy, Arjun Appadurai, Chandrima Chakraborty and Homi Bhabha amongst them. Their voices will help to open up uncertainties in the conventional discourses, and to articulate some of the cultural politics and poetics at play in Lagaan specifically and the performance of cricket more generally.

Are current coaching recommendations for cricket batting technique supported by biomechanical research?

Science.gov (United States)

Penn, Melissa J; Spratford, Wayne

2012-09-01

Coaching manuals are an invaluable tool for coaches, used in player skill and technique development, especially at grass-roots level. Commonly developed by former players and coaches, this information is generally based on anecdotal evidence and in general lacks the scientific rigour of a peer-reviewed journal. Thus there is a need to establish the level of agreement and support between the coaching and biomechanical literature. In doing so, evidence-based coaching practices can be optimally developed. Moreover, this will ensure the technique and skill development practices implemented at grass-roots level are supported by successful performance in the later stages of player development. The purpose of this review was to evaluate the latest batting biomechanics research, providing a comprehensive and up-to-date insight into the kinematic and kinetic aspects of batting in cricket. Furthermore, this review compared and contrasted this research with a selection of coaching literature, establishing a strong level of support and agreement between the coaching and biomechanical literature in recommendations for cricket batting technique. Although the ambiguity in a number of coaching concepts still exists, coaches and players can be confident in the successful implementation of both sources of information in a player's technical development.

Early embryonic development of the head region of Gryllus assimilis Fabricius, 1775 (Orthoptera, Insecta).

Science.gov (United States)

Liu, Yu; Maas, Andreas; Waloszek, Dieter

2010-09-01

We report our investigations on the embryonic development of Gryllus assimilis, with particular attention to the head. Significant findings revealed with scanning electron microscopy (SEM) images include: (1) the pre-antennal lobes represent the anterior-most segment that does not bear any appendages; (2) each of the lobes consists of central and marginal regions; (3) the central region thereof develops into the protocerebrum and the optic lobes, whereas the marginal region thereof becomes the anterior portion of the head capsule; (4) the initial position of the antennal segment is posterior to the mouth region; (5) appendage anlagen are transitorily present in the intercalary segment, and they later vanish together with the segment itself; (6) a bulged sternum appears to develop from the ventral surface of the mandibular, maxillary and labial segments. Embryonic features are then compared across the Insecta and further extended to the embryos of a spider (Araneae, Chelicerata). Striking similarities shared by the anterior-most region of the insect and spider embryos lead the authors to conclude that such comparison should be further undertaken to cover the entire Euarthropoda. This will help us to understand the embryology and evolution of the arthropod head. Copyright © 2010 Elsevier Ltd. All rights reserved.

Responses of male cricket frogs (Acris crepitans) to attenuated and degraded advertisement calls.

Science.gov (United States)

Venator, Kurt R; Ryan, Michael J; Wilczynski, Walter

2017-05-01

We examined the vocal and non-vocal responses of male cricket frogs ( Acris crepitans ) to conspecific advertisement calls that had been attenuated or degraded by reducing the depth of amplitude modulation (AM). Both are characteristic of changes to the call as it is transmitted through natural habitats. As stimulus calls became more intense or less degraded, male cricket frogs gradually decreased their call rate and increased the number of call groups and pulse groups in their calls, changes indicative of increased aggressive interactions. At the higher intensities and lower degradation levels, the probability that males would shift to one of two non-vocal behavioral responses, attacking the perceived intruder or ceasing calling and abandoning the call site, gradually increased. The results show that differences in signal attenuation and AM degradation levels are perceived by males and trigger both vocal and non-vocal behavioral responses consistent with their use in evaluating the distance to a challenging male. Furthermore, the results indicate that the male responses are graded, increasing as intensity rises and degradation falls, and hierarchical, with vocal responses preceding behavioral responses over the range of intensities and degradation levels presented.

Circadian locomotor rhythms in the cricket, Gryllodes sigillatus. I. Localization of the pacemaker and the photoreceptor.

Science.gov (United States)

Abe, Y; Ushirogawa, H; Tomioka, K

1997-10-01

Circadian locomotor rhythm and its underlying mechanism were investigated in the cricket, Gryllodes sigillatus. Adult male crickets showed a nocturnal locomotor rhythm peaking early in the dark phase of a light to dark cycle. This rhythm persisted under constant darkness (DD) with a free-running period averaging 23.1 +/- 0.3 hr. Although constant bright light made most animals arrhythmic, about 40% of the animals showed free-running rhythms with a period longer than 24 hr under constant dim light condition. On transfer to DD, all arrhythmic animals restored the locomotor rhythm. Bilateral optic nerve severance resulted in free-running of the rhythm even under light-dark cycles. The free-running period of the optic nerve severed animals was significantly longer than sham operated crickets in DD, suggesting that the compound eye plays some role in determining the free-running period. Removal of bilateral lamina-medulla portion of the optic lobe abolished the rhythm under DD. These results demonstrate that the photoreceptor for entrainment is the compound eye and the optic lobe is indispensable for persistence of the rhythm. However, 75% and 54% of the optic lobeless animals showed aberrant rhythms with a period very close to 24 hr under light and temperature cycles, respectively, suggesting that there are neural and/or humoral mechanisms for the aberrant rhythms outside of the optic lobe. Since ocelli removal did not affect the photoperiodically induced rhythm, it is likely that the photoreception for the rhythm is performed through an extraretinal photoreceptor.

Cloning, crystallization and preliminary X-ray studies of XC2981 from Xanthomonas campestris, a putative CutA1 protein involved in copper-ion homeostasis

International Nuclear Information System (INIS)

Lin, Chien-Hung; Chin, Ko-Hsin; Gao, Fei Philip; Lyu, Ping-Chiang; Shr, Hui-Lin; Wang, Andrew H.-J.; Chou, Shan-Ho

2006-01-01

A probable copper-ion tolerance protein from the plant pathogen X. campestris has been overexpressed in E. coli, purified and crystallized. Divalent metal ions play key roles in all living organisms, serving as cofactors for many proteins involved in a variety of electron-transfer activities. However, copper ions are highly toxic when an excessive amount is accumulated in a cell. CutA1 is a protein found in all kingdoms of life that is believed to participate in copper-ion tolerance in Escherichia coli, although its specific function remains unknown. Several crystal structures of multimeric CutA1 with different rotation angles and degrees of interaction between trimer interfaces have been reported. Here, the cloning, expression, crystallization and preliminary X-ray analysis of XC2981, a possible CutA1 protein present in the plant pathogen Xanthomonas campestris, are reported. The XC2981 crystals diffracted to a resolution of 2.6 Å. They are cubic and belong to space group I23, with unit-cell parameters a = b = c = 130.73 Å

Development of high yielding mutants of Brassica campestris L. cv. Toria selection through gamma rays irradiation

International Nuclear Information System (INIS)

Javed, M.A.; Siddiqui, M.A.; Khan, M.K.R.; Khatri, A.; Khan, I.A.; Dahar, N.A.; Khanzada, M.H.; Khan, R.

2003-01-01

Homogeneous seeds of Brassica campestris L. cv. Toria selection were treated with different doses of gamma rays (750, 1000 and 1250 Gy) to induce genetic variability for the selection of new genotypes with improved agronomic traits. After passing through different stages of selection, two promising mutants were selected for further studies. Two selected mutants along with 5 other entries including parent variety were evaluated for yield and yield components in yield trials for two consecutive years. The mutant TS96-752 was significantly (P less than or equal to 0.05) superior to all other entries in grain yield but at par with FSD 86028-3

The dynamic behaviour of the cricket ear predicted from first principles

DEFF Research Database (Denmark)

van Leeuwen, Johan L; Michelsen, Axel; Larsen, Ole Næsbye

2008-01-01

Cricket ears have exquisite sensitivity and directional resolution for the calling frequency of con-specifics ( [Michelsen, 1995] , [Michelsen, 1998] and [Michelsen et al., 1994] ). We propose a mechanistic explanation for their remarkable hearing capabilities. We developed a numerical mechanical...... key role in the directional properties of the hearing system), and the left and right spiracle inputs in the thorax. The model predicts that the overall sensitivity of the hearing system is much higher with open spiracles than with closed spiracles, with important sensitivity peaks at 4.8 kHz (used...

Biological control of dodder (Cuscuta campestris L. by fungi pathogens

Directory of Open Access Journals (Sweden)

F. Fallahpour

2016-04-01

Full Text Available Parasite weeds are the most important yield reducing factors, and among them dodder (Cuscuta campestris L. is an obligate parasite of many plant families. In order to find a suitable biocontrol agent for dodder a study was conducted based on a randomized complete design with four replications at research greenhouse of Faculty of Agriculture, Ferdowsi University of Mashhad, Iran during 2007-2009. Diseased dodders sampled from sugarbeet farms of Chenaran, Iran. After culturing and isolating exiting fungi from infected tissues of dodder, Fusarium sp., Alternaria sp. and Colletotrichum sp. were recognized. Inoculation of isolates was carried out with concenteration of 1×108 spores per ml sterile water at different growth stages of dodder in labratoary and greenhouse. Among different fungi, isolate of 323 of F. oxysporum showed an effective control on germination of dodder seeds and the highest level of plant pathogencity was before the contact of dodder with host and infection in older plants decreased. Infection of this isolate with crops such as sugarbeet (Beta vulgaris L., alfalfa (Medigago sativa L., basil (Ocimum basilicum L., wheat (Triticum aestivum L. and barley (Hordeum vulgare L. showed no symptoms.

Overcoming interspecific incompatibility in the cross Brassica campestris ssp. japonica x Brassica oleracea var. botrytis using irradiated mentor pollen page

International Nuclear Information System (INIS)

Sarla, N.

1988-01-01

The cross B. campestris ssp. japonica x B. oleracea var. botrytis fails due to incompatibility barrier at the stigma. To realize this cross, irradiated compatible pollen (mentor pollen) was used before the incompatible pollination. The presence of mentor pollen stimulated the incompatible pollen to germinate and effect fertilization and seed set. One hybrid was thus obtained. Most of the seeds were inviable. Of the 5 plants raised one was a hybrid and 4 resembled the female parent. 1 tab., 7 refs

Colony growth of two species of Solenopsis fire ants(Hymenoptera: Formicidae) reared with crickets and beef liver

Science.gov (United States)

Most diets for rearing fire ants and other ants contain insects such as crickets or mealworms. Unfortunately, insect diets are expensive, especially for large rearing operations, and are not always easily available. This study was designed to examine colony growth of Solenopsis fire ants on beef liv...

Multiplex PCR for specific and robust detection of Xanthomonas campestris pv. musacearum in pure culture and infected plant material

DEFF Research Database (Denmark)

Adriko, John; Aritua, V.; Mortensen, Carmen Nieves

2012-01-01

The present study developed a pathovar-specific PCR for the detection of Xanthomonas campestris pv. musacearum (Xcm), the cause of banana xanthomonas wilt, by amplification of a 265-bp region of the gene encoding the general secretion pathway protein D (GspD). A distinct DNA fragment......-specific PCR was successfully multiplexed with internal control primers targeting 16S rDNA for application on DNA from bacterial cultures and with primers targeting plant mitochondrial 26S rDNA for application on DNA extracted from plant material. Diagnostic discrimination of healthy and infected plants...

Seasonality influences cuticle melanization and immune defense in a cricket: support for a temperature-dependent immune investment hypothesis in insects

Energy Technology Data Exchange (ETDEWEB)

Fedorka, K. M. [Univ. of Central Florida, Orlando, FL (United States); Copeland, E. K. [Univ. of Central Florida, Orlando, FL (United States); Winterhalter, W. E. [Univ. of Central Florida, Orlando, FL (United States)

2013-07-18

To improve thermoregulation in colder environments, insects are expected to darken their cuticles with melanin via the phenoloxidase cascade, a phenomenon predicted by the thermal melanin hypothesis. However, the phenoloxidase cascade also plays a significant role in insect immunity, leading to the additional hypothesis that the thermal environment indirectly shapes immune function via direct selection on cuticle color. Support for the latter hypothesis comes from the cricket Allonemobius socius, where cuticle darkness and immune-related phenoloxidase activity increase with latitude. However, thermal environments vary seasonally as well as geographically, suggesting that seasonal plasticity in immunity may also exist. Although seasonal fluctuations in vertebrate immune function are common (because of flux in breeding or resource abundance), seasonality in invertebrate immunity has not been widely explored. We addressed this possibility by rearing crickets in simulated summer and fall environments and assayed their cuticle color and immune function. Prior to estimating immunity, crickets were placed in a common environment to minimize metabolic rate differences. Individuals reared under fall-like conditions exhibited darker cuticles, greater phenoloxidase activity and greater resistance to the bacteria Serratia marcescens. These data support the hypothesis that changes in the thermal environment modify cuticle color, which indirectly shapes immune investment through pleiotropy. This hypothesis may represent a widespread mechanism governing immunity in numerous systems, considering that most insects operate in seasonally and geographically variable thermal environments.

Effects of Drought and Salinity Stresses on Germination Characteristics of Dodder (Cuscuta campestris

Directory of Open Access Journals (Sweden)

A Ghanbari

2012-10-01

Full Text Available In order to study the germination characteristics of dodder (Cuscuta campestris under drought and salinity stress conditions, two laboratory's experiment were conducted. Experiments were conducted in completely randomized design with 4 replications. The treatments, for salinity and drought stress were six potential levels (0,-3, -6, -9, -12 and -15 bar of NaCl and five potential levels (0, -3, -6, -9 and -12 bar of PEG 6000 respectively. Results showed that increasing drought and salinity stress significantly germination rate and germination percentage, plumule and radicle length, plumule of Dodder and its radicle fresh weight decreased. However ratio of radicle to plumule and root to shoot were increased (P≤0.01. It seems that among the characters, plumule length is more sensitive to drought and salinity stresses. In addition, germination of dodder was tolernt to drought stress more than salinity stresses.

Experimentally induced spermatophore production and immune responses reveal a trade-off in crickets

OpenAIRE

Angela M. Kerr; Susan N. Gershman; Scott K. Sakaluk

2010-01-01

The energetic demands of the immune system and reproduction are often high and can lead to trade-offs between these 2 life-history traits. In decorated crickets, Gryllodes sigillatus, much of a male's reproductive effort is devoted to calling, and to the synthesis of a spermatophylax, a large, gelatinous, non--sperm-containing mass forming part of the spermatophore and consumed by the female after mating. We employed a reciprocal design in which we experimentally induced an immune response in...

Predicting the names of the best teams after the knock-out phase of a cricket series.

Science.gov (United States)

Lemmer, Hermanus Hofmeyr

2014-01-01

Cricket players' performances can best be judged after a large number of matches had been played. For test or one-day international (ODI) players, career data are normally used to calculate performance measures. These are normally good indicators of future performances, although various factors influence the performance of a player in a specific match. It is often necessary to judge players' performances based on a small number of scores, e.g. to identify the best players after a short series of matches. The challenge then is to use the best available criteria in order to assess performances as accurately and fairly as possible. In the present study the results of the knock-out phase of an International Cricket Council (ICC) World Cup ODI Series are used to predict the names of the best teams by means of a suitably formulated logistic regression model. Despite using very sparse data, the methods used are reasonably successful. It is also shown that if the same technique is applied to career ratings, very good results are obtained.

Invertebrates of The H.J. Andrews Experimental Forest, Western Cascades, Oregon: III. The Orthoptera (Grasshoppers and Crickets).

Science.gov (United States)

David C. Lightfoot

1986-01-01

An inventory of Orthoptera (grasshoppers and crickets) at the H.J. Andrews Experimental Forest, near Blue River, Oregon, was conducted to determine the species present and ecological relationships. A key for identification and an annotated list are presented. From qualitative assessments of successional habitat relationships, generalized species associations of forest...

Effect of toss and weather on County Cricket Championship outcomes.

Science.gov (United States)

Forrest, David; Dorsey, Ron

2008-01-01

The principal competition in English professional cricket has become more competitive with the introduction of hierarchical divisions linked by promotion and relegation. Using regression analysis, we examine the effect on league points when teams suffer different degrees of weather disruption over the season and different amounts of luck in winning the toss for choice of first innings. The results are used to illustrate the sensitivity of championship, promotion, and relegation outcomes to such matters of chance and revised league tables are produced after applying adjustments to account for the influence of weather and toss. Policy recommendations are presented on how the influence of weather and toss might be lessened in future seasons.

Multiple differences in calling songs and other traits between solitary and gregarious Mormon crickets from allopatric mtDNA clades

Directory of Open Access Journals (Sweden)

Bailey William V

2007-01-01

Full Text Available Abstract Background In acoustic species, traits such as male calling song are likely to diverge quickly between allopatric populations due to sexual selection, and divergence in parameters such as carrier frequency, chirp structure, and other important song characters can influence sexual isolation. Here we make use of two forms of Mormon crickets to examine differences in a broad suite of traits that have the potential to influence speciation via sexual isolation. Mormon crickets in "gregarious" populations aggregate into dense migratory bands, and females are the sexually competitive sex (sex-role reversal. There is also a non-outbreak "solitary" form. These two forms are largely but not perfectly correlated with a significant mtDNA subdivision within the species that is thought to have arisen in allopatry. Combined information about multiple, independently evolving traits, such as morphology and structural and behavioural differences in calling song, provides greater resolution of the overall differences between these allopatric populations, and allows us to assess their stage of divergence. We test two predictions, first that the forms differ in song and second that gregarious males are more reluctant to sing than solitary males due to sex role reversal. We also tested for a difference in the relationship between the size of the forewing resonator, the mirror, and carrier frequency, as most models of sound production in crickets indicate that mirror size should predict carrier frequency. Results Multivariate analyses showed that solitary and gregarious individuals from different populations representing the two mtDNA clades had almost non-overlapping distributions based on multiple song and morphological measurements. Carrier frequency differed between the two, and gregarious males were more reluctant to sing overall. Mirror size predicted carrier frequency; however, the relationship between mirror size and surface area varied between

Origins and activation of prophenoloxidases in the digestive tract of the cricket, Gryllus bimaculatus.

Science.gov (United States)

Joseph, Woodring

2014-10-01

The function of Phenoloxidases (POs) in sclerotization and defense in insects is well understood, but little is known concerning their occurrence, origins, and function in the digestive tract. In Gyrllus bimaculatus gut all of the PO activity is found in the lumen of the digestive tract, and no detectible activity is found in homogenates of the gut epithelium or secretions from incubated epithelial tissues. Prophenoloxidases (PPOs) are synthesized in the hemocytes of  Bombyx mori and are transported into the cuticle. It is suggested that the PPOs in the caecal lumen of G. bimaculatus likewise are synthesized in hemocytes and are transported by unknown means into the caecal lumen, where they are activated to POs by trypsin. Peristalsis transports the POs both forward into the crop and posterior within the peritrophic membrane into the hind gut. The PPOs in the hemolymph consist of a trimer (270-280 kDa) and a tetramer (340-370 kDa). The active POs in the gut lumen consist of a monomer (85-95 kDa) in addition to an activated trimer and tetramer. © 2014 Wiley Periodicals, Inc.

Integrating sensory evaluations in incentivized discrete choice experiments to assess consumer demand for cricket flour buns in Kenya

DEFF Research Database (Denmark)

Alemu, Mohammed Hussen; Olsen, Søren Bøye; Vedel, Suzanne Elizabeth

In this study, we present one of the first thorough assessments of potential consumer demand for an insect based food product. We assess the demand in terms of Kenyan consumer preferences and willingness to pay for buns containing varying amounts of cricket flour. The novel feature of the study...

Polyandry promotes enhanced offspring survival in decorated crickets.

Science.gov (United States)

Ivy, Tracie M; Sakaluk, Scott K

2005-01-01

Although female multiple mating is ubiquitous in insects, its adaptive significance remains poorly understood. Benefits to multiple mating can accrue via direct material benefits, indirect genetic benefits, or both. We investigated the effects of multiple mating in the decorated cricket, Gryllodes sigillatus, by simultaneously varying the number of times that females mated and the number of different males with which they mated, measuring aspects of female fecundity and elements of offspring performance and viability. Multiple matings resulted in enhanced female fitness relative to single matings when females mated with different partners, but not when females mated repeatedly with the same male. Specifically, polyandrous females produced significantly more offspring surviving to reproductive maturity than did monogamous females mating once or mating repeatedly with the same male. These results suggest that the benefit females gain from multiple mating is influenced primarily by genetic and not material benefits.

Plant volatile eliciting FACs in lepidopteran caterpillars, fruit flies and crickets: a convergent evolution or phylogenetic inheritance?

Directory of Open Access Journals (Sweden)

Naoko eYoshinaga

2014-04-01

Full Text Available Fatty acid amino acid conjugates (FACs, first identified in lepidopteran caterpillar spit as elicitors of plant volatile emission, also have been reported as major components in gut tracts of Drosophila melanogaster and cricket Teleogryllus taiwanemma. The profile of FAC analogs in these two insects was similar to that of tobacco hornworm Manduca sexta, showing glutamic acid conjugates predominantly over glutamine conjugates. The physiological function of FACs is presumably to enhance nitrogen assimilation in Spodoptera litura larvae, but in other insects it is totally unknown. Whether these insects share a common synthetic mechanism of FACs is also unclear. In this study, the biosynthesis of FACs was examined in vitro in five lepidopteran species (M. sexta, Cephonodes hylas, silkworm, S. litura, and Mythimna separata, fruit fly larvae and T. taiwanemma. The fresh midgut tissues of all of the tested insects showed the ability to synthesize glutamine conjugates in vitro when incubated with glutamine and sodium linolenate. Such direct conjugation was also observed for glutamic acid conjugates in all the insects but the product amount was very small and did not reflect the in vivo FAC patterns in each species. In fruit fly larvae, the predominance of glutamic acid conjugates could be explained by a shortage of substrate glutamine in midgut tissues, and in M. sexta, a rapid hydrolysis of glutamine conjugates has been reported. In crickets, we found an additional unique biosynthetic pathway for glutamic acid conjugates. T. taiwanemma converted glutamine conjugates to glutamic acid conjugates by deaminating the side chain of the glutamine moiety. Considering these findings together with previous results, a possibility that FACs in these insects are results of convergent evolution can not be ruled out, but it is more likely that the ancestral insects had the glutamine conjugates and crickets and other insects developed glutamic acid conjugates in a

Photosynthetic carbon fixation characteristics of fruiting structures of Brassica campestris L

International Nuclear Information System (INIS)

Singal, H.R.; Sheoran, I.S.; Singh, R.

1987-01-01

Activities of key enzymes of the Calvin cycle and C 4 metabolism, rates of CO 2 fixation, and the initial products of photosynthetic 14 CO 2 fixation were determined in the podwall, seed coat (fruiting structures), and the subtending leaf (leaf below a receme) of Brassica campestris L. cv Toria. Compared to activities of ribulose-1,5-bisphosphate carboxylase and other Calvin cycle enzymes, e.g. NADP-glyceraldehyde-3-phosphate-dehydrogenase and ribulose-5-phosphate kinase, the activities of phosphoenol pyruvate carboxylase and other enzymes of C 4 metabolism, viz. NADP-malate dehydrogenase, NADP-malic enzyme, glutamate pyruvate transaminase, and glutamate oxaloacetate transaminase, were generally much higher in seed than in podwall and leaf. Podwall and leaf were comparable to each other. Pulse-chase experiments showed that in seed the major product of 14 CO 2 assimilation was malate (in short time), whereas in podwall and leaf, the label initially appeared in 3-PGA. With time, the label moved to sucrose. In contrast to legumes, Brassica pods were able to fix net CO 2 during light. However, respiratory losses were very high during the dark period

Evolution of Enzymatic Activities in the Enolase Superfamily: L-Fuconate Dehydratase from Xanthomonas campestris

Energy Technology Data Exchange (ETDEWEB)

Yew,W.; Fedorov, A.; Fedorov, E.; Rakus, J.; Pierce, R.; Almo, S.; Gerlt, J.

2006-01-01

Many members of the mechanistically diverse enolase superfamily have unknown functions. In this report the authors use both genome (operon) context and screening of a library of acid sugars to assign the L-fuconate dehydratase (FucD) function to a member of the mandelate racemase (MR) subgroup of the superfamily encoded by the Xanthomonas campestris pv. campestris str. ATCC 33913 genome (GI: 21233491). Orthologues of FucD are found in both bacteria and eukaryotes, the latter including the rTS beta protein in Homo sapiens that has been implicated in regulating thymidylate synthase activity. As suggested by sequence alignments and confirmed by high-resolution structures in the presence of active site ligands, FucD and MR share the same active site motif of functional groups: three carboxylate ligands for the essential Mg2+ located at the ends of th third, fourth, and fifth-strands in the (/)7-barrel domain (Asp 248, Glu 274, and Glu 301, respectively), a Lys-x-Lys motif at the end of the second-strand (Lys 218 and Lys 220), a His-Asp dyad at the end of the seventh and sixth-strands (His 351 and Asp 324, respectively), and a Glue at the end of the eighth-strand (Glu 382). The mechanism of the FucD reaction involves initial abstraction of the 2-proton by Lys 220, acid catalysis of the vinylogous-elimination of the 3-OH group by His 351, and stereospecific ketonization of the resulting 2-keto-3-deoxy-L-fuconate product. Screening of the library of acid sugars revealed substrate and functional promiscuity: In addition to L-fuconate, FucD also catalyzes the dehydration of L-galactonate, D-arabinonate, D-altronate, L-talonate, and D-ribonate. The dehydrations of L-fuconate, L-galactonate, and D-arabinonate are initiated by abstraction of the 2-protons by Lys 220. The dehydrations of L-talonate and D-ribonate are initiated by abstraction of the 2-protons by His 351; however, protonation of the enediolate intermediates by the conjugate acid of Lys 220 yields L

Morphological characterization of local landraces of rapeseed (Brassica campestris L. var toria of Nepal

Directory of Open Access Journals (Sweden)

Salik Ram Gupta

2015-12-01

Full Text Available Rapeseed (Brassica campestris L. var toria is the main source of edible oil for Nepalese people. 54 rapeseed lines were collected from different hilly district of Nepal ranging from 987 m to 2550 m altitude. These lines were planted in augmented design for its traits characterization in Khumaltar 2013. Different traits of local rapeseed were characterized, and evaluated. NGRC 02778 performed better followed by SR-02 than local checks Morang-2, Chitwan Local and Unnati in terms of yield, days to maturity and pest infestation. Similarly, genotype SR-18 was late and SR-16 was earlier in terms of days to maturity. In conclusion, SR-02 was found better genotype based on different characteristics measured among all local rapeseeds planted in Khumaltar 2013. Thus SR-2 can be used as parents in crossing material for further breeding purposes and it can also be tested in further trial.

Hydration benefits to courtship feeding in crickets

Science.gov (United States)

Ivy, T. M.; Johnson, J. C.; Sakaluk, S. K.

1999-01-01

The spermatophore transferred by male decorated crickets (Gryllodes sigillatus) at mating includes a large gelatinous spermatophylax that the female consumes after copulation. Although previous studies have shown that G. sigillatus females gain no nutritional benefits from consuming food gifts, there may be other benefits to their consumption. We examined potential hydration benefits to females by experimentally manipulating both the availability of water and the number of food gifts that females consumed, and by measuring their effect on female fitness. Analysis of the number of nymphs produced by females revealed a significant interaction between the number of spermatophylaxes consumed and water availability. When spermatophylaxes were not provided, females given water ad libitum produced significantly more nymphs than females subjected to water stress. Female longevity was significantly affected by water availability, with an increase in the availability of water corresponding to a significant increase in female longevity. These data suggest that female G. sigillatus accrue fitness benefits by consuming spermatophylaxes when alternative sources of water are unavailable. In addition, females appear to allocate water contained in spermatophylaxes towards reproduction as opposed to survival.

ComVisMD - compact visualization of multidimensional data: experimenting with cricket players data

Science.gov (United States)

Dandin, Shridhar B.; Ducassé, Mireille

2018-03-01

Database information is multidimensional and often displayed in tabular format (row/column display). Presented in aggregated form, multidimensional data can be used to analyze the records or objects. Online Analytical database Processing (OLAP) proposes mechanisms to display multidimensional data in aggregated forms. A choropleth map is a thematic map in which areas are colored in proportion to the measurement of a statistical variable being displayed, such as population density. They are used mostly for compact graphical representation of geographical information. We propose a system, ComVisMD inspired by choropleth map and the OLAP cube to visualize multidimensional data in a compact way. ComVisMD displays multidimensional data like OLAP Cube, where we are mapping an attribute a (first dimension, e.g. year started playing cricket) in vertical direction, object coloring based on b (second dimension, e.g. batting average), mapping varying-size circles based on attribute c (third dimension, e.g. highest score), mapping numbers based on attribute d (fourth dimension, e.g. matches played). We illustrate our approach on cricket players data, namely on two tables Country and Player. They have a large number of rows and columns: 246 rows and 17 columns for players of one country. ComVisMD’s visualization reduces the size of the tabular display by a factor of about 4, allowing users to grasp more information at a time than the bare table display.

Formulação de meios de cultivo à base de soro de leite para a produção de goma xantana por X. Campestris C7L Formulation of whey-based media for xanthan gum production by X. Campestris C7L isolate

Directory of Open Access Journals (Sweden)

Marcia NITSCHKE

2001-01-01

Full Text Available A goma xantana é um polissacarídeo microbiano de grande significado comercial especialmente para a indústria de alimentos. O objetivo deste trabalho foi avaliar a produção de xantana em diferentes meios de cultura à base de soro de leite utilizando o isolado Xanthomonas campestris C7L. Dentre as formulações testadas o meio de soro de leite integral produziu maior viscosidade e concentração final de xantana. Um sistema combinando soro integral (0,35% de proteína e soro filtrado (0,18%de proteína foi proposto. Na primeira fase em soro integral a produção de xantana foi de 13g/L e 45% de rendimento,enquanto que na segunda fase utilizando-se soro filtrado obteve-se um total de 28g/L de xantana e 75% de rendimento. O rendimento geral do processo foi de 55% e a viscosidade final do meio atingiu 18000cP. As soluções de xantana produzidas em soro de leite apresentaram comportamento pseudoplástico e tixotrópico característicos deste tipo de polímero. O isolado C7L demonstrou capacidade de produzir gomas de alta viscosidade e qualidade em soro de leite, constituindo uma alternativa promissora para a produção industrial de goma xantana a partir deste subproduto.Xanthan gum is a microbial polysaccharide of great commercial interest, especially in the food industry. The aim of this work was the evaluation of xanthan gum production from different whey - based media by a lactose utilizing Xanthomonas campestris C7L isolate. Three whey media formulations were tested: unfiltered whey, filtered whey and hydrolyzed whey. The medium composed of unfiltered whey showed the highest viscosities and xanthan concentrations. A two stage fermentation strategy, combining unfiltered whey (0,35% protein and filtered whey (0,18% protein, was proposed. The first stage, using unfiltered whey medium, showed a xanthan production of 12g/L and a 45% yield. The second stage, with filtered whey addition, gave final xanthan concentration of 28g/L and a 75% yield

Interaction of the phage-xanthomonas campestris (Pammel) Dowson at the eletronic microscopy level, Virazole effect and radioautographic study of the phage action on the host

International Nuclear Information System (INIS)

Sittolin, I.M.

1982-04-01

A bacteriophage from the cabbage tissue infected with Xanthomonas campestris is described. The infection process is studied through a negative staining technique (PTA) and ultrathin section. The effect of Virazole, an antivirus agent, is tested. Radioautography showed that the phage presented a reasonable domain on the bacterial host genome since the beginning of the treatment. Sorological reactions indicated the induction of specific antibodies for the phage. (M.A.C.) [pt

Producão de goma xantana por X. Campestris ATCC 13951 utilizando soro de queijo desproteinado

Directory of Open Access Journals (Sweden)

Jenny Sobenes G.

2015-12-01

Full Text Available A goma xantana é um biopolímero microbiano producido pela bactéria Xanthomonas. O presente trabalho teve como objetivo estudar a produção de goma xantana por processo fermentativo utilizando a linhagem X. campestris ATCC 13951 e como fonte de carbono: soro de queijo desproteinado suplementado com extrato de levedura e sulfato de amônia como fontes de nitrogênio; soro de queijo desproteinado suplementado só com extrato de levedura como fonte de nitrogênio e só soro de queijo desproteinado sem suplementos, tempo de fermentação de 72h para os três meios. Dos meios em análise aquele constituido apenas por soro de queijo desproteinado, atingiu o maior rendimento com valor de 58% e a melhor qualidade de goma.

New Records Reveal the Actual Distribution of Cratomelus meritus Gorochov (Orthoptera: Anostostomatidae), a Giant Red Cricket from Chile.

Science.gov (United States)

Alfaro, F M; Zuñiga-Reinoso, A; Muñoz-Ramírez, C; Elgueta, M

2015-04-01

The geographic distribution of the red cricket Cratomelus meritus Gorochov had remained unknown until now due to mislabeling and lack of new records. The aim of this short communication is to uncover and establish the actual distribution of the species on the basis of new records and discuss potential biogeographic hypotheses about its distribution.

Moisture adsorption properties and shelf-life estimation of dried and pulverised edible house cricket Acheta domesticus (L.) and black soldier fly larvae Hermetia illucens (L.).

Science.gov (United States)

Kamau, E; Mutungi, C; Kinyuru, J; Imathiu, S; Tanga, C; Affognon, H; Ekesi, S; Nakimbugwe, D; Fiaboe, K K M

2018-04-01

Edible insects are part of the diets of a significant proportion of rural populations in the tropics especially Africa and Asia, and their use as source of key nutrients for better nutrition is re-emerging. Indigenously, elemental methods are used to process the insects before they are consumed or sold in retail outlets. In recent years, better knowledge of processing, packaging and storage has become necessary because of commercialisation needs. A common processing approach involves drying after a brief heat-treatment step, and then milling into a powdered product which is sold to manufacturers or consumers as ingredient for processing final products. The hydration properties of dried powders of edible house cricket and black soldier fly larvae (BSFL) were studied with the aim of predicting shelf-life stability under typical packaging and storage temperatures experienced in the tropics. Moisture adsorption isotherms were determined gravimetrically at 25, 30 and 35 °C, over 0.11-0.97 water activity (a W ) range, and the data fitted to various models. Sorption isotherms were of type II according to Brunauer classification indicating monolayer-multilayer sorption behaviour. Cricket powder exhibited higher hydration capacity, and a W of this product was less sensitive to temperature variation as compared to BSFL powder. In the two products, water exhibited transitions from bound- to free- state at ~5 g/100 g moisture content. Based on Heiss-Eichner model, a shelf-life of 7 months at 25 °C can be achieved if the cricket and BSFL powders are dried to ca. 5 g/100 g moisture content and packaged in 80 μm thick polyethylene films. At 35 °C the shelf-life of the cricket product is shortened three- to four-fold whereas the BSFL powder is unable to store. Copyright © 2018 Elsevier Ltd. All rights reserved.

Terminal investment in the gustatory appeal of nuptial food gifts in crickets.

Science.gov (United States)

Duffield, K R; Hunt, J; Rapkin, J; Sadd, B M; Sakaluk, S K

2015-10-01

Investment in current versus future reproduction represents a prominent trade-off in life-history theory and is likely dependent on an individual's life expectancy. The terminal investment hypothesis posits that a reduction in residual reproductive value (i.e. potential for future offspring) will result in increased investment in current reproduction. We tested the hypothesis that male decorated crickets (Gryllodes sigillatus), when cued to their impending mortality, should increase their reproductive effort by altering the composition of their nuptial food gifts (i.e. spermatophylaxes) to increase their gustatory appeal to females. Using a repeated-measures design, we analysed the amino acid composition of spermatophylaxes derived from males both before and after injection of either a saline control or a solution of heat-killed bacteria. The latter, although nonpathogenic, represents an immune challenge that may signal an impending survival threat. One principal component explaining amino acid variation in spermatophylaxes, characterized by a high loading to histidine, was significantly lower in immune-challenged versus control males. The relevance of this difference for the gustatory appeal of gifts to females was assessed by mapping spermatophylax composition onto a fitness surface derived in an earlier study identifying the amino acid composition of spermatophylaxes preferred by females. We found that immune-challenged males maintained the level of attractiveness of their gifts post-treatment, whereas control males produced significantly less attractive gifts post-injection. These results are consistent with the hypothesis that cues of a survival-threatening infection stimulate terminal investment in male decorated crickets with respect to the gustatory appeal of their nuptial food gifts. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.

Quantitative characterization of the filiform mechanosensory hair array on the cricket cercus.

Directory of Open Access Journals (Sweden)

John P Miller

Full Text Available Crickets and other orthopteran insects sense air currents with a pair of abdominal appendages resembling antennae, called cerci. Each cercus in the common house cricket Acheta domesticus is approximately 1 cm long, and is covered with 500 to 750 filiform mechanosensory hairs. The distribution of the hairs on the cerci, as well as the global patterns of their movement vectors, have been characterized semi-quantitatively in studies over the last 40 years, and have been shown to be very stereotypical across different animals in this species. Although the cercal sensory system has been the focus of many studies in the areas of neuroethology, development, biomechanics, sensory function and neural coding, there has not yet been a quantitative study of the functional morphology of the receptor array of this important model system.We present a quantitative characterization of the structural characteristics and functional morphology of the cercal filiform hair array. We demonstrate that the excitatory direction along each hair's movement plane can be identified by features of its socket that are visible at the light-microscopic level, and that the length of the hair associated with each socket can also be estimated accurately from a structural parameter of the socket. We characterize the length and directionality of all hairs on the basal half of a sample of three cerci, and present statistical analyses of the distributions.The inter-animal variation of several global organizational features is low, consistent with constraints imposed by functional effectiveness and/or developmental processes. Contrary to previous reports, however, we show that the filiform hairs are not re-identifiable in the strict sense.

Formation of apolar ecdysteroid conjugates by ovaries of the house cricket Acheta domesticus in vitro.

OpenAIRE

Whiting, P; Dinan, L

1988-01-01

The newly laid eggs of the house cricket Acheta domesticus contain apolar ecdysteroid conjugates, which we have hypothesized to be ecdysone long-chain fatty acyl esters [Whiting & Dinan (1988) J. Insect Physiol., in the press]. The ovaries of mature adult female A. domesticus in vitro convert [3H]ecdysone into apolar conjugates identical with those found in newly laid eggs. Comparison of the radioactive metabolites produced on incubation of [3H]ecdysone with various organs of adult female A. ...

Pace bowlers in cricket with history of lumbar stress fracture have increased risk of lower limb muscle strains, particularly calf strains

Directory of Open Access Journals (Sweden)

John Orchard

2010-09-01

Full Text Available John Orchard1, Patrick Farhart2, Alex Kountouris3, Trefor James3, Marc Portus31School of Public Health, University of Sydney, Australia; 2Punjab Kings XI team, Indian Premier League, India; 3Cricket Australia, Melbourne, AustraliaObjective: To assess whether a history of lumbar stress fracture in pace bowlers in cricket is a risk factor for lower limb muscle strains.Methods: This was a prospective cohort risk factor study, conducted using injury data from contracted first class pace bowlers in Australia during seasons 1998–1999 to 2008–2009 inclusive. There were 205 pace bowlers, 33 of whom suffered a lumbar stress fracture when playing first class cricket. Risk ratios ([RR] with 95% confidence intervals[CI] were calculated to compare the seasonal incidence of various injuries between bowlers with a prior history of lumbar stress fracture and those with no history of lumbar stress fracture.Results: Risk of calf strain was strongly associated with prior lumbar stress fracture injury history (RR = 4.1; 95% CI: 2.4–7.1. Risks of both hamstring strain (RR = 1.5; 95% CI: 1.03–2.1 and quadriceps strain (RR = 2.0; 95% CI: 1.1–3.5 were somewhat associated with history of lumbar stress fracture. Risk of groin strain was not associated with history of lumbar stress fracture (RR = 0.7; 95% CI: 0.4–1.1. Other injuries showed little association with prior lumbar stress fracture, although knee cartilage injuries were more likely in the non-stress fracture group.Conclusion: Bony hypertrophy associated with lumbar stress fracture healing may lead to subsequent lumbar nerve root impingement, making lower limb muscle strains more likely to occur. Confounders may be responsible for some of the findings. In particular, bowling speed is likely to be independently correlated with risk of lumbar stress fracture and risk of muscle strain. However, as the relationship between lumbar stress fracture history and calf strain was very strong, and that there is a

Crickets are not a free lunch: protein capture from scalable organic side-streams via high-density populations of Acheta domesticus.

Directory of Open Access Journals (Sweden)

Mark E Lundy

Full Text Available It has been suggested that the ecological impact of crickets as a source of dietary protein is less than conventional forms of livestock due to their comparatively efficient feed conversion and ability to consume organic side-streams. This study measured the biomass output and feed conversion ratios of house crickets (Acheta domesticus reared on diets that varied in quality, ranging from grain-based to highly cellulosic diets. The measurements were made at a much greater population scale and density than any previously reported in the scientific literature. The biomass accumulation was strongly influenced by the quality of the diet (p99% mortality without reaching a harvestable size. Therefore, the potential for A. domesticus to sustainably supplement the global protein supply, beyond what is currently produced via grain-fed chickens, will depend on capturing regionally scalable organic side-streams of relatively high-quality that are not currently being used for livestock production.

Bioconversion from crude glycerin by Xanthomonas campestris 2103: xanthan production and characterization

Directory of Open Access Journals (Sweden)

L. V. Brandão

2013-12-01

Full Text Available The production and rheological properties of xanthan gum from crude glycerin fermentation, a primary by-product of the biodiesel industry with environmental and health risks, were evaluated. Batch fermentations (28 °C/250 rpm /120 h were carried out using crude glycerin, 0.01% urea and 0.1% KH2PO4, (% w/v, and compared to a sucrose control under the same operational conditions, using Xanthomonas campestris strain 2103 isolate from Brazil. Its maximal production by crude glycerin fermentation was 7.23±0.1 g·L-1 at 120 h, with an apparent viscosity of 642.57 mPa·s, (2 % w/v, 25 °C, 25 s-1, 70% and 30% higher than from sucrose fermentation, respectively. Its molecular weight varied from 28.2 to 36.2×10(6 Da. The Ostwald-de-Waele model parameters (K and n indicated a pseudoplastic behavior at all concentrations (0.5 to 2.0 %, w/v and temperatures (25-85 °C, while its consistency index indicated promising rheological properties for drilling fluid applications. Therefore, crude glycerin has potential as a cost-effective and alternative substrate for non-food grade xanthan production.

Auditory DUM neurons in a bush-cricket: A filter bank for carrier frequency.

Science.gov (United States)

Lefebvre, Paule Chloé; Seifert, Marvin; Stumpner, Andreas

2018-05-01

In bush-crickets the first stage of central auditory processing occurs in the prothoracic ganglion. About 15 to 50 different auditory dorsal unpaired median neurons (DUM neurons) exist but they have not been studied in any detail. These DUM neurons may be classified into seven different morphological types, although, there is only limited correlation between morphology and physiological responses. Ninety seven percent of the stained neurons were local, 3% were intersegmental. About 90% project nearly exclusively into the auditory neuropile, and 45% into restricted areas therein. Lateral extensions overlap with the axons of primary auditory sensory neurons close to their branching point. DUM neurons are typically tuned to frequencies covering the range between 2 and 50 kHz and thereby may establish a filter bank for carrier frequency. Less than 10% of DUM neurons have their branches in adjacent and more posterior regions of the auditory neuropile and are mostly tuned to low frequencies, less sensitive than the other types and respond to vibration. Thirty five percent of DUM show indications of inhibition, either through reduced responses at higher intensities, or by hyperpolarizing responses to sound. Most DUM neurons produce phasic spike responses preferably at higher intensities. Spikes may be elicited by intracellular current injection. Preliminary data suggest that auditory DUM neurons have GABA as transmitter and therefore may inhibit other auditory interneurons. From all known local auditory neurons, only DUM neurons have frequency specific responses which appear suited for local processing relevant for acoustic communication in bush crickets. © 2018 Wiley Periodicals, Inc.

Anthropometric, biomechanical, and isokinetic strength predictors of ball release speed in high-performance cricket fast bowlers.

Science.gov (United States)

Wormgoor, Shohn; Harden, Lois; Mckinon, Warrick

2010-07-01

Fast bowling is fundamental to all forms of cricket. The purpose of this study was to identify parameters that contribute to high ball release speeds in cricket fast bowlers. We assessed anthropometric dimensions, concentric and eccentric isokinetic strength of selected knee and shoulder muscle groups, and specific aspects of technique from a single delivery in 28 high-performance fast bowlers (age 22.0 +/- 3.0 years, ball release speed 34.0 +/- 1.3 m s(-1)). Six 50-Hz cameras and the Ariel Performance Analysis System software were used to analyse the fast and accurate deliveries. Using Pearson's correlation, parameters that showed significant associations with ball release speed were identified. The findings suggest that greater front leg knee extension at ball release (r=0.52), shoulder alignment in the transverse plane rotated further away from the batsman at front foot strike (r=0.47), greater ankle height during the delivery stride (r=0.44), and greater shoulder extension strength (r=0.39) contribute significantly to higher ball release speeds. Predictor variables failed to allow their incorporation into a multivariate model, which is known to exist in less accomplished bowlers, suggesting that factors that determine ball release speed found in other groups may not apply to high-performance fast bowlers.

Circadian locomotor rhythms in the cricket, Gryllodes sigillatus. II. Interactions between bilaterally paired circadian pacemakers.

Science.gov (United States)

Ushirogawa, H; Abe, Y; Tomioka, K

1997-10-01

The optic lobe is essential for circadian locomotor rhythms in the cricket, Gryllodes sigillatus. We examined potential interactions between the bilaterally paired optic lobes in circadian rhythm generation. When one optic lobe was removed, the free-running period of the locomotor rhythm slightly but significantly lengthened. When exposed to light-dark cycles (LD) with 26 hr period, intact and sham operated animals were clearly entrained to the light cycle, but a large number of animals receiving unilateral optic nerve severance showed rhythm dissociation. In the dissociation, two rhythmic components appeared; one was readily entrained to the given LD and the other free-ran with a period shorter than 24 hr, and activity was expressed only when they were inphase. The period of the free-running component was significantly longer than that of the animals with a single blinded pacemaker kept in LD13:13, suggesting that the pacemaker on the intact side had some influence on the blinded pacemaker even in the dissociated state. The ratio of animals with rhythm dissociation was greater with the lower light intensity of the LD. The results suggest that the bilaterally distributed pacemakers are only weakly coupled to one another but strongly suppress the activity driven by the partner pacemaker during their subjective day. The strong suppression of activity would be advantageous to keep a stable nocturnality for this cricket living indoors.

Involvement of plasma membrane Ca2+ channels, IP3 receptors, and ryanodine receptors in the generation of spontaneous rhythmic contractions of the cricket lateral oviduct.

Science.gov (United States)

Tamashiro, Hirotake; Yoshino, Masami

2014-12-01

In the present study, the isolated cricket (Gryllus bimaculatus) lateral oviduct exhibited spontaneous rhythmic contractions (SRCs) with a frequency of 0.29±0.009 Hz (n=43) and an amplitude of 14.6±1.25 mg (n=29). SRCs completely disappeared following removal of extracellular Ca2+ using a solution containing 5mM EGTA. Application of the non-specific Ca2+ channel blockers Co2+, Ni2+, and Cd2+ also decreased both the frequency and amplitude of SRCs in dose-dependent manners, suggesting that Ca2+ entry through plasma membrane Ca2+ channels is essential for the generation of SRCs. Application of ryanodine (30 μM), which depletes intracellular Ca2+ by locking ryanodine receptor (RyR)-Ca2+ channels in an open state, gradually reduced the frequency and amplitude of SRCs. A RyR antagonist, tetracaine, reduced both the frequency and amplitude of SRCs, whereas a RyR activator, caffeine, increased the frequency of SRCs with a subsequent increase in basal tonus, indicating that RyRs are essential for generating SRCs. To further investigate the involvement of phospholipase C (PLC) and inositol 1,4,5-trisphosphate receptors (IP3Rs) in SRCs, we examined the effect of a PLC inhibitor, U73122, and an IP3R antagonist, 2-aminoethoxydiphenyl borate (2-APB), on SRCs. Separately, U73122 (10 μM) and 2-APB (30-50 μM) both significantly reduced the amplitude of SRCs with little effect on their frequency, further indicating that the PLC/IP3R signaling pathway is fundamental to the modulation of the amplitude of SRCs. A hypotonic-induced increase in the frequency and amplitude of SRCs and a hypertonic-induced decrease in the frequency and amplitude of SRCs indicated that mechanical stretch of the lateral oviduct is involved in the generation of SRCs. The sarcoplasmic reticulum Ca2+-pump ATPase inhibitors thapsigargin and cyclopiazonic acid impaired or suppressed the relaxation phase of SRCs. Taken together, the present results indicate that Ca2+ influx through plasma membrane Ca2

Metal accumulation in a potential winter vegetable mustard (Brassica campestris L.) irrigated with different types of waters in Punjab, Pakistan

International Nuclear Information System (INIS)

Khan, Z. I.; Ahmad, K.; Yasmeen, S.; Ashfaq, A.

2016-01-01

Considering the harmful effects of metal-enriched vegetables a comprehensive study was conducted to appraise the extent of accumulation of different metals in mustard (Brassica campestris L.). The vegetable was treated with ground water, sewage water and canal water irrigation in areas of Punjab, Pakistan. Metals and metalloids observed in all three sites treated with sewage, canal and ground water were As, Cu, Fe, Ni, Pb, Mo, Se and Zn were observed in the sites treated with ground, sewage and canal waters as well as the vegetable grown therein. The metal concentration observed in water samples was: Fe>Zn >Pb> Ni> Mo> Cu> As> Se, the order in the soil was: As >Pb> Fe > Ni > Mo > Cu > Zn > Se, while the order in the vegetable was: Zn > Fe> Cu> Ni> Mo>Pb> As> Se. The values of bio-concentration factor varied from 0.09-15.47 mg kg-1. Correlation was positively significant for Brassica campestris and soil except Ni and Se which showed positive non significant correlation. Pollution load index was observed to be in the following order: As >Pb> Ni > Mo >Fe > Cu > Se > Zn in the sites GWI, CWI and CWI. Fe and Zn (0.169) showed highest value of daily intake of metal (DIM), while Se (0.003) showed lowest value in crop of all three sites GWI, CWI and CWI. The health risk index and EF ranged from 0.24-69.86 mg day/sup -1/and 0.134-14.12 mg day/sup -1/, respectively. Overall, the vegetable treated with sewage water may have considerable impact on food quality and in turn on the health of people consuming it. (author)

Distinguishing psychological characteristics of expert cricket batsmen.

Science.gov (United States)

Weissensteiner, Juanita R; Abernethy, Bruce; Farrow, Damian; Gross, John

2012-01-01

This paper sought to determine the psychological characteristics and skills that are fundamental to batting success in the sport of cricket. Following on from the findings of an earlier qualitative investigation which suggested that a favourable mix of psychological attributes and skills are critical to high performance in batting (Weissensteiner et al.(10)), adult-aged batsmen of two different skill levels (highly skilled n=11; lesser skilled n=10) completed a battery of psychological tests that included measures of mental toughness (Mental Toughness Inventory), perfectionism (Multidimensional Perfectionism Scale), coping ability (Athletic Coping Skills Inventory-28), and optimism (Attributional Styles Questionnaire). Contrary to the research hypothesis, it was found that the highly skilled batsmen were only distinguishable from batsmen of lesser skill by their higher degree of global mental toughness. The skilled batsmen scored significantly higher on mental toughness dimensions relating to motivation (Personal Bests, Task Value and Commitment), coping skill (Perseverance) and self-belief (Potential). If mental toughness can be reliably predicted at an earlier age, it may be an attribute worthy of inclusion in future talent identification and development programs. Copyright © 2011 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

Effects of cold acclimation on rectal macromorphology, ultrastructure, and cytoskeletal stability in Gryllus pennsylvanicus crickets

Czech Academy of Sciences Publication Activity Database

Des Marteaux, Lauren E.; Stinziano, J. R.; Sinclair, B. J.

2018-01-01

Roč. 104, JAN 10 (2018), s. 15-24 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : insect * phenotypic plasticity * actin Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.227, year: 2016 https://www.sciencedirect.com/science/article/pii/S0022191017302925?via%3Dihub

Roles of aminergic neurons in formation and recall of associative memory in crickets

Directory of Open Access Journals (Sweden)

Makoto Mizunami

2010-11-01

Full Text Available We review recent progress in the study of roles of octopaminergic (OA-ergic and dopaminergic (DA-ergic signaling in insect classical conditioning, focusing on our studies on crickets. Studies on olfactory learning in honey bees and fruit-flies have suggested that OA-ergic and DA-ergic neurons convey reinforcing signals of appetitive unconditioned stimulus (US and aversive US, respectively. Our work suggested that this is applicable to olfactory, visual pattern and color learning in crickets, indicating that this feature is ubiquitous in learning of various sensory stimuli. We also showed that aversive memory decayed much faster than did appetitive memory, and we proposed that this feature is common in insects and humans. Our study also suggested that activation of OA- or DA-ergic neurons is needed for appetitive or aversive memory recall, respectively. To account for this finding, we proposed a model in which it is assumed that two types of synaptic connections are strengthened by conditioning and are activated during memory recall, one type being connections from neurons representing conditioned stimulus (CS to neurons inducing conditioned response and the other being connections from neurons representing CS to OA- or DA-ergic neurons representing appetitive or aversive US, respectively. The former is called stimulus-response (S-R connection and the latter is called stimulus-stimulus (S-S connection by theorists studying classical conditioning in vertebrates. Results of our studies using a second-order conditioning procedure supported our model. We propose that insect classical conditioning involves the formation of S-S connection and its activation for memory recall, which are often called cognitive processes.

Predicting Where a Radiation Will Occur: Acoustic and Molecular Surveys Reveal Overlooked Diversity in Indian Ocean Island Crickets (Mogoplistinae: Ornebius.

Directory of Open Access Journals (Sweden)

Ben H Warren

Full Text Available Recent theory suggests that the geographic location of island radiations (local accumulation of species diversity due to cladogenesis can be predicted based on island area and isolation. Crickets are a suitable group for testing these predictions, as they show both the ability to reach some of the most isolated islands in the world, and to speciate at small spatial scales. Despite substantial song variation between closely related species in many island cricket lineages worldwide, to date this characteristic has not received attention in the western Indian Ocean islands; existing species descriptions are based on morphology alone. Here we use a combination of acoustics and DNA sequencing to survey these islands for Ornebius crickets. We uncover a small but previously unknown radiation in the Mascarenes, constituting a three-fold increase in the Ornebius species diversity of this archipelago (from two to six species. A further new species is detected in the Comoros. Although double archipelago colonisation is the best explanation for species diversity in the Seychelles, in situ cladogenesis is the best explanation for the six species in the Mascarenes and two species of the Comoros. Whether the radiation of Mascarene Ornebius results from intra- or purely inter- island speciation cannot be determined on the basis of the phylogenetic data alone. However, the existence of genetic, song and ecological divergence at the intra-island scale is suggestive of an intra-island speciation scenario in which ecological and mating traits diverge hand-in-hand. Our results suggest that the geographic location of Ornebius radiations is partially but not fully explained by island area and isolation. A notable anomaly is Madagascar, where our surveys are consistent with existing accounts in finding no Ornebius species present. Possible explanations are discussed, invoking ecological differences between species and differences in environmental history between

Releasing stimuli and aggression in crickets: octopamine promotes escalation and maintenance but not initiation

Directory of Open Access Journals (Sweden)

Jan eRillich

2015-04-01

Full Text Available Biogenic amines have widespread effects on numerous behaviors, but their natural functions are often unclear. We investigated the role of octopamine (OA, the invertebrate analogue of noradrenaline, on initiation and maintenance of aggression in male crickets of different social status. The key-releasing stimulus for aggression is antennal fencing between males, a behavior occurring naturally on initial contact. We show that mechanical antennal stimulation (AS alone is sufficient to initiate an aggressive response (mandible threat display. The efficacy of AS was augmented in winners of a previous fight, but unaffected in losers. The efficacy of AS was not, however, influenced by OA receptor (OAR agonists or antagonists, regardless of social status. Additional experiments indicate that the efficacy of AS is also not influenced by dopamine (DA or serotonin (5HT. In addition to initiating an aggressive response, prior AS enhanced aggression exhibited in subsequent fights, whereby AS with a male antenna was now necessary, indicating a role for male contact pheromones. This priming effect of male-AS on subsequent aggression was dependent on OA since it was blocked by OAR-antagonists, and enhanced by OAR-agonists. Together our data reveal that neither OA, DA nor 5HT are required for initiating aggression in crickets, nor do these amines influence the efficacy of the natural releasing stimulus to initiate aggression. OA’s natural function is restricted to promoting escalation and maintenance of aggression once initiated, and this can be invoked by numerous experiences, including prior contact with a male antenna as shown here.

Desenvolvimento vegetativo de Mentha campestris Schur e produção de mentol em diferentes espaçamentos de plantio e épocas de colheita Vegetative development of Mentha campestris Schur and menthol production in different row spaces and harvest times

Directory of Open Access Journals (Sweden)

R. Monteiro

2011-01-01

Full Text Available A produção de óleos essenciais nas plantas aromáticas é influenciada por fatores bióticos e abióticos. A demanda por esses produtos tem aumentado, sendo os óleos essenciais do gênero Mentha de grande interesse nas indústrias farmacêutica, de cosméticos, alimentícia e agrícola, principalmente em função do composto mentol. Esse trabalho teve como objetivo avaliar o efeito de três espaçamentos de plantio (0,60 x 0,15 m; 0,60 x 0,30 m e 0,60 x 0,45 m e duas épocas de colheita (60 e 90 dias após o plantio na espécie Mentha campestris Schur. O experimento foi conduzido no Centro de Estações Experimentais do Canguiri-UFPR, em Pinhais-PR, no período de janeiro a abril de 2008. O delineamento utilizado foi o de blocos ao acaso em esquema de parcelas subdivididas. Houve diferença significativa para todas as variáveis analisadas. As massas secas de folhas, ramos e total foram maiores que na primeira época. Para a biomassa seca de folhas foram observados maiores valores no menor espaçamento de plantio. O rendimento de óleo essencial foi maior na segunda época de colheita e nos espaçamentos maiores. A produtividade do óleo também foi maior na segunda época de colheita, porém no espaçamento mais adensado. Pode-se concluir como recomendação para M. campestris Schur o espaçamento 0,60 x 0,15 m e colheita aos 90 dias, por terem atingido maior biomassa, rendimento de óleo essencial e produtividade de mentol por hectare.Essential oil production in aromatic plants is influenced by biotic and abiotic factors. The demand for these products has increased, and essential oils from the genus Mentha have been of great interest for pharmaceutical, cosmetic, food and agronomic industries, especially because of the compound menthol. This study aimed to evaluate the effect of three row spaces (0.60 x 0.15 m; 0.60 x 0.30 m and 0.60 x 0.45 m and two harvest times (60 and 90 days after planting on the species Mentha campestris Schur. The

Structure of a Novel N-acetyl-L-citrulline Deacetylase from Xanthomonas campestris

Energy Technology Data Exchange (ETDEWEB)

Shi,D.; Yu, X.; Roth, L.; Tuchman, M.; Allewell, N.

2007-01-01

The structure of a novel acetylcitrulline deacetylase from the plant pathogen Xanthomonas campestris has been solved by multiple-wavelength anomalous dispersion (MAD) using crystals grown from selenomethionine-substituted protein and refined at 1.75 {angstrom} resolution. The asymmetric unit of the crystal contains one monomer consisting of two domains, a catalytic domain and a dimerization domain. The catalytic domain is able to bind a single Co(II) ion at the active site with no change in confirmation. the dimerization domain forms an interface between two monomers related by a crystallographic two-fold symmetry axis. The interface is maintained by hydrophobic interactions between helices and hydrogen bonding between two {beta} strands that form a continuous {beta} sheet across the dimer interface. Because the dimers are also related by two-fold crystallographic axes, they pack together across the crystal via the dimerization domain, suggesting that higher order oligomers may form in solution. The polypeptide fold of the monomer is similar to the fold of Pseudomonas sp. carboxypeptidase G2 and Neisseria meningitidis succinyl diaminopimelate desuccinylase. Structural comparison among these enzymes allowed modeling of substrate binding and suggests a possible catalytic mechanism, in which Glu130 functions as a bifunctional general acid-base catalyst and the metal ion polarizes the carbonyl of the acetyl group.

Xanthan biosynthesis by Xanthomonas campestris ATCC 13951 on wastewaters from white grape processing

Directory of Open Access Journals (Sweden)

Rončević Zorana

2017-01-01

Full Text Available Wastewaters from grape processing in wineries are characterized by large seasonal fluctuations in volume and composition, and are often discarded into environment with little or no treatment. The biotechnological production of valuable products is the most promising alternative for reducing the negative environmental impact and recycling these effluents. Results from previous study show that mixed winery wastewaters, after additional optimization of the medium preparation, may be a suitable raw material for industrial xanthan production. Therefore, the aim of this work was to examine the possibility of xanthan production by Xanthomonas campestris ATCC 13951 on mixed wastewaters from different stages of white grape processing in winery with initial sugars content of 20 g/L. In addition to the media characteristics and indicators of biopolymer quality, raw xanthan yield and degree of sugars conversion into product were determined in order to examine the success of performed bioprocess. The results for biopolymer yield (14.66 g/L and sugars conversion into desired product (70.21% obtained in applied experimental conditions confirm that wastewaters from white grape processing have a great potential to be used as a substrate for xanthan biosynthesis.

Effect of 60Co γ irradiation with seed and shoot-tip of Brassica campestris L. var on its culture in vitro

International Nuclear Information System (INIS)

Liao Feixiong; Yu Rangcai; Pan Ruichi

2003-01-01

The survival rate in vitro of shoot-tips of Brassica campestris L. var from seeds irradiated by 60 Co γ-rays decreased with the increase of dose. Irradiation inhibited proliferation of shoot-tip, induction of callus from cotyledons and differentiation of the callus. The age of explant contributed to the effect of irradiation in the culture. Irradiation stimulated the proliferation of shoot-tip with dose less than 50 Gy. Based on the effect of irradiation in the tissue culture, the effective dose recommended was about 200 Gy for seeds, 50-100 Gy for pre-soaked germinating seeds and 40-70 Gy for shoot-tips in vitro, respectively

Efficiency of Sports Leagues - The Economic Implications of Having Two Leagues in the Indian Cricket Market

OpenAIRE

Vig, Arun

2008-01-01

Worldwide more and more money is being invested in sports teams and professional sports leagues. There are numerous sports that are popular in different parts of the world. In the United States, its American Football, in Europe and UK it is Football (soccer); in the Indian sub-continent and Australia it is Cricket that attracts the largest crowds. If we study the professional sporting leagues around the world usually there is only one major/premier league in every sport. Smaller leagues e...

A Suppressor of the Menadione-Hypersensitive Phenotype of a Xanthomonas campestris pv. phaseoli oxyR Mutant Reveals a Novel Mechanism of Toxicity and the Protective Role of Alkyl Hydroperoxide Reductase

Science.gov (United States)

Vattanaviboon, Paiboon; Whangsuk, Wirongrong; Mongkolsuk, Skorn

2003-01-01

We isolated menadione-resistant mutants of Xanthomonas campestris pv. phaseoli oxyR (oxyRXp). The oxyRR2Xp mutant was hyperresistant to the superoxide generators menadione and plumbagin and was moderately resistant to H2O2 and tert-butyl hydroperoxide. Analysis of enzymes involved in oxidative-stress protection in the oxyRR2Xp mutant revealed a >10-fold increase in AhpC and AhpF levels, while the levels of superoxide dismutase (SOD), catalase, and the organic hydroperoxide resistance protein (Ohr) were not significantly altered. Inactivation of ahpC in the oxyRR2Xp mutant resulted in increased sensitivity to menadione killing. Moreover, high levels of expression of cloned ahpC and ahpF in the oxyRXp mutant complemented the menadione hypersensitivity phenotype. High levels of other oxidant-scavenging enzymes such as catalase and SOD did not protect the cells from menadione toxicity. These data strongly suggest that the toxicity of superoxide generators could be mediated via organic peroxide production and that alkyl hydroperoxide reductase has an important novel function in the protection against the toxicity of these compounds in X. campestris. PMID:12591894

Polyandry and fitness of offspring reared under varying nutritional stress in decorated crickets.

Science.gov (United States)

Sakaluk, Scott K; Schaus, Jennifer M; Eggert, Anne-Katrin; Snedden, W Andrew; Brady, Pamela L

2002-10-01

Females, by mating with more than one male in their lifetime, may reduce their risk of receiving sperm from genetically incompatible sires or increase their prospects of obtaining sperm from genetically superior sires. Although there is evidence of both kinds of genetic benefits in crickets, their relative importance remains unclear, and the extent to which experimentally manipulated levels of polyandry in the laboratory correspond to those that occur in nature remain unknown. We measured lifetime polyandry of free-living female decorated crickets, Gryllodes sigillatus, and conducted an experiment to determine whether polyandry leads to an increase in offspring viability. We experimentally manipulated both the levels of polyandry and opportunities for females to select among males, randomly allocating the offspring of experimental females to high-food-stress or low-food-stress regimes to complete their development. Females exhibited a high degree of polyandry, mating on average with more than seven different males during their lifetime and up to as many as 15. Polyandry had no effect on either the developmental time or survival of offspring. However, polyandrous females produced significantly heavier sons than those of monandrous females, although there was no difference in the adult mass of daughters. There was no significant interaction between mating treatment and offspring nutritional regimen in their effects on offspring mass, suggesting that benefits accruing to female polyandry are independent of the environment in which offspring develop. The sex difference in the extent to which male and female offspring benefit via their mother's polyandry may reflect possible differences in the fitness returns from sons and daughters. The larger mass gain shown by sons of polyandrous females probably leads to their increased reproductive success, either because of their increased success in sperm competition or because of their increased life span.

Food fight: sexual conflict over free amino acids in the nuptial gifts of male decorated crickets.

Science.gov (United States)

Gershman, S N; Hunt, J; Sakaluk, S K

2013-04-01

In decorated crickets, Gryllodes sigillatus, the spermatophore that a male transfers at mating includes a gelatinous spermatophylax that the female consumes, delaying her removal of the sperm-filled ampulla. Male fertilization success increases with the length of time females spend feeding on the spermatophylax, while females may benefit by prematurely discarding the spermatophylaxes of undesirable males. This sexual conflict should favour males that produce increasingly appealing spermatophylaxes, and females that resist this manipulation. To determine the genetic basis of female spermatophylax feeding behaviour, we fed spermatophylaxes to females of nine inbred lines and found that female genotype had a major influence on spermatophylax feeding duration. The amino acid composition of the spermatophylax was also significantly heritable. There was a positive genetic correlation between spermatophylax feeding duration and the gustatory appeal of the spermatophylax. This correlation suggests that genes expressed in males that produce more manipulative spermatophylaxes are positively linked to genes expressed in females that make them more vulnerable to manipulation. Outbred females spent less time feeding on spermatophylaxes than inbred females, and thus showed greater resistance to male manipulation. Further, in a nonspermatophylax producing cricket (Acheta domesticus), females were significantly more prone to feeding on spermatophylaxes than outbred female Gryllodes. Collectively, these results suggest a history of sexually antagonistic coevolution over the consumption of nuptial food gifts. © 2013 The Authors. Journal of Evolutionary Biology © 2013 European Society For Evolutionary Biology.

The Relationship Between Morphological Symmetry and Immune Response in Wild-Caught Adult Bush-Crickets

Directory of Open Access Journals (Sweden)

Åsa Berggren

2009-09-01

Full Text Available Despite interest in the relationship between fluctuating asymmetry (FA, immune response and ecological factors in insects, little data are available from wild populations. In this study we measured FA and immune response in 370 wild-caught male bush-crickets, Metrioptera roeseli, from 20 experimentally introduced populations in southern-central Sweden. Individuals with more-symmetric wings had a higher immune response as measured by the cellular encapsulation of a surgically-implanted nylon monofilament. However, we found no relationship between measures of FA in other organs (i.e. tibia and maxillary palp and immune response, suggesting that this pattern may reflect differing selection pressures.

Limpeza clonal de mudas de videira infectadas por Xanthomonas campestris pv. viticola

Directory of Open Access Journals (Sweden)

Adriano Márcio Freire Silva

2013-03-01

Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.

Overexpression of stress-related genes in Cuscuta campestris in response to host defense reactions

Directory of Open Access Journals (Sweden)

Hamed Rezaei

2017-07-01

Full Text Available Herb dodder ( Cuscuta spp. is one of the most important parasitic plants that can severely affect crop yields in the world. So far, interactions of this parasitic plant with hosts were not investigated adequately. Here, we conducted a differential expression analyzes and identified a number of genes that were differentially expressed in haustorium tissue compared with the stem of Cuscuta campestris growing on Alfalfa. We obtained 439 cDNA fragments from haustoria (parasite-host connection zone and stems (25 cm away from connections zones using the cDNA-AFLP (Amplified Fragment Length Polymorphism method with eight different primer combinations. Of 439 transcript-derived fragments (TDFs that were detected, 145 fragments were identified as differentially expressed genes. Five TDF sequences were similar to known functional genes involved in signal transduction, metabolism, respiration, and stress responses. Genes encoding DEAD-box ATP-dependent RNA helicase, potential heme-binding protein, lysine-specific demethylase 5A were selected for qRT-PCR. The qRT-PCR analyzes confirmed the results obtained using cDNA-AFLP. Our findings shed light on the elicitation of dodder defense responses in the connection zone to overcome plant defense reactions.

Alfalfa dodder (Cuscuta campestris) toxicity in horses: clinical, haematological and serum biochemical findings.

Science.gov (United States)

Abutarbush, S M

2013-07-27

The objective of this observational study is to describe clinical, haematological and serum biochemical findings of horses affected with alfalfa dodder (Cuscuta campestris) toxicity. Twenty horses naturally exposed to alfalfa dodder toxicity were examined and information was collected on history and clinical signs. Physical examination was done on horses in the premises (n=20), and venous blood samples of 12 horses were submitted for haematology and serum biochemical examination for each horse. Abnormal clinical signs started around 36 hours after horses were fed the contaminated alfalfa. Abnormal signs were seen in 11 horses and those included diarrhoea (n=8), decreased appetite (n=7), neurological signs (n=4) and abdominal pain (n=1). Some horses had multiple clinical signs of the above. The results of complete blood cell count revealed leukocytopenia, neutropenia and thrombocytopenia. Serum biochemical analysis revealed decreased ALP, AST and CPK levels and increased direct bilirubin level. The used alfalfa was stopped immediately and a different alfalfa from a new container that did not contain any weeds was fed. Horses on the premises were observed closely, and the abnormal clinical signs resolved within three days. No treatment was implemented. Knowledge about toxicity of horses by Cuscuta species is scarce in the English veterinary literature and very limited.

Alleviation of Drought Stress by Nitrogen Application in Brassica campestris ssp. Chinensis L.

Directory of Open Access Journals (Sweden)

Xin Xiong

2018-05-01

Full Text Available To assess the influence of drought stress on the growth and nitrogen nutrition status of pakchoi (Brassica campestris ssp. Chinensis L. at different nitrogen (N levels, the changes in N accumulation and enzyme activities involved in N assimilation were investigated. The drought was induced by adding polyethylene glycol (PEG under hydroponic culture conditions. Pakchoi seedlings were exposed to a modified nutrient solution with different nitrogen concentration (N1, N2, and N3 represent 2, 9 and 18 mM NaNO3, respectively and osmotic potential (W1, W2 and W3 represent 0, 60 and 120 g·L−1 PEG 6000 in a full factorial, replicated randomized block design. A short time (seven days of drought stress caused a significant decline in plant water content, transpiration rate, shoot biomass and shoot nitrogen concentration. Increasing N availability considerably alleviate drought stress by increasing the content of total free amino acids in the roots, promoting the acceleration of root biomass accumulation, and improving the activities of nitrate reductase (NR; EC 1.7.1.1 and glutamine synthetase (GS; EC 6.3.1.2 which would reduce moisture limitations. The results suggested that pakchoi supplied with relative higher N had better growth performance under drought stress.

Salacia campestris root bark extract: peroxidase inhibition, antioxidant and antiradical profile

Directory of Open Access Journals (Sweden)

José Carlos Rebuglio Vellosa

2009-03-01

Full Text Available Reactive oxygen species (ROS and free radical species have been implicated in initiating or accompanying many diseases in living organisms; there is thus, a continual need for antioxidants molecules to inactivate ROS/free radicals. Many studies of plants crude extracts have demonstrated free-radical scavenging and antioxidant action. Salacia species have long been used, in several countries, as traditional medicines against certain diseases and for their anti-inflammatory properties. In this study, Salacia campestris Walp (Hippocrateaceae root bark ethanol extract (ScEtOH was assessed for its ability to scavenge free radicals and reactive oxygen species; the results were expressed as percentage inhibition of the active species. ScEtOH was efficient against studied species: DPPH radical (obtained inhibition = 30%, ABTS•+ (IC50 = 1.8±0.8 μg/mL, HOCl (IC50 = 1.7 ± 0.1 μg/mL, O2•- (obtained inhibition = 32%, and NO• (obtained inhibition = 18 %. Peroxidase activity inhibition was evaluated through the guaiacol oxidation reaction catalyzed by hemin, HRP and myeloperoxidase (MPO; data showed that ScEtOH at 10 μg/mL led to 54 and 51% of inhibition, respectively, for the hemin and HRP systems. In the MPO system, ScEtOH promoted a 50% inhibition at 8.9 μg/mL, whereas quercetin, a powerful MPO inhibitor, inhibited this system at 1.35 μg/mL.Espécies reativas do oxigênio (ERO e radicais livres estão relacionados ao início ou à exacerbação de muitas doenças em organismos vivos; existindo portanto uma necessidade contínua por moléculas antioxidantes que inativem as ERO e radicais livres. Muitos estudos com extratos brutos de plantas têm demonstrado propriedades antioxidantes e seqüestradoras de radicais livres. Espécies de Salacia são utilizadas, em muitos países, como remédio tradicional contra certas doenças e por suas propriedades antiinflamatórias. Neste estudo, o extrato bruto etanólico da casca da raiz da Salacia

Grasshoppers, crickets (Orthoptera and earwigs (Dermaptera of Tovačov gravel pit (central Moravia, Czech Republic: New locality for several thermophilous species in anthropogenic secondary habitat

Directory of Open Access Journals (Sweden)

Trnka Filip

2015-12-01

Full Text Available Study of Orthoptera and earwigs was conducted in Tovačov gravel pit in 2014. We have recorded 18 species of Orthoptera and 3 species of earwigs. The most significant recorded species are Cepero’s ground-hopper (Tetrix ceperoi, pygmy mole cricket (Xya variegata, Italian tree cricket (Oecanthus pellucens and riparian earwig (Labidura riparia. Tovačov gravel pit poses the northernmost locality of T. ceperoi and X. variegata in the Czech Republic and the northernmost known locality in Moravia for O. pellucens. For the L. riparia, we present a founding from Tovačov together with another finding from Olomouc vicinity, which is currently the northernmost locality within Moravia. Our findings display recent spatial expansion of some thermophilous species. Moreover, we emphasize importance of (post-industrial areas as secondary habitats for specialised endangered species.

Body Size, Fecundity, and Sexual Size Dimorphism in the Neotropical Cricket Macroanaxipha macilenta (Saussure) (Orthoptera: Gryllidae).

Science.gov (United States)

Cueva Del Castillo, R

2015-04-01

Body size is directly or indirectly correlated with fitness. Body size, which conveys maximal fitness, often differs between sexes. Sexual size dimorphism (SSD) evolves because body size tends to be related to reproductive success through different pathways in males and females. In general, female insects are larger than males, suggesting that natural selection for high female fecundity could be stronger than sexual selection in males. I assessed the role of body size and fecundity in SSD in the Neotropical cricket Macroanaxipha macilenta (Saussure). This species shows a SSD bias toward males. Females did not present a correlation between number of eggs and body size. Nonetheless, there were fluctuations in the number of eggs carried by females during the sampling period, and the size of females that were collected carrying eggs was larger than that of females collected with no eggs. Since mating induces vitellogenesis in some cricket species, differences in female body size might suggest male mate choice. Sexual selection in the body size of males of M. macilenta may possibly be stronger than the selection of female fecundity. Even so, no mating behavior was observed during the field observations, including audible male calling or courtship songs, yet males may produce ultrasonic calls due to their size. If female body size in M. macilenta is not directly related to fecundity, the lack of a correlated response to selection on female body size could represent an alternate evolutionary pathway in the evolution of body size and SSD in insects.

Studies on the physiological changes in the rice plants infected with Xanthomonas campestris pv. oryzae, (3)

International Nuclear Information System (INIS)

Watanabe, Minoru; Samejima, Shin-ichi; Hosokawa, Daijiro

1980-01-01

Accumulation of 14 C-photosynthetic assimilates in rice leaves infected with Xanthomonas campestris pv. oryzae was studied by using autoradiography for the purpose of elucidating the movement of nutrients from healthy tissues to the infected parts. When rice plants were exposed to 14 CO 2 immediately after inoculation, 14 C-photosynthetic assimilates did not accumulate in and around the inoculated spots of leaves until the lesions became visible, i.e., approximately 7 days after inoculation. When the leaves were exposed to 14 CO 2 before visible lesions appeared, 2 and 5 days after inoculation, the assimilates did not accumulate in the inoculated areas, but apparently accumulated in the lesions 24 hr later on from the exposure of leaves with visible lesions. In the newly formed lesions, accumulation site corresponded to the yellow streak parts of lesions along leaf veins. In the large and old lesions, assimilates hardly any accumulated in the center of lesions, grayish-white in color, but accumulated in the border parts of lesions adjacent to healthy tissues which are developing and yellow streak in symptoms. (author)

Wing mechanics, vibrational and acoustic communication in a new bush-cricket species of the genus Copiphora (Orthoptera: Tettigoniidae) from Colombia

OpenAIRE

Sarria-S, Fabio; Buxton, Kallum; Jonsson, Thorin; Montealegre-Z, Fernando

2016-01-01

Male bush-crickets produce acoustic signals by wing stridulation to call females. Several species also alternate vibratory signals with acoustic calls for intraspecific communication, a way to reduce risk of detection by eavesdropping predators. Both modes of communication have been documented mostly in neotropical species, for example in the genus Copiphora. In this article, we studied vibratory and acoustic signals and the biophysics of wing resonance in C. vigorosa, a new species from the ...

RNAi of the circadian clock gene period disrupts the circadian rhythm but not the circatidal rhythm in the mangrove cricket

OpenAIRE

Takekata, Hiroki; Matsuura, Yu; Goto, Shin G.; Satoh, Aya; Numata, Hideharu

2012-01-01

The clock mechanism for circatidal rhythm has long been controversial, and its molecular basis is completely unknown. The mangrove cricket, Apteronemobius asahinai, shows two rhythms simultaneously in its locomotor activity: a circatidal rhythm producing active and inactive phases as well as a circadian rhythm modifying the activity intensity of circatidal active phases. The role of the clock gene period (per), one of the key components of the circadian clock in insects, was investigated in t...

Antioxidant Enzyme Activities and Lipid Oxidation in Rape (Brassica campestris L. Bee Pollen Added to Salami during Processing

Directory of Open Access Journals (Sweden)

Yawei Zhang

2016-10-01

Full Text Available The present research investigated the antioxidant effect of rape (Brassica campestris L. bee pollen (RBP on salami during processing. Eight flavonoids in RBP ethanol extract were quantified by high-performance liquid chromatography-mass spectrometry (HPLC-MS analysis, and quercetin, rutin, and kaempferol were the major bioactive compounds. The RBP ethanol extract exhibited higher total antioxidant capacity than 6-hydroxy-2,5,7,8-tertramethylchromancarboxylic acid (trolox at the same concentration. The salami with 0.05% RBP extract had higher catalase (CAT, superoxide dismutase (SOD, and glutathione peroxidase (GSH-Px activities than that of the control throughout the processing time (p < 0.05. Significant decreases in peroxide value (POV and thiobarbituric acid-reactive substances (TBARS were obtained in the final salami product with 0.05% RBP ethanol extract or 1% RBP (p < 0.05. These results suggested that RBP could improve oxidative stability and had a good potential as a natural antioxidant for retarding lipid oxidation.

Ballistic movements of jumping legs implemented as variable components of cricket behaviour.

Science.gov (United States)

Hustert, R; Baldus, M

2010-12-01

Ballistic accelerations of a limb or the whole body require special joint mechanisms in many animals. Specialized joints can be moved by stereotypic or variable motor control during motor patterns with and without ballistic components. As a model of variable motor control, the specialized femur-tibia (knee) joints of cricket (Acheta domesticus) hindlegs were studied during ballistic kicking, jumping and swimming and in non-ballistic walking. In this joint the tendons of the antagonistic flexor and the extensor muscles attach at different distances from the pivot and the opposed lever arms form an angle of 120 deg. A 10:1 ratio of their effective lever arms at full knee flexion helps to prepare for most ballistic extensions: the tension of the extensor can reach its peak while it is restrained by flexor co-contraction. In kicks, preparatory flexion is rapid and the co-contraction terminates just before knee extensions. Therefore, mainly the stored tension of the extensor muscle accelerates the small mass of the tibia. Jumps are prepared with slower extensor-flexor co-contractions that flex both knees simultaneously and then halt to rotate both legs outward to a near horizontal level. From there, catapult extension of both knees accelerates the body, supported by continued high frequency motor activity to their tibia extensor muscles during the ongoing push-off from the substrate. Premature extension of one knee instantly takes load from the lagging leg that extends and catches up, which finally results in a straight jump. In swimming, synchronous ballistic power strokes of both hindlegs drive the tibiae on a ventral-to-posterior trajectory through the water, well coordinated with the swimming patterns of all legs. In walking, running and climbing the steps of the hindlegs range between 45 deg flexion and 125 deg extension and use non-ballistic, alternating activity of knee flexor and extensor muscles. Steep climbing requires longer bursts from the extensor tibiae

Comparison of three types of full‐body compression garments on throwing and repeat‐sprint performance in cricket players

Science.gov (United States)

Duffield, Rob; Portus, Marc

2007-01-01

Objective To compare the effects of three types of full‐body compression garments (Skins, Adidas and Under Armour) on repeat‐sprint and throwing performance in cricket players. Methods Following familiarisation, 10 male cricket players performed four randomised exercise sessions (3 garments and a control). Each session involved a 30 min repeat‐sprint exercise protocol comprising 20 m sprints every minute, separated by submaximal exercise. Throwing tests included a pre‐exercise and a postexercise maximal distance test and accuracy throwing tests. During each session, measures of heart rate, skin temperature, change in body mass, rate of perceived exertion and perceived muscle soreness were recorded. Capillary blood samples were analysed before and after exercise for lactate, pH, O2 saturation and O2 partial pressure, and 24 h after exercise for creatine kinase (CK). Ratings of perceived muscle soreness were also obtained 24 h after exercise. Results No significant differences (p>0.05) were evident in repeat‐sprint performance (10 m, 20 m time or total submaximal distance covered) or throwing performance (maximum distance or accuracy). No significant differences (p>0.05) were observed in heart rate, body mass change or blood measures during exercise. Significant differences (p0.05). Conclusions No benefit was noted when wearing compression garments for repeat‐sprint or throwing performance; however, the use of the garments as a recovery tool, when worn after exercise, may be beneficial to reduce postexercise trauma and perceived muscle soreness. PMID:17341589

Comparison of three types of full-body compression garments on throwing and repeat-sprint performance in cricket players.

Science.gov (United States)

Duffield, Rob; Portus, Marc

2007-07-01

To compare the effects of three types of full-body compression garments (Skins, Adidas and Under Armour) on repeat-sprint and throwing performance in cricket players. Following familiarisation, 10 male cricket players performed four randomised exercise sessions (3 garments and a control). Each session involved a 30 min repeat-sprint exercise protocol comprising 20 m sprints every minute, separated by submaximal exercise. Throwing tests included a pre-exercise and a postexercise maximal distance test and accuracy throwing tests. During each session, measures of heart rate, skin temperature, change in body mass, rate of perceived exertion and perceived muscle soreness were recorded. Capillary blood samples were analysed before and after exercise for lactate, pH, O(2) saturation and O(2) partial pressure, and 24 h after exercise for creatine kinase (CK). Ratings of perceived muscle soreness were also obtained 24 h after exercise. No significant differences (p>0.05) were evident in repeat-sprint performance (10 m, 20 m time or total submaximal distance covered) or throwing performance (maximum distance or accuracy). No significant differences (p>0.05) were observed in heart rate, body mass change or blood measures during exercise. Significant differences (p0.05). No benefit was noted when wearing compression garments for repeat-sprint or throwing performance; however, the use of the garments as a recovery tool, when worn after exercise, may be beneficial to reduce postexercise trauma and perceived muscle soreness.

Macronutrient intake regulates sexual conflict in decorated crickets.

Science.gov (United States)

Rapkin, J; Jensen, K; Lane, S M; House, C M; Sakaluk, S K; Hunt, J

2016-02-01

Sexual conflict results in a diversity of sex-specific adaptations, including chemical additions to ejaculates. Male decorated crickets (Gryllodes sigillatus) produce a gelatinous nuptial gift (the spermatophylax) that varies in size and free amino acid composition, which influences a female's willingness to fully consume this gift. Complete consumption of this gift maximizes sperm transfer through increased retention of the sperm-containing ampulla, but hinders post-copulatory mate choice. Here, we examine the effects of protein (P) and carbohydrate (C) intake on the weight and amino acid composition of the spermatophylax that describes its gustatory appeal to the female, as well as the ability of this gift to regulate sexual conflict via ampulla attachment time. Nutrient intake had similar effects on the expression of these traits with each maximized at a high intake of nutrients with a P : C ratio of 1 : 1.3. Under dietary choice, males actively regulated their nutrient intake but this regulation did not coincide with the peak of the nutritional landscape for any trait. Our results therefore demonstrate that a balanced intake of nutrients is central to regulating sexual conflict in G. sigillatus, but males are constrained from reaching the optima needed to bias the outcome of this conflict in their favour. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.

Testing the Effects of DL-Alpha-Tocopherol Supplementation on Oxidative Damage, Total Antioxidant Protection and the Sex-Specific Responses of Reproductive Effort and Lifespan to Dietary Manipulation in Australian Field Crickets (Teleogryllus commodus

Directory of Open Access Journals (Sweden)

C. Ruth Archer

2015-12-01

Full Text Available The oxidative stress theory predicts that the accumulation of oxidative damage causes aging. More generally, oxidative damage could be a cost of reproduction that reduces survival. Both of these hypotheses have mixed empirical support. To better understand the life-history consequences of oxidative damage, we fed male and female Australian field crickets (Teleogryllus commodus four diets differing in their protein and carbohydrate content, which have sex-specific effects on reproductive effort and lifespan. We supplemented half of these crickets with the vitamin E isoform DL-alpha-tocopherol and measured the effects of nutrient intake on lifespan, reproduction, oxidative damage and antioxidant protection. We found a clear trade-off between reproductive effort and lifespan in females but not in males. In direct contrast to the oxidative stress theory, crickets fed diets that improved their lifespan had high levels of oxidative damage to proteins. Supplementation with DL-alpha-tocopherol did not significantly improve lifespan or reproductive effort. However, males fed diets that increased their reproductive investment experienced high oxidative damage to proteins. While this suggests that male reproductive effort could elevate oxidative damage, this was not associated with reduced male survival. Overall, these results provide little evidence that oxidative damage plays a central role in mediating life-history trade-offs in T. commodus.

TGF-β signaling in insects regulates metamorphosis via juvenile hormone biosynthesis.

Science.gov (United States)

Ishimaru, Yoshiyasu; Tomonari, Sayuri; Matsuoka, Yuji; Watanabe, Takahito; Miyawaki, Katsuyuki; Bando, Tetsuya; Tomioka, Kenji; Ohuchi, Hideyo; Noji, Sumihare; Mito, Taro

2016-05-17

Although butterflies undergo a dramatic morphological transformation from larva to adult via a pupal stage (holometamorphosis), crickets undergo a metamorphosis from nymph to adult without formation of a pupa (hemimetamorphosis). Despite these differences, both processes are regulated by common mechanisms that involve 20-hydroxyecdysone (20E) and juvenile hormone (JH). JH regulates many aspects of insect physiology, such as development, reproduction, diapause, and metamorphosis. Consequently, strict regulation of JH levels is crucial throughout an insect's life cycle. However, it remains unclear how JH synthesis is regulated. Here, we report that in the corpora allata of the cricket, Gryllus bimaculatus, Myoglianin (Gb'Myo), a homolog of Drosophila Myoglianin/vertebrate GDF8/11, is involved in the down-regulation of JH production by suppressing the expression of a gene encoding JH acid O-methyltransferase, Gb'jhamt In contrast, JH production is up-regulated by Decapentaplegic (Gb'Dpp) and Glass-bottom boat/60A (Gb'Gbb) signaling that occurs as part of the transcriptional activation of Gb'jhamt Gb'Myo defines the nature of each developmental transition by regulating JH titer and the interactions between JH and 20E. When Gb'myo expression is suppressed, the activation of Gb'jhamt expression and secretion of 20E induce molting, thereby leading to the next instar before the last nymphal instar. Conversely, high Gb'myo expression induces metamorphosis during the last nymphal instar through the cessation of JH synthesis. Gb'myo also regulates final insect size. Because Myo/GDF8/11 and Dpp/bone morphogenetic protein (BMP)2/4-Gbb/BMP5-8 are conserved in both invertebrates and vertebrates, the present findings provide common regulatory mechanisms for endocrine control of animal development.

Formulação de meios de cultivo à base de soro de leite para a produção de goma xantana por X. Campestris C7L

OpenAIRE

NITSCHKE,Marcia; RODRIGUES,Vanessa; SCHINATTO,Lisiane Fiorio

2001-01-01

A goma xantana é um polissacarídeo microbiano de grande significado comercial especialmente para a indústria de alimentos. O objetivo deste trabalho foi avaliar a produção de xantana em diferentes meios de cultura à base de soro de leite utilizando o isolado Xanthomonas campestris C7L. Dentre as formulações testadas o meio de soro de leite integral produziu maior viscosidade e concentração final de xantana. Um sistema combinando soro integral (0,35% de proteína) e soro filtrado (0,18%de prote...

Nutritive values of brassica campestris L. oil as affected by growth regulator treatments

International Nuclear Information System (INIS)

Bano, A.; Khan, N.

2009-01-01

The effects of plant growth regulators, viz. Indole acetic acid (IAA), Gibberellic acid (GA) and Abscisic acid (ABA) were studied on fatty acid compositions, glucosinolate content and protein content of Brassica campestris L subsp. Oleifera (common name yellow sarson). Growth regulators were applied in seed soaking solution as well as foliar spray during vegetative phase and at flowering stage. There were reductions in the amount of long chain fatty acids viz erucic acid, eicosenoic acid and increase in the amount of unsaturated fatty acid viz. linoleic acid by lAA applications. The stimulating effect of lAA which reduced amount of unsaturated fatty acid was more pronounced when applied as foliar spray at vegetative stage. But, foliar spray of ABA during flowering increased the concentration of linoleic acid and reduced the eicosenoic acid and erucic acid. The glucosinolate content was greater in seeds soaked in 10/sup -5/ M lAA than that of control but less in 10/sup -5/ M GA treated seeds than that of control. The ABA treatment (10/sup -5/M) increased the concentration of glucosinolates in the seeds IAA treatments (10/sup -5/M) increased the protein percentage in the seeds. Foliar application of GA (10/sup -5/M) during vegetative growth and ABA (10/sup -5/M) as seed soaking prior to sowing as well as foliar spry during flowering decreased the protein content of seeds. (author)

The role of product information on consumer sensory evaluation, expectations, experiences and emotions of cricket-flour-containing buns.

Science.gov (United States)

Pambo, Kennedy O; Okello, Julius J; Mbeche, Robert M; Kinyuru, John N; Alemu, Mohammed H

2018-04-01

Studies suggest that consumer' acceptance of edible insects can be enhanced by processing and blending them with familiar food products. This is however, expected to result in changes in some sensory attributes. In this study, we investigated how consumers evaluate the appropriateness of sensory attributes of a common bakery product (buns) that was blended with cricket-flour i.e., cricket-flour-containing (CFC) buns. We also tested whether provision of information can modulate the sensory evaluations, personal involvement and emotions. The study is based on a field experiment involving 432 participants drawn from rural communities in Kenya. Participants were randomly assigned to 3 information treatment groups: i) Control group - received only general information, ii) Treatment 1 - received general information and information about the benefits (i.e., positive attributes), iii) Treatment 2 - received general information and information about the potential drawbacks (i.e., negative attributes). Participants evaluated the CFC buns before and after tasting using Just-About-Right (JAR) scale. Results indicate that providing product information affected sensory evaluation of the product's sensory attributes. They also indicate that actual tasting of the CFC buns improved the convergence of sensory evaluation of the attributes towards the ideal level. Results further show that CFC buns elicited more positive feelings with little differences in the emotional profiles between the information treatments, which suggests general interest in the buns. These results provide useful insights on how to enhance consumer acceptance of insect-based foods. We discuss the implications of the findings. Copyright © 2018 Elsevier Ltd. All rights reserved.

[Mechanism of the constant representation of the position of a sound signal source by the cricket cercal system neurons].

Science.gov (United States)

Rozhkova, G I; Polishcuk, N A

1976-01-01

Previously it has been shown that some abdominal giant neurones of the cricket have constant preffered directions of sound stimulation in relation not to the cerci (the organs bearing sound receptors) but to the insect body (fig. 1) [1]. Now it is found that the independence of directional sensitivity of giant neurones on the cerci position disappears after cutting all structures connecting the cerci to the body (except cercal nerves) (fig 2). Therefore the constancy of directional sensitivity of the giant nerones is provided by proprioceptive signals about cerci position.

Male crickets adjust ejaculate quality with both risk and intensity of sperm competition.

Science.gov (United States)

Simmons, Leigh W; Denholm, Amy; Jackson, Chantelle; Levy, Esther; Madon, Ewa

2007-10-22

Sperm competition theory predicts that males should increase their expenditure on the ejaculate with increasing risk of sperm competition, but decrease their expenditure with increasing intensity. There is accumulating evidence for sperm competition theory, based on examinations of testes size and/or the numbers of sperm ejaculated. However, recent studies suggest that ejaculate quality can also be subject to selection by sperm competition. We used experimental manipulations of the risk and intensity of sperm competition in the cricket, Teleogryllus oceanicus. We found that males produced ejaculates with a greater percentage of live sperm when they had encountered a rival male prior to mating. However, when mating with a female that presented a high intensity of sperm competition, males did not respond to risk, but produced ejaculates with a reduced percentage of live sperm. Our data suggest that males exhibit a fine-tuned hierarchy of responses to these cues of sperm competition.

Cell wall-bound invertase limits sucrose export and is involved in symptom development and inhibition of photosynthesis during compatible interaction between tomato and Xanthomonas campestris pv vesicatoria.

Science.gov (United States)

Kocal, Nurcan; Sonnewald, Uwe; Sonnewald, Sophia

2008-11-01

Cell wall-bound invertase (cw-Inv) plays an important role in carbohydrate partitioning and regulation of sink-source interaction. There is increasing evidence that pathogens interfere with sink-source interaction, and induction of cw-Inv activity has frequently been shown in response to pathogen infection. To investigate the role of cw-Inv, transgenic tomato (Solanum lycopersicum) plants silenced for the major leaf cw-Inv isoforms were generated and analyzed during normal growth and during the compatible interaction with Xanthomonas campestris pv vesicatoria. Under normal growth conditions, activities of sucrolytic enzymes as well as photosynthesis and respiration were unaltered in the transgenic plants compared with wild-type plants. However, starch levels of source leaves were strongly reduced, which was most likely caused by an enhanced sucrose exudation rate. Following X. campestris pv vesicatoria infection, cw-Inv-silenced plants showed an increased sucrose to hexose ratio in the apoplast of leaves. Symptom development, inhibition of photosynthesis, and expression of photosynthetic genes were clearly delayed in transgenic plants compared with wild-type plants. In addition, induction of senescence-associated and pathogenesis-related genes observed in infected wild-type plants was abolished in cw-Inv-silenced tomato lines. These changes were not associated with decreased bacterial growth. In conclusion, cw-Inv restricts carbon export from source leaves and regulates the sucrose to hexose ratio in the apoplast. Furthermore, an increased apoplastic hexose to sucrose ratio can be linked to inhibition of photosynthesis and induction of pathogenesis-related gene expression but does not significantly influence bacterial growth. Indirectly, bacteria may benefit from low invertase activity, since the longevity of host cells is raised and basal defense might be dampened.

Nutritional Potential of Selected Insect Species Reared on the Island of Sumatra.

Science.gov (United States)

Adámková, Anna; Mlček, Jiří; Kouřimská, Lenka; Borkovcová, Marie; Bušina, Tomáš; Adámek, Martin; Bednářová, Martina; Krajsa, Jan

2017-05-12

Inhabitants of the Indonesian island of Sumatra are faced with the problem of insufficient food supplies and the consequent risk of undernourishment and health issues. Edible insects as a traditional and readily available food source could be part of the solution. The nutritional value of insects depends on many factors, e.g., species, developmental stage, sex, diet, and climatic conditions. However, edible insects bred in Sumatra for human consumption have never before been assessed with regard to their nutritional value. Our study involved analyses of crude protein, chitin, fat and selected fatty acid contents of giant mealworm larvae ( Zophobas morio ), larvae of the common mealworm ( Tenebrio molitor) and nymphs of the field cricket ( Gryllus assimilis ). Crude protein content in the samples ranged from 46% to 56%. Highest (35%) and lowest (31%) amounts of fat were recorded in giant mealworm larvae and larvae of the common mealworm, respectively. Chitin amounts ranged from 6% to 13%. Based on these values, which are comparable to those known from other food insects reared in different regions of the world, the edible species bred in Sumatra could become food sources with a potential to help stave off hunger and undernourishment.

Context dependency and generality of fever in insects

Science.gov (United States)

Stahlschmidt, Z. R.; Adamo, S. A.

2013-07-01

Fever can reduce mortality in infected animals. Yet, despite its fitness-enhancing qualities, fever often varies among animals. We used several approaches to examine this variation in insects. Texas field crickets ( Gryllus texensis) exhibited a modest fever (1 °C increase in preferred body temperature, T pref) after injection of prostaglandin, which putatively mediates fever in both vertebrates and invertebrates, but they did not exhibit fever during chronic exposure to heat-killed bacteria. Further, chronic food limitation and mating status did not affect T pref or the expression of behavioural fever, suggesting limited context dependency of fever in G. texensis. Our meta-analysis of behavioural fever studies indicated that behavioural fever occurs in many insects, but it is not ubiquitous. Thus, both empirical and meta-analytical results suggest that the fever response in insects `is widespread, although certainly not inevitable' (Moore 2002). We highlight the need for future work focusing on standardizing an experimental protocol to measure behavioural fever, understanding the specific mechanism(s) underlying fever in insects, and examining whether ecological or physiological costs often outweigh the benefits of fever and can explain the sporadic nature of fever in insects.

Evaluation of the radioimmunoassay, indirect enzyme linked immunosorbent assay, and dot blot assay for the identification of Xanthomonas campestris pv. phaseoli

Energy Technology Data Exchange (ETDEWEB)

Malin, E; Belden, E L; Roth, D

1985-09-01

A radioimmunoassay (RIA), an indirect competitive enzyme-linked immunosorbent assay (ELISA), and a dot-blot modification of the ELISA were evaluated for detection and identification of Xanthomonas campestris pv. phaseoli (X. c. pv. phaseoli). RIA and the dot blot tests were specific for X. c. pv. phaseoli; however, significant cross reactions occurred in the indirect competitive ELISA when using anti-X. c. pv. phaseoli antiserum against other closely related bacteria. The sensitivity level of all procedures for X. c. pv. phaseoli was approximately l0/sup 5/ colony forming unitsmL. All procedures were unsatisfactory in reliably detecting low levels of X. c. pv. phaseoli directly from extracts of bean seed. However when used in conjunction with ilution plating the dot blot assay and the RIA would be useful in specifically identifying X. c. pv. phaseoli. The relative merits of these tests for identification of X. c. pv. phaseoli are discussed.

Titanogryllus n. gen., the largest Gryllinae cricket from the Neotropical Region with three new species from the Brazilian Atlantic Forest (Orthoptera, Grylloidea, Gryllidae).

Science.gov (United States)

Jaiswara, Ranjana; Souza-Dias, Pedro G B; De Campos, Lucas Denadai; RedÜ, Darlan R; De Mello, Francisco de A G; Desutter-Grandcolas, Laure

2018-03-29

Titanogryllus, a new genus and three new species T. salgado n. gen. n. sp., T. oxossi n. gen. n. sp., and T. oxente n. gen. n. sp. from subfamily Gryllinae (Grylloidea, Gryllidae) are described from the Brazilian Atlantic Forest. This genus is characterized by its very large size, and establishes a new record for the largest known cricket from Neotropical Region. The new taxa are characterized by their external morphology and male and female genitalia.

Nonintegrated Host Association of Myrmecophilus tetramorii, a Specialist Myrmecophilous Ant Cricket (Orthoptera: Myrmecophilidae

Directory of Open Access Journals (Sweden)

Takashi Komatsu

2013-01-01

Full Text Available Myrmecophilus ant crickets (Orthoptera: Myrmecophilidae are typical ant guests. In Japan, about 10 species are recognized on the basis of morphological and molecular phylogenetic frameworks. Some of these species have restricted host ranges and behave intimately toward their host ant species (i.e., they are host specialist. We focused on one species, M. tetramorii, which uses the myrmicine ant Tetramorium tsushimae as its main host. All but one M. tetramorii individuals were collected specifically from nests of T. tsushimae in the field. However, behavioral observation showed that all individuals used in the experiment received hostile reactions from the host ants. There were no signs of intimate behaviors such as grooming of hosts or receipt of mouth-to-mouth feeding from hosts, which are seen in some host-specialist Myrmecophilus species among obligate host-ant species. Therefore, it may be that M. tetramorii is the species that is specialized to exploit the host by means other than chemical integration.

CFD Analysis of Swing of Cricket Ball and Trajectory Prediction

Science.gov (United States)

G, Jithin; Tom, Josin; Ruishikesh, Kamat; Jose, Jyothish; Kumar, Sanjay

2013-11-01

This work aims to understand the aerodynamics associated with the flight and swing of a cricket ball and predict its flight trajectory over the course of the game: at start (smooth ball) and as the game progresses (rough ball). Asymmetric airflow over the ball due to seam orientation and surface roughness can cause flight deviation (swing). The values of Drag, Lift and Side forces which are crucial for determining the trajectory of the ball were found with the help of FLUENT using the standard K- ɛ model. Analysis was done to study how the ball velocity, spin imparted to be ball and the tilt of the seam affects the movement of the ball through air. The governing force balance equations in 3 dimensions in combination a MATLAB code which used Heun's method was used for obtaining the trajectory of the ball. The conditions for the conventional swing and reverse swing to occur were deduced from the analysis and found to be in alignment with the real life situation. Critical seam angle for maximum swing and transition speed for normal to reverse swing were found out. The obtained trajectories were compared to real life hawk eye trajectories for validation. The analysis results were in good agreement with the real life situation.

Roles of calcium/calmodulin-dependent kinase II in long-term memory formation in crickets.

Directory of Open Access Journals (Sweden)

Makoto Mizunami

Full Text Available Ca(2+/calmodulin (CaM-dependent protein kinase II (CaMKII is a key molecule in many systems of learning and memory in vertebrates, but roles of CaMKII in invertebrates have not been characterized in detail. We have suggested that serial activation of NO/cGMP signaling, cyclic nucleotide-gated channel, Ca(2+/CaM and cAMP signaling participates in long-term memory (LTM formation in olfactory conditioning in crickets, and here we show participation of CaMKII in LTM formation and propose its site of action in the biochemical cascades. Crickets subjected to 3-trial conditioning to associate an odor with reward exhibited memory that lasts for a few days, which is characterized as protein synthesis-dependent LTM. In contrast, animals subjected to 1-trial conditioning exhibited memory that lasts for only several hours (mid-term memory, MTM. Injection of a CaMKII inhibitor prior to 3-trial conditioning impaired 1-day memory retention but not 1-hour memory retention, suggesting that CaMKII participates in LTM formation but not in MTM formation. Animals injected with a cGMP analogue, calcium ionophore or cAMP analogue prior to 1-trial conditioning exhibited 1-day retention, and co-injection of a CaMKII inhibitor impaired induction of LTM by the cGMP analogue or that by the calcium ionophore but not that by the cAMP analogue, suggesting that CaMKII is downstream of cGMP production and Ca(2+ influx and upstream of cAMP production in biochemical cascades for LTM formation. Animals injected with an adenylyl cyclase (AC activator prior to 1-trial conditioning exhibited 1-day retention. Interestingly, a CaMKII inhibitor impaired LTM induction by the AC activator, although AC is expected to be a downstream target of CaMKII. The results suggest that CaMKII interacts with AC to facilitate cAMP production for LTM formation. We propose that CaMKII serves as a key molecule for interplay between Ca(2+ signaling and cAMP signaling for LTM formation, a new role of Ca

Bursting neurons and ultrasound avoidance in crickets

Directory of Open Access Journals (Sweden)

Gary eMarsat

2012-07-01

Full Text Available Decision making in invertebrates often relies on simple neural circuits composed of only a few identified neurons. The relative simplicity of these circuits makes it possible to identify the key computation and neural properties underlying decisions. In this review, we summarize recent research on the neural basis of ultrasound avoidance in crickets, a response that allows escape from echolocating bats. The key neural property shaping behavioral output is high-frequency bursting of an identified interneuron, AN2, which carries information about ultrasound stimuli from receptor neurons to the brain. AN2's spike train consists of clusters of spikes –bursts– that may be interspersed with isolated, non-burst spikes. AN2 firing is necessary and sufficient to trigger avoidance steering but only high-rate firing, such as occurs in bursts, evokes this response. AN2 bursts are therefore at the core of the computation involved in deciding whether or not to steer away from ultrasound. Bursts in AN2 are triggered by synaptic input from nearly synchronous bursts in ultrasound receptors. Thus the population response at the very first stage of sensory processing –the auditory receptor- already differentiates the features of the stimulus that will trigger a behavioral response from those that will not. Adaptation, both intrinsic to AN2 and within ultrasound receptors, scales the burst-generating features according to the stimulus statistics, thus filtering out background noise and ensuring that bursts occur selectively in response to salient peaks in ultrasound intensity. Furthermore AN2’s sensitivity to ultrasound varies adaptively with predation pressure, through both developmental and evolutionary mechanisms. We discuss how this key relationship between bursting and the triggering of avoidance behavior is also observed in other invertebrate systems such as the avoidance of looming visual stimuli in locusts or heat avoidance in beetles.

Analysis of Hydroxy Fatty Acids from the Pollen of Brassica campestris L. var. oleifera DC. by UPLC-MS/MS

Directory of Open Access Journals (Sweden)

Nian-Yun Yang

2013-01-01

Full Text Available Ultraperformance liquid chromatography coupled with negative electrospray tandem mass spectrometry (UPLC-ESI-MS/MS was used to determine 7 hydroxy fatty acids in the pollen of Brassica campestris L. var. oleifera DC. All the investigated hydroxy fatty acids showed strong deprotonated molecular ions [M–H]−, which underwent two major fragment pathways of the allyl scission and the β-fission of the alcoholic hydroxyl group. By comparison of their molecular ions and abundant fragment ions with those of reference compounds, they were tentatively assigned as 15,16-dihydroxy-9Z,12Z-octadecadienoic acid (1, 10,11,12-trihydroxy-(7Z,14Z-heptadecadienoic acid (2, 7,15,16-trihydroxy-9Z,12Z-octadecadienoic acid (3, 15,16-dihydroxy-9Z,12Z-octadecadienoic acid (4, 15-hydroxy-6Z,9Z,12Z-octadecatrienoic acid (5, 15-hydroxy-9Z,12Z- octadecadienoic acid (6, and 15-hydroxy-12Z-octadecaenoic acid (7, respectively. Compounds 3, 5, and 7 are reported for the first time.

Fiddler on the Tree - A Bush-Cricket Species with Unusual Stridulatory Organs and Song

Science.gov (United States)

Heller, Klaus-Gerhard; Hemp, Claudia

2014-01-01

Insects of the order Orthoptera are well-known for their acoustic communication. The structures used for this purpose show a high diversity which obviously relates to differences in song parameters and to the physics of sound production. Here we describe song and morphology of the sound producing organs of a tropical bush-cricket, Ectomoptera nepicauda, from East Africa. It has a very unusual calling song consisting of frequency-modulated, pure-tone sounds in the high ultrasonic range of 80 to120 kHz and produced by extremely fast wing movements. Concerning morphology, it represents the most extreme state in the degree of left-right fore-wing differentiation found among Orthoptera: the acoustic parts of the left fore-wing consist exclusively of the stridulatory file, comparable in function to the bow of a violin, while the right wing carries only the plectrum ( =  string) and mirror ( =  soundbox). PMID:24643071

Production of intergeneric allotetraploid between autotetraploid non-heading Chinese cabbage (Brassica campestris ssp. chinensis Makino and autotetraploid radish (Raphanus sativus L.

Directory of Open Access Journals (Sweden)

Sun Cheng-Zhen

2014-03-01

Full Text Available Intergeneric hybrids between non-heading Chinese cabbage (Brassica campestris ssp. chinensis Makino; 2n = 4x = 40 and radish (Raphanus sativus L.; 2n = 4x = 36 were obtained through ovary culture and embryo rescue. Some hybrid embryos (0.11 per ovary were produced, but only 4 of them germinated. As most hybrid embryos failed to develop into plantlets directly, plants were regenerated by inducing shoots on the cultured cotyledon and inducing roots on the root induction medium. All hybrid plants were morphologically uniform. They resembled the non-heading Chinese cabbage in the long-lived habit, the plant status, the vernalization requirement and the petiole color, while the petiole shape, leaf venation pattern and flowers were more similar to those of radish. Upon examination of the flowers, these were found to have normal pistil, but rudimentary anthers with non-functional pollen grains. The somatic chromosome number of F1 plants was 38. Analysis of SSR banding patterns provided additional confirmation of hybridity.

Generation of dipeptidyl peptidase IV (DPP-IV) inhibitory peptides during the enzymatic hydrolysis of tropical banded cricket (Gryllodes sigillatus) proteins.

Science.gov (United States)

Nongonierma, Alice B; Lamoureux, Candice; FitzGerald, Richard J

2018-01-24

Tropical banded crickets (Gryllodes sigillatus) were studied for their ability to yield hydrolysates with dipeptidyl peptidase IV (DPP-IV) inhibitory properties. A cricket protein isolate (CPI) was prepared following extraction of the water soluble proteins from G. sigillatus powder (CP). The extraction yield and purity were 20.90 ± 0.35% and 57.0 ± 2.23%, respectively. Endogenous proteinase activities were detected in the CP, which were linked to the significant protein breakdown seen in this sample. Fifteen CPI hydrolysates (H1-H15) were generated with Protamex™ using a design of experiments (DOE) approach combining three parameters, temperature (40, 50 and 60 °C), enzyme to substrate ratio (E : S, 0.50, 1.25 and 2.00% (w/w)) and hydrolysis time (60, 150 and 240 min). The DPP-IV half maximal inhibitory concentrations (IC 50 ) of the CPI hydrolysates ranged from 0.40 ± 0.03/0.40 ± 0.02 (H2/H3) to 1.01 ± 0.07 mg mL -1 (H7). Following simulated gastrointestinal digestion (SGID), the DPP-IV IC 50 of CPI decreased (>3.57 vs. 0.78 ± 0.04 mg mL -1 ) while that of H5 increased (0.47 ± 0.03 vs. 0.71 ± 0.06 mg mL -1 ). This study has demonstrated for the first time that G. sigillatus protein hydrolysates are able to inhibit DPP-IV. The study of these hydrolysates in vivo is needed to evaluate their potential role in glycaemic management.

Are inertial forces ever of significance in cricket, golf and other sports?

Science.gov (United States)

Robinson, Garry; Robinson, Ian

2017-04-01

In previous papers we investigated the motion of a spherical projectile rotating about an arbitrary axis, subject to a drag force, a lift or Magnus force, and in the presence of a wind. The aim was to determine the motion of balls used in sporting games, primarily cricket. Newton’s laws of motion apply in an inertial (unaccelerated) coordinate system, but the rotating Earth is not an inertial system. In such a non-inertial system two additional forces are present, the Coriolis force which produces a side-ways movement, and the centrifugal force. Generally these two inertial forces produce noticeable effects only on the large scale, when either the time of travel and/or the path length is large. In this paper we have added both of these forces to the equations of motion. In addition, we have also included a ground friction force in order to simulate a ball rolling over a surface or, more generally, a body moving through a resistive medium such as water. Here we quantitatively investigate the magnitude and direction of the effect of the inertial forces in a number of cases. It is found that, as expected, the effects of the inertial forces are generally small for ball games. In cricket the side-ways movement is ≲1 cm for a throw from the boundary and ≲1 mm for a slow bowler’s delivery, and for a long drive in golf it is ≲10 cm. In lawn bowls the side-ways movement can be ∼2.8 cm, which may be significant, given the nature of this sport. The inertial forces are also potentially of relevance in sporting events not employing spherical projectiles. For example, in Olympic rowing we find that the side-ways movement can be more than 40 m for a 2 km race if it is not compensated for, and nearly 20 m for a 4 min mile event in athletics. The effect is also of significance in events such as swimming and horse racing. The importance of this is that athletes may not be aware of the effect and, in the case of rowing for example, may attribute it to side-ways currents

Effects of the Consumption of Male Spermatophylax on the Oviposition Schedule of Females in the Decorated Cricket, Gryllodes sigillatus.

Science.gov (United States)

Kasuya, E; Sato, N

1998-01-01

The effects of the consumption of the spermatophylax produced by males on female fitness were studied in the decorated cricket, Gryllodes sigillatus. An increase in the number of spermatophylaces presented to females did not increase the total number of eggs made by females, the number of eggs laid, or the hatchability of eggs laid by females, but increased the number of eggs laid in the early stage of adult life of females. The duration of the egg stage decreased with the number of spermatophylaces presented to females. The implication of the results on the sham hypothesis that the spermatophylax does not have nutritional value is discussed.

Fiddler on the tree--a bush-cricket species with unusual stridulatory organs and song.

Directory of Open Access Journals (Sweden)

Klaus-Gerhard Heller

Full Text Available Insects of the order Orthoptera are well-known for their acoustic communication. The structures used for this purpose show a high diversity which obviously relates to differences in song parameters and to the physics of sound production. Here we describe song and morphology of the sound producing organs of a tropical bush-cricket, Ectomoptera nepicauda, from East Africa. It has a very unusual calling song consisting of frequency-modulated, pure-tone sounds in the high ultrasonic range of 80 to 120 kHz and produced by extremely fast wing movements. Concerning morphology, it represents the most extreme state in the degree of left-right fore-wing differentiation found among Orthoptera: the acoustic parts of the left fore-wing consist exclusively of the stridulatory file, comparable in function to the bow of a violin, while the right wing carries only the plectrum ( =  string and mirror ( =  soundbox.

Genetic damage induced by a food coloring dye (sunset yellow) on meristematic cells of Brassica campestris L.

Science.gov (United States)

Dwivedi, Kshama; Kumar, Girjesh

2015-01-01

We have performed the present piece of work to evaluate the effect of synthetic food coloring azo dye (sunset yellow) on actively dividing root tip cells of Brassica campestris L. Three doses of azo dye were administered for the treatment of actively dividing root tip cells, namely, 1%, 3%, and 5%, for 6-hour duration along with control. Mitotic analysis clearly revealed the azo dye induced endpoint deviation like reduction in the frequency of normal divisions in a dose dependent manner. Mitotic divisions in the control sets were found to be perfectly normal while dose based reduction in MI was registered in the treated sets. Azo dye has induced several chromosomal aberrations (genotoxic effect) at various stages of cell cycle such as stickiness of chromosomes, micronuclei formation, precocious migration of chromosome, unorientation, forward movement of chromosome, laggards, and chromatin bridge. Among all, stickiness of chromosomes was present in the highest frequency followed by partial genome elimination as micronuclei. The present study suggests that extensive use of synthetic dye should be forbidden due to genotoxic and cytotoxic impacts on living cells. Thus, there is an urgent need to assess potential hazardous effects of these dyes on other test systems like human and nonhuman biota for better scrutiny.

Development of manganese toxicity in pasture legumes under extreme climatic conditions. [Trifolium subterraneum; Medicago sativa; Brassica campestris

Energy Technology Data Exchange (ETDEWEB)

Siman, A; Cradock, F W; Hudson, A W

1974-08-01

Manganese levels and pH in soil were measured on limed and unlimed plots at bi-monthly intervals for two years at five field sites with lucerne (Medicago sativa) and subterranean clover (Trifolium subterraneum) and related to rainfall and temperature. Pot experiments with lucerne, subterranean clover and rape (Brassica campestris) were used to confirm the results of the field experiments. Manganese toxicity developed in lucerne and subterranean clover under waterlogged conditions after heavy rain on the slightly acid soils (pH 4.7-5.5). Lucerne also showed manganese toxicity on the same soils in summer after extended hot, dry conditions. The maximum available manganese was 210 ..mu..g/g in the waterlogged soil (0-15 cm) the 128 ..mu..g/g in the heat affected soil. Lime treatment of 2240 kg/ha reduced the maximum available manganese to 148 ..mu..g/g in waterlogged plots and to 47 ..mu..g/g in the heat affected plots but failed to correct manganese toxicity. However, lime corrected toxicity symptoms under less severe conditions. In the pot experiments, available manganese reached 270 ..mu..g/g after 2 weeks artificial waterlogging and 68 ..mu..g/g after 2 weeks dry heat exposure. 12 references, 4 figures, 3 tables.

Radio-telemetric evidence of migration in the gregarious but not the solitary morph of the Mormon cricket (Anabrus simplex: Orthoptera: Tettigoniidae)

Science.gov (United States)

Lorch, Patrick D.; Gwynne, D. T.

The Mormon cricket, Anabrus simplex, is one of just a few species of katydids (or bushcrickets, Orthoptera: Tettigoniidae) that, like migratory locusts, appear to have solitary and migratory morphs. Using radio telemetry we studied movements of individuals of two morphs of this flightless species. Individuals within each migratory band had similar rates of movements along similar directional headings whereas solitary individuals moved little and showed little evidence of directionality in movement. Our results also add to other recent radio-telemetry studies showing that flightless insects of 1-2g in mass can be tracked successfully using these methods.

GERMINATION TEST IN SEEDS OF MELOTHRIA CAMPESTRIS (NAUDIN H. SCHAEF. & S.S. RENNER

Directory of Open Access Journals (Sweden)

ANA CARINA DA SILVA CÂNDIDO

2016-01-01

Full Text Available The Cerrado occupies 25% of the Brazilian territory and is the second largest biome in South America, second only to the Amazon Rainforest. Hence, studies on the native species of the Cerrado are important for implementing conservation strategies. In this context, knowledge of the requirements and conditions for germination of seeds of these native species is essential. The Cerrado watermelon ( Melothria campestris (Naudin H. Schaef. & S.S. Renner is a plant that is not cultivated, but has been used in revegetation projects in the countryside of the Cerrado because its fruits are fed upon by fauna in times of food shortage. The purpose of this study was to determine the most appropriate methodology for the germination of the Cerrado watermelon, by identifying the best - suited substrate, the optimal temperature, and the corresponding time taken for germination . The treatments consisted of four substrates: in a paper roll, on paper, in sand, and on sand; and four temperatures: 20, 25, and 30 °C (maintained constant, and a fourth temperature treatment that alternated 20 - 30 °C. The effect of the substrates and temperatures on seed performance was evaluated using the germination test, speed index, and average time for germination. The experimental design was fully randomized, with treatments distributed in a 4 × 4 (substrates × temperatures factorial scheme, with four replications. Our results show that the temperature of 20 °C had a negative influence on germination in all substrates. Further, we found that the germination of the Cerrado watermelon seeds was best in a paper roll or on sand substrate, maintained at a constant temperature of 30 °C, or when temperature was alternated 20 - 30 °C, and the time required for germination stabilization was 30 days.

Orthopteran insects as potential and preferred preys of the Red-footed Falcon (Falco vespertinus in Hungary

Directory of Open Access Journals (Sweden)

Szövényi Gergely

2015-06-01

Full Text Available Orthopterans play an important role in Red-footed Falcon diet, however, most studies focus only on its qualitative food composition, and less on quantitative composition and preferences of the taxa identified as prey. During the present research, an extensive orthopterological investigation was carried out in the Red-footed Falcon study area, Vásárhelyi Plain (SE-Hungary between 2006 and 2008. Grasshoppers were sampled in their main habitats by sweep netting and pitfall trapping, and orthopterans were identified in the food remnants collected from the nests, both artificial and natural ones. 26 species were detected during the field works, 18 species from the food remnants. Altogether 32 species were identified. Prey preference values for all species for each year were calculated. More than two thirds of the identified preys were Decticus verrucivorus, and nearly 20% were Tettigonia viridissima. Other common prey species were Melanogryllus desertus, Platycleis affinis, Gryllotalpa gryllotalpa, Calliptamus italicus and Gryllus campestris. Based on the prey preference analysis, the most preferred species was Decticus verrucivorus with extreme high values, and the other preferred ones, overlapping with the previous list, were Platycleis affinis, Bicolorana bicolor, Tettigonia viridissima, Calliptamus italicus and Roeseliana roeselii. These results may help in the development of Red-footed Falcon-friendly habitats through the application of habitat management favourable for the preferred prey species.

Overexpression of a eukaryotic glutathione reductase gene from Brassica campestris improved resistance to oxidative stress in Escherichia coli

International Nuclear Information System (INIS)

Yoon, Ho-Sung; Lee, In-Ae; Lee, Hyoshin; Lee, Byung-Hyun; Jo, Jinki

2005-01-01

Glutathione reductase (GR) plays an essential role in a cell's defense against reactive oxygen metabolites by sustaining the reduced status of an important antioxidant glutathione. We constructed a recombinant plasmid based on the expression vector pET-18a that overexpresses a eukaryotic GR from Brassica campestris (BcGR) in Escherichia coli. For comparative analyses, E. coli GR (EcGR) was also subcloned in the same manner. The transformed E. coli with the recombinant constructs accumulated a high level of GR transcripts upon IPTG induction. Also, Western blot analysis showed overproduction of the BcGR protein in a soluble fraction of the transformed E. coli extract. When treated with oxidative stress generating reagents such as paraquat, salicylic acid, and cadmium, the BcGR overproducing E. coli exhibited a higher level of growth and survival rate than the control E. coli strain, but it was not as high as the E. coli strain transformed with the inducible EcGR. The translated amino acid sequences of BcGR and EcGR share 37.3% identity but all the functionally known important residues are conserved. It appears that eukaryotic BcGR functions in a prokaryotic system by providing protection against oxidative damages in E. coli

Effects of ambient and elevated level of ozone on Brassica campestris L. with special reference to yield and oil quality parameters.

Science.gov (United States)

Tripathi, Ruchika; Agrawal, S B

2012-11-01

Tropospheric ozone (O(3)) has become a serious threat to growth and yield of important agricultural crops over Asian regions including India. Effect of elevated O(3) (ambient+10ppb) was studied on Brassica campestris L. (cv. Sanjukta and Vardan) in open top chambers under natural field conditions. Eight hourly mean ambient O(3) concentration varied from 26.3ppb to 69.5ppb during the growth period. Plants under O(3) exposure showed reductions in photosynthetic rate, reproductive parameters, yield as well as seed and oil quality. Cultivar Sanjukta showed more reduction in photosynthetic characteristics, reproductive structures and seed and oil quality. However, total yield was more affected in Vardan. Exposure of O(3) increased the degree of unsaturation and level of PUFA, ω-6fatty acid, linolenic acid and erucic acid in oil indicating the deterioration of its quality. The study further confirmed that there is a correspondence between O(3) induced change in photosynthetic processes, reproductive development and yield and did not find any compensatory response in the final yield. Copyright © 2012 Elsevier Inc. All rights reserved.

Genotipos de frijol (Phaseolus Vulgaris l. resistentes a Xanthomonas campestris pv. phaseoli de Mexico

Directory of Open Access Journals (Sweden)

Rosa Navarrete

2000-01-01

Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas

Genetic diversity analysis of brassica napus/brassica campestris progenies using microsatellite markers

International Nuclear Information System (INIS)

Fayyaz, L.; Farhatullah, A.; Iqbal, S.; Kanwal, M.; Nawaz, I.

2014-01-01

Genetic diversity and relationship of F2 segregating progenies of interspecific crosses between B. napus N-501/B. campestris C-118 were studied. A set of 90 genotypes (2 parental lines and their 88 F2 progenies) was characterized separately using 24 microsatellite or SSR markers to cover the diversity as broadly as possibly present in them. In initial screening only 12 out of 24 SSR primers combination amplified DNA fragments, while the remaining 12 SSR primers did not amplify DNA fragment therefore those 12 SSR molecular markers were not used for further analysis. The 12 SSR primer combinations generated a total of 33 alleles, of that 32 were polymorphic loci, whereas only one was monomorphic locus. Primers BRMS-19 and BRMS-40 were highly polymorphic producing 4 bands each. Primer Ra2-D04 was less polymorphic and it produced only one band. The proportion of polymorphic loci was 95.83% which indicates high genetic diversity among the progenies. The average number of polymorphic alleles per locus was 2.66. The PIC values ranged from 0.395 for primer Ra2-E03 to 0.726 for primer BRMS-019 with an average genetic diversity (PIC value) of 0.584 per locus. Seven primers showed PIC values above 0.5 (50%) indicating high genetic diversity in the studied plant materials. Pair-wise similarity indices among 90 genotypes ranged from 0.3 to 0.95. Dendrogram obtained through UPGMA clustering of F2 progenies depicted eight main groups using similarity coefficient of 0.70. The progenies could be similar to their parents if they have the same banding patterns as that of the parents and could be distinguished from each other by the combination of fragments which are repeatedly present in one progeny and absent in the other. Considerable genetic diversity has been found among the F2 segregating progenies and their parents using SSR markers thus, SSR analysis proved to be a useful tool. (author)

Cercal sensory system and giant interneurons in Gryllodes sigillatus.

Science.gov (United States)

Kanou, Masamichi; Nawae, Miyuki; Kuroishi, Hiroyuki

2006-04-01

The external morphologies of two cricket species, Gryllodes sigillatus and Gryllus bimaculatus, were investigated. Despite its small body length, G. sigillatus possessed longer cerci and longer cercal filiform hairs than G. bimaculatus. The estimated number of filiform hairs on a cercus was also larger in G. sigillatus than in G. bimaculatus. Wind-sensitive interneurons receiving sensory inputs from cercal filiform hairs and running in the ventral nerve cord (VNC) were investigated in G. sigillatus both morphologically and physiologically. By intracellular staining, these interneurons were proved to be morphologically homologous with previously identified giant interneurons (GIs 8-1, 9-1, 9-2, 9-3, 10-2, and 10-3) in G. bimaculatus and Acheta domesticus. In G. sigillatus, the intensity-response relationship (I-R curve) for each GI was investigated using a unidirectional air current stimulus. The stimulus was applied from 12 different directions, and an I-R curve was obtained for each stimulus direction. Each GI showed a characteristic I-R curve depending on stimulus direction. The directionality curve expressed in terms of threshold velocity showed that each GI had a distinctive directional characteristic. The functional properties of GIs in G. sigillatus, such as I-R curve, threshold velocity, and directional characteristics, were compared with those of homologous GIs in G. bimaculatus in Discussion.

Studies on the physiological changes in the rice plants infected with Xanthomonas campestris pv. of oryzae, (4)

International Nuclear Information System (INIS)

Watanabe, Minoru; Samejima, Shin-ichi; Hayashi, Nobuo; Hosokawa, Daijiro

1980-01-01

The translocation and accumulation of 14 C-photosynthetic assimilates in rice plants infected with Xanthomonas campestris pv. oryzae were investigated. Approximately the same quantities of assimilates were detected in healthy and infected leaves 1 day after photosynthesis, but 1.7 times as much as healthy leaves assimilates were still remained in infected leaves 7 days after photosynthesis. Much more 14 C-photosynthetic assimilates were generally detected in leaf blade than in leaf sheath or in root within 1 day after photosynthesis, but detected in leaf sheath than in leaf blade later than 2 days after photosynthesis. The rates of translocation of 14 C-assimilates from leaf blade to leaf sheath were lower in inoculated rice plants than in healthy ones. In both healthy and inoculated leaves of susceptible and resistant cultivars, there was a tendency that 14 C-sugar contents decreased, but 14 C-organic acid and -amino acid contents increased gradually after photosynthesis. Incorporation of 14 C-photosynthetic assimilates into invading bacterial cells which were separated from leaf tissues by the methods of leakage and Millipore filtration was not detected immediately after photosynthesis, but became apparent 5 days after photosynthesis. The leakage of 14 C-photosynthetic assimilates from leaf tissues into bathing solution was about 4 times higher in infected leaves than in healthy ones 5 days after photosynthesis, suggesting that the permeability in infected leaf tissues would increase. (author)

Varietals resistance and susceptibility in mustard (brassica campestris l.) genotypes against aphid myzus persicae (sulzer) (homoptera: aphididae)

International Nuclear Information System (INIS)

Sarwar, M.; Ahmad, N.; Khan, G.Z.; Tofique, M.

2009-01-01

The exploitation of resistant cultivars is an imperative, simple, practical and flexible way to cope with insect pests incidence. Thirty genotypes of mustard (Brassica campestris L.) were tested for their resistance and susceptibility to aphid Myzus persicae (Sulzer) exposed under natural field conditions. Data on pest tolerance of genotypes were judged by quantitative traits such as number of aphids on each infested plant and mean dry weight of seeds per genotype. Studies observed the discrepancy in overall rates of pest invasion and seed yield contained by trailed mustard genotypes. Agati sarson (P), S-9-S-97-100/45 and S-9-S-97-100/45 were the least damaged genotypes showing their moderate resistance. Amongst other genotypes, MM-I/01-5, MM-I285 and MM-I/01-6 were the most damaged showing oversensitive response. Although the majority of genotypes were found vulnerable to pest, Agati sarson (P) and S-9-S-97-100/45 due to their lowest hypersensitive response toward aphid contamination and increased pods yield could be used for the development of essential resistance in mustard plant. A marked mode of damage inflicted by aphid on the crop was noticed and the abiotic factors contributing variations in aphid infestation levels during both growing seasons were determined. Knowledge about the host plant resistance investigated can facilitate growers to choose the most appropriate cultivars as pest control strategy. (author)

Morphological and biochemical characterization of xanthomonas campestris (pammel) dawson pv. Sesame and it's management by bacterial antagonists

International Nuclear Information System (INIS)

Naqvi, S.F.; Haq, M.I.U.; Tahir, M.I.; Khan, M.A.; Ali, Z.

2013-01-01

Isolates of Xanthomonas campestris (Pammel) Dawson pv. sesami (Xcs) were collected from various locations in Pakistan and were characterized using several biochemical tests including; (KOH) string test, gram staining, H/sub 2/S production, catalase activity, oxidation/fermentation of glucose, oxidase activity and nitrate reduction. The isolates were positive in tests for KOH string assay, H/sub 2/S, catalase and showed negative reactions in gram staining, oxidase test and nitrate reduction while oxidative utilization of glucose was observed. To develop biological control for the pathogen we isolated numerous bacteria from the rhizosphere of sesame plants and screened them for antagonism against the pathogen using the zone inhibition method. Out of 87 isolates, 9 isolates were inhibitory to the pathogen in vitro. Pseudomonas fluorescens ID-3 exhibited the highest zone of inhibition i.e. 7.97mm. All antagonistic isolates were tested for disease control under greenhouse conditions. Four sesame lines that were found to be moderately resistant in previous studies (i.e. 95001, 96007, 96019, and 20003) were selected for evaluating biocontrol efficacy. The isolates were found to control the disease and reduced severity to 3% compared to untreated plants. The isolate P. fluorescens ID-3 was considered to provide the best disease control with each cultivar. Average biocontrol efficiency (BE) of ID-3 was 78.25% while the best BE was obtained in line 96019, i.e. 81%. (author)

Ejaculate economics: testing the effects of male sexual history on the trade-off between sperm and immune function in Australian crickets.

Directory of Open Access Journals (Sweden)

Damian K Dowling

Full Text Available Trade-offs between investment into male sexual traits and immune function provide the foundation for some of the most prominent models of sexual selection. Post-copulatory sexual selection on the male ejaculate is intense, and therefore trade-offs should occur between investment into the ejaculate and the immune system. Examples of such trade-offs exist, including that between sperm quality and immunity in the Australian cricket, Teleogryllus oceanicus. Here, we explore the dynamics of this trade-off, examining the effects that increased levels of sexual interaction have on the viability of a male's sperm across time, and the concomitant effects on immune function. Males were assigned to a treatment, whereby they cohabited with females that were sexually immature, sexually mature but incapable of copulation, or sexually mature and capable of copulation. Sperm viability of each male was then assessed at two time points: six and 13 days into the treatment, and immune function at day 13. Sperm viability decreased across the time points, but only for males exposed to treatment classes involving sexually mature females. This decrease was similar in magnitude across both sexually mature classes, indicating that costs to the expression of high sperm viability are incurred largely through levels of pre-copulatory investment. Males exposed to immature females produced sperm of low viability at both time points. Although we confirmed a weak negative association between sperm viability and lytic activity (a measure of immune response to bacterial infection at day 13, this relationship was not altered across the mating treatment. Our results highlight that sperm viability is a labile trait, costly to produce, and subject to strategic allocation in these crickets.

Aconitase B is required for optimal growth of Xanthomonas campestris pv. vesicatoria in pepper plants.

Directory of Open Access Journals (Sweden)

Janine Kirchberg

Full Text Available The aerobic plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv colonizes the intercellular spaces of pepper and tomato. One enzyme that might contribute to the successful proliferation of Xcv in the host is the iron-sulfur protein aconitase, which catalyzes the conversion of citrate to isocitrate in the tricarboxylic acid (TCA cycle and might also sense reactive oxygen species (ROS and changes in cellular iron levels. Xcv contains three putative aconitases, two of which, acnA and acnB, are encoded by a single chromosomal locus. The focus of this study is aconitase B (AcnB. acnB is co-transcribed with two genes, XCV1925 and XCV1926, encoding putative nucleic acid-binding proteins. In vitro growth of acnB mutants was like wild type, whereas in planta growth and symptom formation in pepper plants were impaired. While acnA, XCV1925 or XCV1926 mutants showed a wild-type phenotype with respect to bacterial growth and in planta symptom formation, proliferation of the acnB mutant in susceptible pepper plants was significantly impaired. Furthermore, the deletion of acnB led to reduced HR induction in resistant pepper plants and an increased susceptibility to the superoxide-generating compound menadione. As AcnB complemented the growth deficiency of an Escherichia coli aconitase mutant, it is likely to be an active aconitase. We therefore propose that optimal growth and survival of Xcv in pepper plants depends on AcnB, which might be required for the utilization of citrate as carbon source and could also help protect the bacterium against oxidative stress.

Selenium alleviates chromium toxicity by preventing oxidative stress in cabbage (Brassica campestris L. ssp. Pekinensis) leaves.

Science.gov (United States)

Qing, Xuejiao; Zhao, Xiaohu; Hu, Chengxiao; Wang, Peng; Zhang, Ying; Zhang, Xuan; Wang, Pengcheng; Shi, Hanzhi; Jia, Fen; Qu, Chanjuan

2015-04-01

The beneficial role of selenium (Se) in alleviation of chromium (Cr)-induced oxidative stress is well established. However, little is known about the underlying mechanism. The impacts of exogenous Se (0.1mg/L) on Cr(1mg/L)-induced oxidative stress and antioxidant systems in leaves of cabbage (Brassica campestris L. ssp. Pekinensis) were investigated by using cellular and biochemical approaches. The results showed that supplementation of the medium with Se was effective in reducing Cr-induced increased levels of lipid peroxides and superoxide free radicals (O(-)2(·)), as well as increasing activities of superoxide dismutase (SOD) and peroxidase (POD). Meanwhile, 1mg/L Cr induced loss of plasma membrane integrity, growth inhibition, as well as ultrastructural changes of leaves were significantly reversed due to Se supplementation in the medium. In addition, Se application significantly altered the subcellular distribution of Cr which transported from mitochondria, nucleus and the cell-wall material to the soluble fraction and chloroplasts. However, Se application did no significant alteration of Cr effects on osmotic adjustment accumulating products. The study suggested that Se is able to protect leaves of cabbage against Cr toxicity by alleviation of Cr induced oxidative stress, and re-distribution of Cr in the subcellular of the leaf. Furthermore, free radicals, lipid peroxides, activity of SOD and POD, and subcellular distribution of Cr can be considered the efficient biomarkers to indicate the efficiency of Se to detoxification Cr. Copyright © 2015 Elsevier Inc. All rights reserved.

Allelopatic effect of different caster bean organs (Ricinus communis L. on reducing germination and growth of dodder (Cuscuta campestris Yuncker

Directory of Open Access Journals (Sweden)

S.M Seyyedi

2016-05-01

Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without

Phylogenetic footprinting of non-coding RNA: hammerhead ribozyme sequences in a satellite DNA family of Dolichopoda cave crickets (Orthoptera, Rhaphidophoridae

Directory of Open Access Journals (Sweden)

Venanzetti Federica

2010-01-01

Full Text Available Abstract Background The great variety in sequence, length, complexity, and abundance of satellite DNA has made it difficult to ascribe any function to this genome component. Recent studies have shown that satellite DNA can be transcribed and be involved in regulation of chromatin structure and gene expression. Some satellite DNAs, such as the pDo500 sequence family in Dolichopoda cave crickets, have a catalytic hammerhead (HH ribozyme structure and activity embedded within each repeat. Results We assessed the phylogenetic footprints of the HH ribozyme within the pDo500 sequences from 38 different populations representing 12 species of Dolichopoda. The HH region was significantly more conserved than the non-hammerhead (NHH region of the pDo500 repeat. In addition, stems were more conserved than loops. In stems, several compensatory mutations were detected that maintain base pairing. The core region of the HH ribozyme was affected by very few nucleotide substitutions and the cleavage position was altered only once among 198 sequences. RNA folding of the HH sequences revealed that a potentially active HH ribozyme can be found in most of the Dolichopoda populations and species. Conclusions The phylogenetic footprints suggest that the HH region of the pDo500 sequence family is selected for function in Dolichopoda cave crickets. However, the functional role of HH ribozymes in eukaryotic organisms is unclear. The possible functions have been related to trans cleavage of an RNA target by a ribonucleoprotein and regulation of gene expression. Whether the HH ribozyme in Dolichopoda is involved in similar functions remains to be investigated. Future studies need to demonstrate how the observed nucleotide changes and evolutionary constraint have affected the catalytic efficiency of the hammerhead.

Age-dependent variation in the terminal investment threshold in male crickets.

Science.gov (United States)

Duffield, Kristin R; Hampton, Kylie J; Houslay, Thomas M; Hunt, John; Rapkin, James; Sakaluk, Scott K; Sadd, Ben M

2018-03-01

The terminal investment hypothesis proposes that decreased expectation of future reproduction (e.g., arising from a threat to survival) should precipitate increased investment in current reproduction. The level at which a cue of decreased survival is sufficient to trigger terminal investment (i.e., the terminal investment threshold) may vary according to other factors that influence expectation for future reproduction. We test whether the terminal investment threshold varies with age in male crickets, using heat-killed bacteria to simulate an immune-inducing infection. We measured calling effort (a behavior essential for mating) and hemolymph antimicrobial activity in young and old males across a gradient of increasing infection cue intensity. There was a significant interaction between the infection cue and age in their effect on calling effort, confirming the existence of a dynamic terminal investment threshold: young males reduced effort at all infection levels, whereas old males increased effort at the highest levels relative to naïve individuals. A lack of a corresponding decrease in antibacterial activity suggests that altered reproductive effort is not traded against investment in this component of immunity. Collectively, these results support the existence of a dynamic terminal investment threshold, perhaps accounting for some of the conflicting evidence in support of terminal investment. © 2018 The Author(s). Evolution © 2018 The Society for the Study of Evolution.

No intra-locus sexual conflict over reproductive fitness or ageing in field crickets.

Directory of Open Access Journals (Sweden)

Felix Zajitschek

2007-01-01

Full Text Available Differences in the ways in which males and females maximize evolutionary fitness can lead to intra-locus sexual conflict in which genes delivering fitness benefits to one sex are costly when expressed in the other. Trade-offs between current reproductive effort and future reproduction and survival are fundamental to the evolutionary biology of ageing. This leads to the prediction that sex differences in the optimization of age-dependent reproductive effort may generate intra-locus sexual conflict over ageing rates. Here we test for intra-locus sexual conflict over age-dependent reproductive effort and longevity in the black field cricket, Teleogryllus commodus. Using a half-sib breeding design, we show that the most important components of male and female reproductive effort (male calling effort and the number of eggs laid by females were positively genetically correlated, especially in early adulthood. However, the genetic relationships between longevity and reproductive effort were different for males and females, leading to low genetic covariation between male and female longevity. The apparent absence of intra-locus sexual conflict over ageing suggests that male and female longevity can evolve largely independently of one another.

Measurements of the diet in two species of Troglophilus Krauss, 1879 cave crickets from Italian subterranean habitats (Orthoptera, Rhaphidophoridae

Directory of Open Access Journals (Sweden)

Claudio Di Russo

2014-03-01

Full Text Available The diet of two populations of cave crickets, Troglophilus cavicola from Veneto, northern Italy and Troglophilus andreinii from Apulia, southern Italy, were studied by analyzing faecal and gut contents. The results obtained document different food preferences in these two species. In the Troglophilus cavicola population arthropod remains were dominant in the diet, whereas in the T. andreinii population vegetables (green and fibres were the more abundant food category. Furthermore, study of the overlap of food resource exploitation among age and sex sub-samples seems to indicate a separation of diet among the young instars and other age classes of the populations. Differences in diet between males and females were observed only in the population of T. andreinii.

Relative degree of susceptibility and resistance of different brassica campestris l. genotypes against aphid myzus persicae- a field investigation

International Nuclear Information System (INIS)

Sarwar, M.

2013-01-01

Field evaluation of twenty three Brassica campestris L. genotypes was conducted for aphid (Homoptera: Aphididae) resistance during 2008 crop season. The parameters used to assess tolerance of germplasm lines included pest population during growth season and grain yield at crop maturity. Aphids showed obvious preferences for all of the germplasm investigated; however, the evaluation for resistance to pest identified several genotypes with variable potential for tolerance and sensitivity. Estimated grain yield also varied significantly due to variable pest intensity noted, and seemed to be more appropriately dependent on the pest population conditions at the experimental site. Among the germplasm, the estimation obtained regarding both the parameters sorted out MM-II/02-3 and MM-I285 genotypes as most tolerant due to less pest infestation and damage. Peak infestations by aphid caused severe crop fatalities on S-9-S-97-0.75+75/55 and S-9-1006/95 genotypes, affecting the seed weight and resulting an immense reduction in grain Brassica genotypes appeared to be governed by means of varietals characteristics of diverse germplasms. The result of resistance test conducted under field environment is an effective and consistent approach in the practical selection of crop lines resistant or partially resistant to pests for use in future breeding programs. (author)

Pace bowlers in cricket with history of lumbar stress fracture have increased risk of lower limb muscle strains, particularly calf strains.

Science.gov (United States)

Orchard, John; Farhart, Patrick; Kountouris, Alex; James, Trefor; Portus, Marc

2010-01-01

To assess whether a history of lumbar stress fracture in pace bowlers in cricket is a risk factor for lower limb muscle strains. This was a prospective cohort risk factor study, conducted using injury data from contracted first class pace bowlers in Australia during seasons 1998-1999 to 2008-2009 inclusive. There were 205 pace bowlers, 33 of whom suffered a lumbar stress fracture when playing first class cricket. Risk ratios ([RR] with 95% confidence intervals[CI]) were calculated to compare the seasonal incidence of various injuries between bowlers with a prior history of lumbar stress fracture and those with no history of lumbar stress fracture. Risk of calf strain was strongly associated with prior lumbar stress fracture injury history (RR = 4.1; 95% CI: 2.4-7.1). Risks of both hamstring strain (RR = 1.5; 95% CI: 1.03-2.1) and quadriceps strain (RR = 2.0; 95% CI: 1.1-3.5) were somewhat associated with history of lumbar stress fracture. Risk of groin strain was not associated with history of lumbar stress fracture (RR = 0.7; 95% CI: 0.4-1.1). Other injuries showed little association with prior lumbar stress fracture, although knee cartilage injuries were more likely in the non-stress fracture group. Bony hypertrophy associated with lumbar stress fracture healing may lead to subsequent lumbar nerve root impingement, making lower limb muscle strains more likely to occur. Confounders may be responsible for some of the findings. In particular, bowling speed is likely to be independently correlated with risk of lumbar stress fracture and risk of muscle strain. However, as the relationship between lumbar stress fracture history and calf strain was very strong, and that there is a strong theoretical basis for the connection, it is likely that this is a true association.

Xanthomonas campestris RpfB is a Fatty Acyl-CoA Ligase Required to Counteract the Thioesterase Activity of the RpfF Diffusible Signal Factor (DSF) Synthase

Science.gov (United States)

Bi, Hongkai; Yu, Yonghong; Dong, Huijuan; Wang, Haihong; Cronan, John E.

2014-01-01

SUMMARY In Xanthomonas campestris pv. campestris (Xcc), the proteins encoded by the rpf (regulator of pathogenicity factor) gene cluster produce and sense a fatty acid signal molecule called diffusible signaling factor (DSF, 2(Z)-11-methyldodecenoic acid). RpfB was reported to be involved in DSF processing and was predicted to encode an acyl-CoA ligase. We report that RpfB activates a wide range of fatty acids to their CoA esters in vitro. Moreover, RpfB can functionally replace the paradigm bacterial acyl-CoA ligase, Escherichia coli FadD, in the E. coli β-oxidation pathway and deletion of RpfB from the Xcc genome results in a strain unable to utilize fatty acids as carbon sources. An essential RpfB function in the pathogenicity factor pathway was demonstrated by the properties of a strain deleted for both the rpfB and rpfC genes. The ΔrpfB ΔrpfC strain grew poorly and lysed upon entering stationary phase. Deletion of rpfF, the gene encoding the DSF synthetic enzyme, restored normal growth to this strain. RpfF is a dual function enzyme that synthesizes DSF by dehydration of a 3-hydroxyacyl-acyl carrier protein (ACP) fatty acid synthetic intermediate and also cleaves the thioester bond linking DSF to ACP. However, the RpfF thioesterase activity is of broad specificity and upon elimination of its RpfC inhibitor RpfF attains maximal activity and its thioesterase activity proceeds to block membrane lipid synthesis by cleavage of acyl-ACP intermediates. This resulted in release of the nascent acyl chains to the medium as free fatty acids. This lack of acyl chains for phospholipid synthesis results in cell lysis unless RpfB is present to counteract the RpfF thioesterase activity by catalyzing uptake and activation of the free fatty acids to give acyl-CoAs that can be utilized to restore membrane lipid synthesis. Heterologous expression of a different fatty acid activating enzyme, the Vibrio harveyi acyl-ACP synthetase, replaced RpfB in counteracting the effects of

Free amino acids as phagostimulants in cricket nuptial gifts: support for the 'Candymaker' hypothesis.

Science.gov (United States)

Warwick, Stuart; Vahed, Karim; Raubenheimer, David; Simpson, Stephen J

2009-04-23

Nuptial gifts that are manufactured by the male are found in numerous insect species and some spiders, but there have been very few studies of the composition of such gifts. If, as has been proposed recently, nuptial gifts represent sensory traps, males will be selected to produce gifts that are attractive to females but such gifts will not necessarily provide the female with nutritional benefits (the 'Candymaker' hypothesis). We examined the free amino acid content of the spermatophylax of the cricket Gryllodes sigillatus (Orthoptera: Gryllidae) using high performance liquid chromatography (HPLC). The spermatophylax (dry weight) consisted of approximately 7 per cent free amino acids. The free amino acid composition was highly imbalanced, with a low proportion of essential amino acids (18.7%) and a high proportion of proline and glycine. The main free amino acids found in the spermatophylax appeared to act as phagostimulants: the duration of feeding on artificial gels by females was positively related to the free amino acid content of the gels. The results therefore suggest that males use free amino acids to 'sweeten' a relatively low-value food item. A possible function of glycine in inhibiting female movement is also proposed.

Mouthparts and nectar feeding of the flower visiting cricket Glomeremus orchidophilus (Gryllacrididae).

Science.gov (United States)

Krenn, Harald W; Fournel, Jacques; Bauder, Julia A-S; Hugel, Sylvain

2016-05-01

Glomeremus orchidophilus (Gryllacrididae) is a flower visiting cricket on the tropical island La Réunion. This species is the only Orthoptera shown to be a pollinator of a plant. We studied its nectar feeding behavior and mouthpart morphology in detail. Since G. orchidophilus possesses biting-and-chewing mouthparts, our objective was to find behavioral and/or structural specializations for nectar-feeding. The comparative analysis of feeding behavior revealed that fluid is taken up without movements of the mouthparts in Glomeremus. A comparative morphological examination of two Glomeremus species, together with several representatives of other Gryllacrididae and other Ensifera taxa revealed subtle adaptations to fluid feeding in Glomeremus. All representatives of Gryllacrididae were found to possess a distinct patch of microtrichia at the tip of their galeae. However, in Glomeremus a channel is formed between the distal components of the maxillae and the mandibles on each side of the body. Micro-CT and SEM examination revealed a longitudinal groove that extends over the galea beginning at the patch of microtrichia in the studied Glomeremus species. We hypothesize that the microtrichia take up fluid by capillarity and the action of the cibarium and pharyngeal pumps transports fluid along the channels between the maxillae and mandibles into the preoral cavity. These mouthpart features allow nectar uptake from flowers that is unique in Orthoptera. Copyright © 2016 Elsevier Ltd. All rights reserved.

The effects of stress hormones on immune function may be vital for the adaptive reconfiguration of the immune system during fight-or-flight behavior.

Science.gov (United States)

Adamo, Shelley A

2014-09-01

Intense, short-term stress (i.e., robust activation of the fight-or-flight response) typically produces a transient decline in resistance to disease in animals across phyla. Chemical mediators of the stress response (e.g., stress hormones) help induce this decline, suggesting that this transient immunosuppression is an evolved response. However, determining the function of stress hormones on immune function is difficult because of their complexity. Nevertheless, evidence suggests that stress hormones help maintain maximal resistance to disease during the physiological changes needed to optimize the body for intense physical activity. Work on insects demonstrates that stress hormones both shunt resources away from the immune system during fight-or-flight responses as well as reconfigure the immune system. Reconfiguring the immune system minimizes the impact of the loss of these resources and reduces the increased costs of some immune functions due to the physiological changes demanded by the fight-or-flight response. For example, during the stress response of the cricket Gryllus texensis, some molecular resources are shunted away from the immune system and toward lipid transport, resulting in a reduction in resistance to disease. However, insects' immune cells (hemocytes) have receptors for octopamine (the insect stress neurohormone). Octopamine increases many hemocyte functions, such as phagocytosis, and these changes would tend to mitigate the decline in immunity due to the loss of molecular resources. Moreover, because the stress response generates oxidative stress, some immune responses are probably more costly when activated during a stress response (e.g., those that produce reactive molecules). Some of these immune responses are depressed during stress in crickets, while others, whose costs are probably not increased during a stress response, are enhanced. Some effects of stress hormones on immune systems may be better understood as examples of reconfiguration

Examining the effectiveness of discriminant function analysis and cluster analysis in species identification of male field crickets based on their calling songs.

Directory of Open Access Journals (Sweden)

Ranjana Jaiswara

Full Text Available Traditional taxonomy based on morphology has often failed in accurate species identification owing to the occurrence of cryptic species, which are reproductively isolated but morphologically identical. Molecular data have thus been used to complement morphology in species identification. The sexual advertisement calls in several groups of acoustically communicating animals are species-specific and can thus complement molecular data as non-invasive tools for identification. Several statistical tools and automated identifier algorithms have been used to investigate the efficiency of acoustic signals in species identification. Despite a plethora of such methods, there is a general lack of knowledge regarding the appropriate usage of these methods in specific taxa. In this study, we investigated the performance of two commonly used statistical methods, discriminant function analysis (DFA and cluster analysis, in identification and classification based on acoustic signals of field cricket species belonging to the subfamily Gryllinae. Using a comparative approach we evaluated the optimal number of species and calling song characteristics for both the methods that lead to most accurate classification and identification. The accuracy of classification using DFA was high and was not affected by the number of taxa used. However, a constraint in using discriminant function analysis is the need for a priori classification of songs. Accuracy of classification using cluster analysis, which does not require a priori knowledge, was maximum for 6-7 taxa and decreased significantly when more than ten taxa were analysed together. We also investigated the efficacy of two novel derived acoustic features in improving the accuracy of identification. Our results show that DFA is a reliable statistical tool for species identification using acoustic signals. Our results also show that cluster analysis of acoustic signals in crickets works effectively for species

Are herbicide-resistant crops the answer to controlling Cuscuta?

Science.gov (United States)

Nadler-Hassar, Talia; Shaner, Dale L; Nissen, Scott; Westra, Phill; Rubin, Baruch

2009-07-01

Herbicide-resistant crop technology could provide new management strategies for the control of parasitic plants. Three herbicide-resistant oilseed rape (Brassica napus L.) genotypes were used to examine the response of attached Cuscuta campestris Yuncker to glyphosate, imazamox and glufosinate. Cuscata campestris was allowed to establish on all oilseed rape genotypes before herbicides were applied. Unattached seedlings of C. campestris, C. subinclusa Durand & Hilg. and C. gronovii Willd. were resistant to imazamox and glyphosate and sensitive to glufosinate, indicating that resistance initially discovered in C. campestris is universal to all Cuscuta species. Glufosinate applied to C. campestris attached to glufosinate-resistant oilseed rape had little impact on the parasite, while imazamox completely inhibited C. campestris growth on the imidazolinone-resistant host. The growth of C. campestris on glyphosate-resistant host was initially inhibited by glyphosate, but the parasite recovered and resumed growth within 3-4 weeks. The ability of C. campestris to recover was related to the quality of interaction between the host and parasite and to the resistance mechanism of the host. The parasite was less likely to recover when it had low compatibility with the host, indicating that parasite-resistant crops coupled with herbicide resistance could be highly effective in controlling Cuscuta. (c) 2009 by John Wiley & Sons, Ltd.

The development of a novel cricket bowling system: recreating spin and swing bowling deliveries at the elite level

Science.gov (United States)

West, A. A.; Justham, L.

2008-03-01

During the game of cricket, bowlers create different deliveries by altering the manner in which they release the ball from their hand. The orientation of the seam, the speed at which the ball is released and the magnitude and direction of the spin combine to determine the motion of the ball through the air and its movement after impact with the wicket. These factors have to be considered if automatic training machines are to be capable of replicating elite bowling deliveries. The need for automotive systems for batting and fielding training at the elite level has arisen due to: (i) the capabilities of human bowlers are limited by the onset of fatigue and the risk of injury and (ii) a large number of accurate and repeatable deliveries to be ''programmable'' by coaches to ensure batsmen and fielders are tested to the limits of their abilities and a training benefit is achieved.

Development rate rather than social environment influences cognitive performance in Australian black field crickets, Teleogryllus commodus.

Science.gov (United States)

Anderson, Caitlin L; Kasumovic, Michael M

2017-01-01

Cognitive functioning is vital for enabling animals of all taxa to optimise their chances of survival and reproductive success. Learning and memory in particular are drivers of many evolutionary processes. In this study, we examine how developmental plasticity can affect cognitive ability by exploring the role the early social environment has on problem solving ability and learning of female black field crickets, Teleogryllus commodus. We used two learning paradigms, an analog of the Morris water maze and a novel linear maze, to examine cognitive differences between individuals reared in two acoustic treatments: silence or calling. Although there was no evidence of learning or memory, individuals that took longer to mature solved the Morris water maze more quickly. Our results suggest that increased investment into cognitive development is likely associated with increased development time during immature stages. Inconsistent individual performance and motivation during the novel linear maze task highlights the difficulties of designing ecologically relevant learning tasks within a lab setting. The role of experimental design in understanding cognitive ability and learning in more natural circumstances is discussed.

Development rate rather than social environment influences cognitive performance in Australian black field crickets, Teleogryllus commodus

Directory of Open Access Journals (Sweden)

Caitlin L. Anderson

2017-07-01

Full Text Available Cognitive functioning is vital for enabling animals of all taxa to optimise their chances of survival and reproductive success. Learning and memory in particular are drivers of many evolutionary processes. In this study, we examine how developmental plasticity can affect cognitive ability by exploring the role the early social environment has on problem solving ability and learning of female black field crickets, Teleogryllus commodus. We used two learning paradigms, an analog of the Morris water maze and a novel linear maze, to examine cognitive differences between individuals reared in two acoustic treatments: silence or calling. Although there was no evidence of learning or memory, individuals that took longer to mature solved the Morris water maze more quickly. Our results suggest that increased investment into cognitive development is likely associated with increased development time during immature stages. Inconsistent individual performance and motivation during the novel linear maze task highlights the difficulties of designing ecologically relevant learning tasks within a lab setting. The role of experimental design in understanding cognitive ability and learning in more natural circumstances is discussed.

The evolution of trade-offs under directional and correlational selection.

Science.gov (United States)

Roff, Derek A; Fairbairn, Daphne J

2012-08-01

Using quantitative genetic theory, we develop predictions for the evolution of trade-offs in response to directional and correlational selection. We predict that directional selection favoring an increase in one trait in a trade-off will result in change in the intercept but not the slope of the trade-off function, with the mean value of the selected trait increasing and that of the correlated trait decreasing. Natural selection will generally favor an increase in some combination of trait values, which can be represented as directional selection on an index value. Such selection induces both directional and correlational selection on the component traits. Theory predicts that selection on an index value will also change the intercept but not the slope of the trade-off function but because of correlational selection, the direction of change in component traits may be in the same or opposite directions. We test these predictions using artificial selection on the well-established trade-off between fecundity and flight capability in the cricket, Gryllus firmus and compare the empirical results with a priori predictions made using genetic parameters from a separate half-sibling experiment. Our results support the predictions and illustrate the complexity of trade-off evolution when component traits are subject to both directional and correlational selection. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

Free amino acids as phagostimulants in cricket nuptial gifts: support for the ‘Candymaker’ hypothesis

Science.gov (United States)

Warwick, Stuart; Vahed, Karim; Raubenheimer, David; Simpson, Stephen J.

2009-01-01

Nuptial gifts that are manufactured by the male are found in numerous insect species and some spiders, but there have been very few studies of the composition of such gifts. If, as has been proposed recently, nuptial gifts represent sensory traps, males will be selected to produce gifts that are attractive to females but such gifts will not necessarily provide the female with nutritional benefits (the ‘Candymaker’ hypothesis). We examined the free amino acid content of the spermatophylax of the cricket Gryllodes sigillatus (Orthoptera: Gryllidae) using high performance liquid chromatography (HPLC). The spermatophylax (dry weight) consisted of approximately 7 per cent free amino acids. The free amino acid composition was highly imbalanced, with a low proportion of essential amino acids (18.7%) and a high proportion of proline and glycine. The main free amino acids found in the spermatophylax appeared to act as phagostimulants: the duration of feeding on artificial gels by females was positively related to the free amino acid content of the gels. The results therefore suggest that males use free amino acids to ‘sweeten’ a relatively low-value food item. A possible function of glycine in inhibiting female movement is also proposed. PMID:19158029

Complex Genotype by Environment interactions and changing genetic architectures across thermal environments in the Australian field cricket, Teleogryllus oceanicus

Directory of Open Access Journals (Sweden)

Dowling Damian K

2011-07-01

Full Text Available Abstract Background Biologists studying adaptation under sexual selection have spent considerable effort assessing the relative importance of two groups of models, which hinge on the idea that females gain indirect benefits via mate discrimination. These are the good genes and genetic compatibility models. Quantitative genetic studies have advanced our understanding of these models by enabling assessment of whether the genetic architectures underlying focal phenotypes are congruent with either model. In this context, good genes models require underlying additive genetic variance, while compatibility models require non-additive variance. Currently, we know very little about how the expression of genotypes comprised of distinct parental haplotypes, or how levels and types of genetic variance underlying key phenotypes, change across environments. Such knowledge is important, however, because genotype-environment interactions can have major implications on the potential for evolutionary responses to selection. Results We used a full diallel breeding design to screen for complex genotype-environment interactions, and genetic architectures underlying key morphological traits, across two thermal environments (the lab standard 27°C, and the cooler 23°C in the Australian field cricket, Teleogryllus oceanicus. In males, complex three-way interactions between sire and dam parental haplotypes and the rearing environment accounted for up to 23 per cent of the scaled phenotypic variance in the traits we measured (body mass, pronotum width and testes mass, and each trait harboured significant additive genetic variance in the standard temperature (27°C only. In females, these three-way interactions were less important, with interactions between the paternal haplotype and rearing environment accounting for about ten per cent of the phenotypic variance (in body mass, pronotum width and ovary mass. Of the female traits measured, only ovary mass for crickets

Maternal effects, but no good or compatible genes for sperm competitiveness in Australian crickets.

Science.gov (United States)

Dowling, Damian K; Nystrand, Magdalena; Simmons, Leigh W

2010-05-01

Explanations for the evolution of polyandry often center on the idea that females garner genetic benefits for their offspring by mating multiply. Furthermore, postcopulatory processes are thought to be fundamental to enabling polyandrous females to screen for genetic quality. Much attention has focused on the potential for polyandrous females to accrue such benefits via a sexy- or good-sperm mechanism, whereby additive variation exists among males in sperm competitiveness. Likewise, attention has focused on an alternative model, in which offspring quality (in this context, the sperm competitiveness of sons) hinges on an interaction between parental haplotypes (genetic compatibility). Sperm competitiveness that is contingent on parental compatibility will exhibit nonadditive genetic variation. We tested these models in the Australian cricket, Teleogryllus oceanicus, using a design that allowed us to partition additive, nonadditive genetic, and parental variance for sperm competitiveness. We found an absence of additive and nonadditive genetic variance in this species, challenging the direct relevance of either model to the evolution of sperm competitiveness in particular, and polyandry in general. Instead, we found maternal effects that were possibly sex-linked or cytoplasmically linked. We also found effects of focal male age on sperm competitiveness, with small increments in age conferring more competitive sperm.

Give 'til it hurts: trade-offs between immunity and male reproductive effort in the decorated cricket, Gryllodes sigillatus.

Science.gov (United States)

Gershman, S N; Barnett, C A; Pettinger, A M; Weddle, C B; Hunt, J; Sakaluk, S K

2010-04-01

Trade-offs between life-history variables can be manifested at either the phenotypic or genetic level, with vastly different evolutionary consequences. Here, we examined whether male decorated crickets (Gryllodes sigillatus) from eight inbred lines and the outbred founder population from which they were derived, trade-off immune effort [lytic activity, phenoloxidase (PO) activity or encapsulation] to produce spermatophylaxes: costly nuptial food gifts essential for successful sperm transfer. Canonical correlation analysis of the outbred population revealed a trade-off between spermatophylax mass and lytic activity. Analysis of our inbred lines, however, revealed that although PO activity, encapsulation, body mass, spermatophylax mass and ampulla (sperm capsule) mass were all highly heritable, lytic activity was not, and there was, therefore, no negative genetic correlation between lytic activity and spermatophylax mass. Thus, males showed a phenotypic but not a genetic trade-off between spermatophylax mass and lytic activity, suggesting that this trade-off is mediated largely by environmental factors.

Technological application of an extracellular cell lytic enzyme in xanthan gum clarification Aplicação tecnológica de uma enzima celulolítica para clarificação de goma xantana

Directory of Open Access Journals (Sweden)

Suresh Shastry

2005-03-01

Full Text Available An extracellular cell lytic enzyme from Pseudomonas sp. was active on heat killed cells of Xanthomonas campestris. The lytic activity caused enzymatic digestion of X.campestris xanthan gum. Digestion was effective for highly viscous native xanthan 2.0% (w/v and 2.5% (w/v commercial Sigma xanthan. Scanning electron microscopy and SDS-PAGE observations confirmed the cell lytic action on X.campestris cells.Uma enzima extracelular celulolítica produzida por Pseudomonas sp. foi ativa sobre células de Xanthomonas campestris mortas pelo calor. A atividade lítica causou a digestão enzimática de goma xantana de X. campestris. A digestão foi eficiente tanto para xantana nativa altamante viscosa (2,0% w/v como para xantana comercial Sigma (2,5% w/v. Observações por microscopia eletrônica de varredura demonstraram a ação celulolítica sobre células de X. campestris.

A new, morphologically cryptic bush-cricket discovered on the basis of its song in the Carpathian Mountains (Insecta, Orthoptera, Tettigoniidae

Directory of Open Access Journals (Sweden)

Ionuţ Ştefan Iorgu

2017-06-01

Full Text Available A new, morphologically cryptic species of phaneropterine bush-crickets is described from the grasslands of the Romanian Eastern Carpathians. Despite the morphological and acoustic similarities with the recently described Isophya nagyi Szövényi, Puskás & Orci, I. bucovinensis sp. n. is characterized by a peculiar male calling song, with faster syllable repetition rate (160–220 syllables per minute, at 22–27°C and less complex syllable structure (composed of only two elements instead of three observable in I. nagyi. The morphological description of the new species is supplemented with an oscillographic and spectrographic analysis of the male calling song and male–female pair-forming acoustic duet. An acoustic signal-based identification key is provided for all the presently known species of the Isophya camptoxypha species group, including the new species.

Evaluation of physiological, growth and yield responses of a tropical oil crop (Brassica campestris L. var. Kranti) under ambient ozone pollution at varying NPK levels

International Nuclear Information System (INIS)

Singh, Poonam; Agrawal, Madhoolika; Agrawal, Shashi Bhushan

2009-01-01

A field study was conducted to evaluate the impact of ambient ozone on mustard (Brassica campestris L. var. Kranti) plants grown under recommended and 1.5 times recommended NPK doses at a rural site of India using filtered (FCs) and non-filtered open top chambers (NFCs). Ambient mean O 3 concentration varied from 41.65 to 54.2 ppb during the experiment. Plants growing in FCs showed higher photosynthetic rate at both NPK levels, but higher stomatal conductance only at recommended NPK. There were improvements in growth parameters and biomass of plants in FCs as compared to NFCs at both NPK levels with higher increments at 1.5 times recommended. Seed yield and harvest index decreased significantly only at recommended NPK in NFCs. Seed quality in terms of nutrients, protein and oil contents reduced in NFCs at recommended NPK. The application of 1.5 times recommended NPK provided protection against yield loss due to ambient O 3 . - NPK level above recommended alleviates the adverse effects of ambient ozone on a tropical mustard cultivar

Evaluation of physiological, growth and yield responses of a tropical oil crop (Brassica campestris L. var. Kranti) under ambient ozone pollution at varying NPK levels

Energy Technology Data Exchange (ETDEWEB)

Singh, Poonam [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India); Agrawal, Madhoolika [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India)], E-mail: madhoo58@yahoo.com; Agrawal, Shashi Bhushan [Laboratory of Air Pollution and Global Climate Change, Ecology Research Circle, Department of Botany, Banaras Hindu University, Varanasi 221005 (India)

2009-03-15

A field study was conducted to evaluate the impact of ambient ozone on mustard (Brassica campestris L. var. Kranti) plants grown under recommended and 1.5 times recommended NPK doses at a rural site of India using filtered (FCs) and non-filtered open top chambers (NFCs). Ambient mean O{sub 3} concentration varied from 41.65 to 54.2 ppb during the experiment. Plants growing in FCs showed higher photosynthetic rate at both NPK levels, but higher stomatal conductance only at recommended NPK. There were improvements in growth parameters and biomass of plants in FCs as compared to NFCs at both NPK levels with higher increments at 1.5 times recommended. Seed yield and harvest index decreased significantly only at recommended NPK in NFCs. Seed quality in terms of nutrients, protein and oil contents reduced in NFCs at recommended NPK. The application of 1.5 times recommended NPK provided protection against yield loss due to ambient O{sub 3}. - NPK level above recommended alleviates the adverse effects of ambient ozone on a tropical mustard cultivar.

Effects of plant growth promoting rhizobacteria (PGPR and cover crops on seed germination and early establishment of field dodder (Cuscuta campestris Yunk.

Directory of Open Access Journals (Sweden)

Sarić-Krsmanović Marija

2017-01-01

Full Text Available Several bacterial cultures: Bacillus licheniformis (MO1, B. pumilus (MO2, and B. amyloliquefaciens (MO3, isolated from manure; B. megatherium ZP6 (MO4 isolated from maize rhizosphere; Azotobacter chroococcum Ps1 (MO5 and Pseudomonas fluorescens (MO6, were used to test the influence of plant growth promoting rhizobacteria (PGPR on seed germination and germination rate of field dodder (Cuscuta campestris Yunk.. Also, to examine the effect of host seeds on germination and initial growth of seedlings of field dodder plants in the dark and under white light, the seeds of four host plants were used (watermelon, red clover, alfalfa and sugar beet. Germinated seeds were counted daily over a ten-day period and the length of seedlings was measured on the final day. The results show that treatments MO3, MO4 and MO6 had inhibitory effects (15%, 65% and 52%, respectively, while treatments MO1, MO2 and MO5 had stimulating effects (3%, 3% and 19%, respectively on seed germination of field dodder. The data for host seeds show that light was a significant initial factor (83-95%, control 95% for stimulating seed germination of field dodder plants, apart from host presence (73-79%, control 80%.

Is radon emission in caves causing deletions in satellite DNA sequences of cave-dwelling crickets?

Directory of Open Access Journals (Sweden)

Giuliana Allegrucci

Full Text Available The most stable isotope of radon, 222Rn, represents the major source of natural radioactivity in confined environments such as mines, caves and houses. In this study, we explored the possible radon-related effects on the genome of Dolichopoda cave crickets (Orthoptera, Rhaphidophoridae sampled in caves with different concentrations of radon. We analyzed specimens from ten populations belonging to two genetically closely related species, D. geniculata and D. laetitiae, and explored the possible association between the radioactivity dose and the level of genetic polymorphism in a specific family of satellite DNA (pDo500 satDNA. Radon concentration in the analyzed caves ranged from 221 to 26,000 Bq/m3. Specimens coming from caves with the highest radon concentration showed also the highest variability estimates in both species, and the increased sequence heterogeneity at pDo500 satDNA level can be explained as an effect of the mutation pressure induced by radon in cave. We discovered a specific category of nuclear DNA, the highly repetitive satellite DNA, where the effects of the exposure at high levels of radon-related ionizing radiation are detectable, suggesting that the satDNA sequences might be a valuable tool to disclose harmful effects also in other organisms exposed to high levels of radon concentration.

Identification of flavonoids and hydroxycinnamic acids in pak choi varieties (Brassica campestris L. ssp. chinensis var. communis) by HPLC-ESI-MSn and NMR and their quantification by HPLC-DAD.

Science.gov (United States)

Harbaum, Britta; Hubbermann, Eva Maria; Wolff, Christian; Herges, Rainer; Zhu, Zhujun; Schwarz, Karin

2007-10-03

Twenty-eight polyphenols (11 flavonoid derivatives and 17 hydroxycinnamic acid derivatives) were detected in different cultivars of the Chinese cabbage pak choi ( Brassica campestris L. ssp. chinensis var. communis) by HPLC-DAD-ESI-MS(n). Kaempferol was found to be the major flavonoid in pak choi, glycosylated and acylated with different compounds. Smaller amounts of isorhamnetin were also detected. A structural determination was carried out by (1)H and (13)C NMR spectroscopy for the main compound, kaempferol-3-O-hydroxyferuloylsophoroside-7-O-glucoside, for the first time. Hydroxycinnamic acid derivatives were identified as different esters of quinic acid, glycosides, and malic acid. The latter ones are described for the first time in cabbages. The content of polyphenols was determined in 11 cultivars of pak choi, with higher concentrations present in the leaf blade than in the leaf stem. Hydroxycinnamic acid esters, particularly malic acid derivatives, are present in both the leaf blade and leaf stem, whereas flavonoid levels were determined only in the leaf blade.

SAJSM EDITORIAL.indd

African Journals Online (AJOL)

Richard played cricket at a high level, with an average of 25.9 runs in rst division cricket. He captained the South. African Country Districts Cricket team for a number of years as a wicketkeeper-batsman. He retired from active cricket in 1982 and after his cricket career he served on the Border Cricket Board, with a three-year ...

Female monopolization and paternity assurance in South American crickets (Orthoptera, Grylloidea: mating plugs, extra claspers and forced copulation

Directory of Open Access Journals (Sweden)

Francisco de A.G. de Mello

2007-01-01

Full Text Available This paper describes the first three cases in which male crickets monopolize females by means of mating plugs. The origin of the plugs vary among the cases (i.e., they are not homologous. Female monogamy is assured by the permanent presence of the plug attached to their genitalia after first mating, while males are potentially polygamous. The presence of an additional clasping structure and the occurrence of forced copulation are also described.Este trabalho descreve os primeiros três casos em que grilos machos monopolizam suas fêmeas através de plugues de acasalamento. A origem dessas estruturas varia entre os casos (i.e., não há homologia entre as mesmas. A monogamia feminina é assegurada pela presença permanente do plugue de acasalamento aderido a sua genitália após a primeira cópula, enquanto que os machos são potencialmente poligâmicos. Descrevem-se ainda a presença de clásper adicional e a ocorrência de cópulas forçadas.

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available thomonas ... campestris pv. campestris str. ATCC 33913] ... Length = 247 ... Query: 49 ... LNPFVPVQF...PLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY 108 ... LNPFVPVQFPLKLV...DRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY Sbjct: 1 ... LNPFVPVQFPLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQY

Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.

Directory of Open Access Journals (Sweden)

Bo Liu

Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.

Production of the quinone-methide triterpene maytenin by in vitro adventitious roots of Peritassa campestris (Cambess.) A.C.Sm. (Celastraceae) and rapid detection and identification by APCI-IT-MS/MS.

Science.gov (United States)

Paz, Tiago Antunes; dos Santos, Vânia A F F M; Inácio, Marielle Cascaes; Pina, Edieidia Souza; Pereira, Ana Maria Soares; Furlan, Maysa

2013-01-01

Establishment of adventitious root cultures of Peritassa campestris (Celastraceae) was achieved from seed cotyledons cultured in semisolid Woody Plant Medium (WPM) supplemented with 2% sucrose, 0.01% PVP, and 4.0 mg L⁻¹ IBA. Culture period on accumulation of biomass and quinone-methide triterpene maytenin in adventitious root were investigated. The accumulation of maytenin in these roots was compared with its accumulation in the roots of seedlings grown in a greenhouse (one year old). A rapid detection and identification of maytenin by direct injection into an atmospheric-pressure chemical ionization ion trap tandem mass spectrometer (APCI-IT-MS/MS) were performed without prior chromatographic separation. In vitro, the greatest accumulation of biomass occurred within 60 days of culture. The highest level of maytenin--972.11  μ g·g⁻¹ dry weight--was detected at seven days of cultivation; this value was 5.55-fold higher than that found in the roots of seedlings grown in a greenhouse.

Production of the Quinone-Methide Triterpene Maytenin by In Vitro Adventitious Roots of Peritassa campestris (Cambess. A.C.Sm. (Celastraceae and Rapid Detection and Identification by APCI-IT-MS/MS

Directory of Open Access Journals (Sweden)

Tiago Antunes Paz

2013-01-01

Full Text Available Establishment of adventitious root cultures of Peritassa campestris (Celastraceae was achieved from seed cotyledons cultured in semisolid Woody Plant Medium (WPM supplemented with 2% sucrose, 0.01% PVP, and 4.0 mg L−1 IBA. Culture period on accumulation of biomass and quinone-methide triterpene maytenin in adventitious root were investigated. The accumulation of maytenin in these roots was compared with its accumulation in the roots of seedlings grown in a greenhouse (one year old. A rapid detection and identification of maytenin by direct injection into an atmospheric-pressure chemical ionization ion trap tandem mass spectrometer (APCI-IT-MS/MS were performed without prior chromatographic separation. In vitro, the greatest accumulation of biomass occurred within 60 days of culture. The highest level of maytenin—972.11 μg·g−1 dry weight—was detected at seven days of cultivation; this value was 5.55-fold higher than that found in the roots of seedlings grown in a greenhouse.

PREDICTING THE MATCH OUTCOME IN ONE DAY INTERNATIONAL CRICKET MATCHES, WHILE THE GAME IS IN PROGRESS

Directory of Open Access Journals (Sweden)

Michael Bailey

2006-12-01

Full Text Available Millions of dollars are wagered on the outcome of one day international (ODI cricket matches, with a large percentage of bets occurring after the game has commenced. Using match information gathered from all 2200 ODI matches played prior to January 2005, a range of variables that could independently explain statistically significant proportions of variation associated with the predicted run totals and match outcomes were created. Such variables include home ground advantage, past performances, match experience, performance at the specific venue, performance against the specific opposition, experience at the specific venue and current form. Using a multiple linear regression model, prediction variables were numerically weighted according to statistical significance and used to predict the match outcome. With the use of the Duckworth-Lewis method to determine resources remaining, at the end of each completed over, the predicted run total of the batting team could be updated to provide a more accurate prediction of the match outcome. By applying this prediction approach to a holdout sample of matches, the efficiency of the "in the run" wagering market could be assessed. Preliminary results suggest that the market is prone to overreact to events occurring throughout the course of the match, thus creating brief inefficiencies in the wagering market

Production of Mushroom Mycelium as a Protein and Fat Source in Submerged Culture in Medium of Vinasse

Science.gov (United States)

Falanghe, H.

1962-01-01

Of ten mushroom cultures investigated, only Agaricus campestris, Boletus indecisus, and Tricholoma nudum were capable of growing in submerged culture in medium of vinasse with added salts. Higher fermentative efficiencies were found under these conditions than in medium containing molasses or waste sulfite liquor. A. campestris showed a better capacity to produce protein but, since B. indecisus is capable of developing greater mycelium weight, its fermentative efficiencies are comparable. Both microorganisms could be grown in medium of vinasse with greatly varied amounts, producing higher mycelial weight in media with greater vinasse. The capacity of B. indecisus and A. campestris to utilize the noncarbohydrate fraction in total solids, instead of the total carbohydrates when they are in smaller amount, was observed in medium containing vinasse. B. indecisus and A. campestris were easily separated by filtration from the medium, although T. nudum was difficult to separate by this procedure. In experiments with A. campestris, the adaptative capacity of the organism to vinasse was demonstrated. PMID:13962715

Sexual selection affects the evolution of lifespan and ageing in the decorated cricket Gryllodes sigillatus.

Science.gov (United States)

Archer, C R; Zajitschek, F; Sakaluk, S K; Royle, N J; Hunt, J

2012-10-01

Recent work suggests that sexual selection can influence the evolution of ageing and lifespan by shaping the optimal timing and relative costliness of reproductive effort in the sexes. We used inbred lines of the decorated cricket, Gryllodes sigillatus, to estimate the genetic (co)variance between age-dependent reproductive effort, lifespan, and ageing within and between the sexes. Sexual selection theory predicts that males should die sooner and age more rapidly than females. However, a reversal of this pattern may be favored if reproductive effort increases with age in males but not in females. We found that male calling effort increased with age, whereas female fecundity decreased, and that males lived longer and aged more slowly than females. These divergent life-history strategies were underpinned by a positive genetic correlation between early-life reproductive effort and ageing rate in both sexes, although this relationship was stronger in females. Despite these sex differences in life-history schedules, age-dependent reproductive effort, lifespan, and ageing exhibited strong positive intersexual genetic correlations. This should, in theory, constrain the independent evolution of these traits in the sexes and may promote intralocus sexual conflict. Our study highlights the importance of sexual selection to the evolution of sex differences in ageing and lifespan in G. sigillatus. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

Identification of salivary gland proteins depleted after blood feeding in the malaria vector Anopheles campestris-like mosquitoes (Diptera: Culicidae.

Directory of Open Access Journals (Sweden)

Sriwatapron Sor-suwan

Full Text Available Malaria sporozoites must invade the salivary glands of mosquitoes for maturation before transmission to vertebrate hosts. The duration of the sporogonic cycle within the mosquitoes ranges from 10 to 21 days depending on the parasite species and temperature. During blood feeding salivary gland proteins are injected into the vertebrate host, along with malaria sporozoites in the case of an infected mosquito. To identify salivary gland proteins depleted after blood feeding of female Anopheles campestris-like, a potential malaria vector of Plasmodium vivax in Thailand, two-dimensional gel electrophoresis and nano-liquid chromatography-mass spectrometry techniques were used. Results showed that 19 major proteins were significantly depleted in three to four day-old mosquitoes fed on a first blood meal. For the mosquitoes fed the second blood meal on day 14 after the first blood meal, 14 major proteins were significantly decreased in amount. The significantly depleted proteins in both groups included apyrase, 5'-nucleotidase/apyrase, D7, D7-related 1, short form D7r1, gSG6, anti-platelet protein, serine/threonine-protein kinase rio3, putative sil1, cyclophilin A, hypothetical protein Phum_PHUM512530, AGAP007618-PA, and two non-significant hit proteins. To our knowledge, this study presents for the first time the salivary gland proteins that are involved in the second blood feeding on the day corresponding to the transmission period of the sporozoites to new mammalian hosts. This information serves as a basis for future work concerning the possible role of these proteins in the parasite transmission and the physiological processes that occur during the blood feeding.

Identification of salivary gland proteins depleted after blood feeding in the malaria vector Anopheles campestris-like mosquitoes (Diptera: Culicidae).

Science.gov (United States)

Sor-suwan, Sriwatapron; Jariyapan, Narissara; Roytrakul, Sittiruk; Paemanee, Atchara; Phumee, Atchara; Phattanawiboon, Benjarat; Intakhan, Nuchpicha; Chanmol, Wetpisit; Bates, Paul A; Saeung, Atiporn; Choochote, Wej

2014-01-01

Malaria sporozoites must invade the salivary glands of mosquitoes for maturation before transmission to vertebrate hosts. The duration of the sporogonic cycle within the mosquitoes ranges from 10 to 21 days depending on the parasite species and temperature. During blood feeding salivary gland proteins are injected into the vertebrate host, along with malaria sporozoites in the case of an infected mosquito. To identify salivary gland proteins depleted after blood feeding of female Anopheles campestris-like, a potential malaria vector of Plasmodium vivax in Thailand, two-dimensional gel electrophoresis and nano-liquid chromatography-mass spectrometry techniques were used. Results showed that 19 major proteins were significantly depleted in three to four day-old mosquitoes fed on a first blood meal. For the mosquitoes fed the second blood meal on day 14 after the first blood meal, 14 major proteins were significantly decreased in amount. The significantly depleted proteins in both groups included apyrase, 5'-nucleotidase/apyrase, D7, D7-related 1, short form D7r1, gSG6, anti-platelet protein, serine/threonine-protein kinase rio3, putative sil1, cyclophilin A, hypothetical protein Phum_PHUM512530, AGAP007618-PA, and two non-significant hit proteins. To our knowledge, this study presents for the first time the salivary gland proteins that are involved in the second blood feeding on the day corresponding to the transmission period of the sporozoites to new mammalian hosts. This information serves as a basis for future work concerning the possible role of these proteins in the parasite transmission and the physiological processes that occur during the blood feeding.

Adaptation and selective information transmission in the cricket auditory neuron AN2.

Directory of Open Access Journals (Sweden)

Klaus Wimmer

Full Text Available Sensory systems adapt their neural code to changes in the sensory environment, often on multiple time scales. Here, we report a new form of adaptation in a first-order auditory interneuron (AN2 of crickets. We characterize the response of the AN2 neuron to amplitude-modulated sound stimuli and find that adaptation shifts the stimulus-response curves toward higher stimulus intensities, with a time constant of 1.5 s for adaptation and recovery. The spike responses were thus reduced for low-intensity sounds. We then address the question whether adaptation leads to an improvement of the signal's representation and compare the experimental results with the predictions of two competing hypotheses: infomax, which predicts that information conveyed about the entire signal range should be maximized, and selective coding, which predicts that "foreground" signals should be enhanced while "background" signals should be selectively suppressed. We test how adaptation changes the input-response curve when presenting signals with two or three peaks in their amplitude distributions, for which selective coding and infomax predict conflicting changes. By means of Bayesian data analysis, we quantify the shifts of the measured response curves and also find a slight reduction of their slopes. These decreases in slopes are smaller, and the absolute response thresholds are higher than those predicted by infomax. Most remarkably, and in contrast to the infomax principle, adaptation actually reduces the amount of encoded information when considering the whole range of input signals. The response curve changes are also not consistent with the selective coding hypothesis, because the amount of information conveyed about the loudest part of the signal does not increase as predicted but remains nearly constant. Less information is transmitted about signals with lower intensity.

Interaction effects on uptake and toxicity of perfluoroalkyl substances and cadmium in wheat (Triticum aestivum L.) and rapeseed (Brassica campestris L.) from co-contaminated soil.

Science.gov (United States)

Zhao, Shuyan; Fan, Ziyan; Sun, Lihui; Zhou, Tao; Xing, Yuliang; Liu, Lifen

2017-03-01

A vegetation study was conducted to investigate the interactive effects of perfluoroalkyl substances (PFASs), including perfluorooctanoic acid (PFOA) and perfluorooctane sulfonate (PFOS), and Cadmium (Cd) on soil enzyme activities, phytotoxicity and bioaccumulation of wheat (Triticum aestivum L.) and rapeseed (Brassica campestris L.) from co-contaminated soil. Soil urease activities were inhibited significantly but catalase activities were promoted significantly by interaction of PFASs and Cd which had few effects on sucrase activities. Joint stress with PFASs and Cd decreased the biomass of plants and chlorophyll (Chl) content in both wheat and rapeseed, and malondialdehyde (MDA) content, superoxide dismutase (SOD) and peroxidase (POD) activities were increased in wheat but inhibited in rapeseed compared with single treatments. The bioconcentration abilities of PFASs in wheat and rapeseed were decreased, and the translocation factor of PFASs was decreased in wheat but increased in rapeseed with Cd addition. The bioaccumulation and translocation abilities of Cd were increased significantly in both wheat and rapeseed with PFASs addition. These findings suggested important evidence that the co-existence of PFASs and Cd reduced the bioavailability of PFASs while enhanced the bioavailability of Cd in soil, which increased the associated environmental risk for Cd but decreased for PFASs. Copyright © 2016 Elsevier Inc. All rights reserved.

The complex interplay between macronutrient intake, cuticular hydrocarbon expression and mating success in male decorated crickets.

Science.gov (United States)

Rapkin, J; Jensen, K; House, C M; Sakaluk, S K; Sakaluk, J K; Hunt, J

2017-04-01

The condition dependence of male sexual traits plays a central role in sexual selection theory. Relatively little, however, is known about the condition dependence of chemical signals used in mate choice and their subsequent effects on male mating success. Furthermore, few studies have isolated the specific nutrients responsible for condition-dependent variation in male sexual traits. Here, we used nutritional geometry to determine the effect of protein (P) and carbohydrate (C) intake on male cuticular hydrocarbon (CHC) expression and mating success in male decorated crickets (Gryllodes sigillatus). We show that both traits are maximized at a moderate-to-high intake of nutrients in a P:C ratio of 1 : 1.5. We also show that female precopulatory mate choice exerts a complex pattern of linear and quadratic sexual selection on this condition-dependent variation in male CHC expression. Structural equation modelling revealed that although the effect of nutrient intake on mating success is mediated through condition-dependent CHC expression, it is not exclusively so, suggesting that other traits must also play an important role. Collectively, our results suggest that the complex interplay between nutrient intake, CHC expression and mating success plays an important role in the operation of sexual selection in G. sigillatus. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.

The 5' untranslated region of a novel infectious molecular clone of the dicistrovirus cricket paralysis virus modulates infection.

Science.gov (United States)

Kerr, Craig H; Wang, Qing S; Keatings, Kathleen; Khong, Anthony; Allan, Douglas; Yip, Calvin K; Foster, Leonard J; Jan, Eric

2015-06-01

Dicistroviridae are a family of RNA viruses that possesses a single-stranded positive-sense RNA genome containing two distinct open reading frames (ORFs), each preceded by an internal ribosome entry site that drives translation of the viral structural and nonstructural proteins, respectively. The type species, Cricket paralysis virus (CrPV), has served as a model for studying host-virus interactions; however, investigations into the molecular mechanisms of CrPV and other dicistroviruses have been limited as an established infectious clone was elusive. Here, we report the construction of an infectious molecular clone of CrPV. Transfection of in vitro-transcribed RNA from the CrPV clone into Drosophila Schneider line 2 (S2) cells resulted in cytopathic effects, viral RNA accumulation, detection of negative-sense viral RNA, and expression of viral proteins. Transmission electron microscopy, viral titers, and immunofluorescence-coupled transwell assays demonstrated that infectious viral particles are released from transfected cells. In contrast, mutant clones containing stop codons in either ORF decreased virus infectivity. Injection of adult Drosophila flies with virus derived from CrPV clones but not UV-inactivated clones resulted in mortality. Molecular analysis of the CrPV clone revealed a 196-nucleotide duplication within its 5' untranslated region (UTR) that stimulated translation of reporter constructs. In cells infected with the CrPV clone, the duplication inhibited viral infectivity yet did not affect viral translation or RNA accumulation, suggesting an effect on viral packaging or entry. The generation of the CrPV infectious clone provides a powerful tool for investigating the viral life cycle and pathogenesis of dicistroviruses and may further understanding of fundamental host-virus interactions in insect cells. Dicistroviridae, which are RNA viruses that infect arthropods, have served as a model to gain insights into fundamental host-virus interactions in

Cognitive, physical and physiological responses of school boy cricketers to a 30-over batting simulation.

Science.gov (United States)

Goble, David; Christie, Candice Jo-Anne

2017-06-01

The purpose of this study was to assess how cognitive and physical performance are affected during a prolonged, fatigue-inducing cricket-batting simulation. Fifteen amateur batters from three Eastern Cape schools in South Africa were recruited (mean ± SD: age 17 ± 0.92 years; stature 1.75 ± 0.07 m; body mass 78.3 ± 13.2 kg). Participants completed a 6-stage, 30-over batting simulation (BATEX © ). During the protocol, there were five periods of cognitive assessment (CogState brief test battery, Melbourne, Australia). The primary outcome measures from each cognitive task were speed and accuracy/error rates. Physiological (heart rate) and physical (sprint times) responses were also recorded. Sprint times deteriorated (d = 0.84; P attention and vigilance (d = 0.56; P = 0.21) and attention and working memory (d = 0.61; P = 0.11), reducing task performance after 30 overs. Therefore, prolonged batting with repeated shuttle running fatigues amateur batters and adversely affects higher-order cognitive function. This will affect decision-making, response selection, response execution and other batting-related executive processes. We recommend that training should incorporate greater proportions of centre-wicket batting with repeated, high-intensity shuttle running. This will improve batting-related skills and information processing when fatigued, making practice more representative of competition.

Transgenic expression of the rice Xa21 pattern-recognition receptor in banana (Musa sp.) confers resistance to Xanthomonas campestris pv. musacearum.

Science.gov (United States)

Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena

2014-08-01

Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

The Xanthomonas campestris type III effector XopJ targets the host cell proteasome to suppress salicylic-acid mediated plant defence.

Directory of Open Access Journals (Sweden)

Suayib Üstün

Full Text Available The phytopathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv requires type III effector proteins (T3Es for virulence. After translocation into the host cell, T3Es are thought to interact with components of host immunity to suppress defence responses. XopJ is a T3E protein from Xcv that interferes with plant immune responses; however, its host cellular target is unknown. Here we show that XopJ interacts with the proteasomal subunit RPT6 in yeast and in planta to inhibit proteasome activity. A C235A mutation within the catalytic triad of XopJ as well as a G2A exchange within the N-terminal myristoylation motif abolishes the ability of XopJ to inhibit the proteasome. Xcv ΔxopJ mutants are impaired in growth and display accelerated symptom development including tissue necrosis on susceptible pepper leaves. Application of the proteasome inhibitor MG132 restored the ability of the Xcv ΔxopJ to attenuate the development of leaf necrosis. The XopJ dependent delay of tissue degeneration correlates with reduced levels of salicylic acid (SA and changes in defence- and senescence-associated gene expression. Necrosis upon infection with Xcv ΔxopJ was greatly reduced in pepper plants with reduced expression of NPR1, a central regulator of SA responses, demonstrating the involvement of SA-signalling in the development of XopJ dependent phenotypes. Our results suggest that XopJ-mediated inhibition of the proteasome interferes with SA-dependent defence response to attenuate onset of necrosis and to alter host transcription. A central role of the proteasome in plant defence is discussed.

Consistency of kinematic and kinetic patterns during a prolonged spell of cricket fast bowling: an exploratory laboratory study.

Science.gov (United States)

Schaefer, Andrew; O'dwyer, Nicholas; Ferdinands, René E D; Edwards, Suzi

2018-03-01

Due to the high incidence of lumbar spine injury in fast bowlers, international cricket organisations advocate limits on workload for bowlers under 19 years of age in training/matches. The purpose of this study was to determine whether significant changes in either fast bowling technique or movement variability could be detected throughout a 10-over bowling spell that exceeded the recommended limit. Twenty-five junior male fast bowlers bowled at competition pace while three-dimensional kinematic and kinetic data were collected for the leading leg, trunk and bowling arm. Separate analyses for the mean and within-participant standard deviation of each variable were performed using repeated measures factorial analyses of variance and computation of effect sizes. No substantial changes were observed in mean values or variability of any kinematic, kinetic or performance variables, which instead revealed a high degree of consistency in kinematic and kinetic patterns. Therefore, the suggestion that exceeding the workload limit per spell causes technique- and loading-related changes associated with lumbar injury risk is not valid and cannot be used to justify the restriction of bowling workload. For injury prevention, the focus instead should be on the long-term effect of repeated spells and on the fast bowling technique itself.

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

Risk Factors of Tendo-Achilles Injury in Football, Cricket and Badminton Players at Dhaka, Bangladesh.

Science.gov (United States)

Khan, M J; Giasuddin, A S M; Khalil, M I

2015-04-01

Achilles tendon is the tendon connecting the heel with the calf muscles. Tendo-achilles injury (TAI) in players is common in games. The frequency of TAI is unknown and aetiology is controversial: The present descriptive cross-sectional study was done to determine the prevalence of TAI and associated factors contributing to it in football, cricket and badminton. From January to June 2012, male players (n = 131), age -17-35 years, were selected by purposive sampling technique from renowned sporting clubs at Dhaka, Bangladesh. TAI was diagnosed through structured questionnaire and interviewing the respondents. The analysis by Statistical Package for Social Sciences (SPSS) programme revealed that 11.5% players suffered from TAI, i.e. prevalence was 115 per 1000 respondents. Most injuries (70/131; 53.4%) occurred in the playground and (59/131; 45.3%) happened in practice field. Injuries among the players of third division were higher, i.e. about 36% (p = 0.000). TAI was significantly dependent on occupation (p = 0.046), BMI (p = 0.008), divisional status (p = 0.023), game type (p = 0.043), ground condition (p = 0.05) and injury severity (p = 0.000). The injured players referred for treatment to the physiotherapist was highest (9/15, i.e. 60%) followed by the physicians (5/15, i.e. 33%) (p = 0.000). The associations of TAI with various factors were discussed suggesting effective measures be taken and treatment, particularly physiotherapy, be given to injured players. However, there is a need of team work with sports medicine specialist also to enable the injured players to continue their professional games.

Arabidopsis wat1 (walls are thin1)-mediated resistance to the bacterial vascular pathogen, Ralstonia solanacearum, is accompanied by cross-regulation of salicylic acid and tryptophan metabolism

NARCIS (Netherlands)

Denancé, N.; Ranocha, P.; Oria, N.; Barlet, X.; Rivière, M.P.; Yadeta, K.A.; Hoffmann, L.; Perreau, F.; Clément, G.; Maia-Grondard, A.; Berg, van den G.C.M.; Savelli, B.; Fournier, S.; Aubert, Y.; Pelletier, S.; Thomma, B.P.H.J.; Molina, A.; Jouanin, L.; Marco, Y.; Goffner, D.

2013-01-01

Inactivation of Arabidopsis WAT1 (Walls Are Thin1), a gene required for secondary cell-wall deposition, conferred broad-spectrum resistance to vascular pathogens, including the bacteria Ralstonia solanacearum and Xanthomonas campestris pv. campestris, and the fungi Verticillium dahliae and

Survival of pathogens of Brussels sprouts (Brassica oleracea Gemifera group) in crop residues

NARCIS (Netherlands)

Köhl, J.; Vlaswinkel, M.E.T.; Groenenboom-de Haas, B.H.; Kastelein, P.; Hoof, van R.A.; Wolf, van der J.M.; Krijger, M.C.

2011-01-01

Mycosphaerella brassicicola (ringspot), Alternaria brassicicola and A. brassicae (dark leaf spot) and Xanthomonas campestris pv. campestris (black spot) can infect leaves of Brussels sprouts resulting in yield losses. Infections of outer leaves of sprouts cause severe losses in quality. Crop

Efeito do tratamento de bacelos de videira 'Red Globe' no controle do cancro bacteriano causado por Xanthomonas campestris pv. viticola

Directory of Open Access Journals (Sweden)

Carine Rosa Naue

2014-12-01

Full Text Available A disseminação de Xanthomonas campestris pv. viticola (Xcv, agente do cancro bacteriano da videira, ocorre, dentre outras formas, por meio de mudas e bacelos infectados. Foi estudada a obtenção de material propagativo livre do patógeno, testando a eficiência do tratamento de bacelos com termoterapia, bactericidas e sanitizantes. Os isolados de Xcv foram testados quanto à patogenicidade e realizado o teste de sensibilidade in vitro aos produtos, em diferentes concentrações. A erradicação de Xcv em bacelos de videira foi testada em experimentos com termoterapia (50ºC por 30 e 40 min; 53ºC por 5 e 10 min; bactericidas [oxitetraciclina+sulfato de cobre (150+2.000; 165+2.200; 180+2.400 e 195+2.600 mg L-1 de H2O e oxitetraciclina (600; 700; 800 e 900 mg L-1]; e sanitizantes [cloreto de dodecildimetil amônio (600; 1.200; 1.800; 2.400 e 3.000 µL L-1; hipoclorito de sódio (5.000; 10.000; 20.000; 30.000 e 40.000 µL L-1 e cloreto de benzalcônio (125; 167;250; 334 e 500 µL L-1]. Foram avaliados período de incubação, incidência e severidade da doença. O bactericida oxitetraciclina e os sanitizantes cloreto de dodecildimetil amônio e hipoclorito de sódio proporcionaram os maiores halos de inibição de Xcv in vitro. No entanto, apesar dos diversos tratamentos testados, não foi possível recomendar tratamento termoterápico ou produto que erradicasse Xcv de bacelos infectados. Porém, ficou confirmada a grande importância destes na disseminação do agente do cancro bacteriano da videira.

The cost of assuming the life history of a host: acoustic startle in the parasitoid fly Ormia ochracea.

Science.gov (United States)

Rosen, M J; Levin, E C; Hoy, R R

2009-12-01

In the obligatory reproductive dependence of a parasite on its host, the parasite must trade the benefit of 'outsourcing' functions like reproduction for the risk of assuming hazards associated with the host. In the present study, we report behavioral adaptations of a parasitic fly, Ormia ochracea, that resemble those of its cricket hosts. Ormia females home in on the male cricket's songs and deposit larvae, which burrow into the cricket, feed and emerge to pupate. Because male crickets call at night, gravid female Ormia in search of hosts are subject to bat predation, in much the same way as female crickets are when responding to male song. We show that Ormia has evolved the same evasive behavior as have crickets: an acoustic startle response to bat-like ultrasound that manifests clearly only during flight. Furthermore, like crickets, Ormia has a sharp response boundary between the frequencies of song and bat cries, resembling categorical perception first described in the context of human speech.

Contribution of rpfB to cell-to-cell signal synthesis, virulence, and vector transmission of Xylella fastidiosa.

Science.gov (United States)

Almeida, Rodrigo P P; Killiny, Nabil; Newman, Karyn L; Chatterjee, Subhadeep; Ionescu, Michael; Lindow, Steven E

2012-04-01

In Xylella fastidiosa the fatty acid signal molecule diffusible signaling factor (DSF) is produced and sensed by components of the regulation of pathogenicity factors (rpf) cluster; lack of DSF production in RpfF mutants results in a non-vector-transmissible phenotype yet cells are hypervirulent to grape. rpfB has not been characterized in Xylella fastidiosa, although its homolog has been suggested to be required for DSF synthesis in Xanthomonas campestris pv. campestris. We show that RpfB is involved in DSF processing in both Xylella fastidiosa and Xanthomonas campestris, affecting the profile of DSF-like fatty acids observed in thin-layer chromatography. Although three fatty acids whose production is dependent on RpfF were detected in Xylella fastidiosa and Xanthomonas campestris wild-type strains, their respective rpfB mutants accumulated primarily one chemical species. Although no quantifiable effect of rpfB on plant colonization by Xylella fastidiosa was found, insect colonization and transmission was reduced. Thus, RpfB apparently is involved in DSF processing, and like Xanthomonas campestris, Xylella fastidiosa also produces multiple DSF molecules. It is possible that Xylella fastidiosa coordinates host vector and plant colonization by varying the proportions of different forms of DSF signals via RpfB.

What's in the Gift? Towards a Molecular Dissection of Nuptial Feeding in a Cricket.

Science.gov (United States)

Pauchet, Yannick; Wielsch, Natalie; Wilkinson, Paul A; Sakaluk, Scott K; Svatoš, Aleš; ffrench-Constant, Richard H; Hunt, John; Heckel, David G

2015-01-01

Nuptial gifts produced by males and transferred to females during copulation are common in insects. Yet, their precise composition and subsequent physiological effects on the female recipient remain unresolved. Male decorated crickets Gryllodes sigillatus transfer a spermatophore to the female during copulation that is composed of an edible gift, the spermatophylax, and the ampulla that contains the ejaculate. After transfer of the spermatophore, the female detaches the spermatophylax and starts to eat it while sperm from the ampulla are evacuated into the female reproductive tract. When the female has finished consuming the spermatophylax, she detaches the ampulla and terminates sperm transfer. Hence, one simple function of the spermatophylax is to ensure complete sperm transfer by distracting the female from prematurely removing the ampulla. However, the majority of orally active components of the spermatophylax itself and their subsequent effects on female behavior have not been identified. Here, we report the first analysis of the proteome of the G. sigillatus spermatophylax and the transcriptome of the male accessory glands that make these proteins. The accessory gland transcriptome was assembled into 17,691 transcripts whilst about 30 proteins were detected within the mature spermatophylax itself. Of these 30 proteins, 18 were encoded by accessory gland encoded messages. Most spermatophylax proteins show no similarity to proteins with known biological functions and are therefore largely novel. A spermatophylax protein shows similarity to protease inhibitors suggesting that it may protect the biologically active components from digestion within the gut of the female recipient. Another protein shares similarity with previously characterized insect polypeptide growth factors suggesting that it may play a role in altering female reproductive physiology concurrent with fertilization. Characterization of the spermatophylax proteome provides the first step in

What's in the Gift? Towards a Molecular Dissection of Nuptial Feeding in a Cricket.

Directory of Open Access Journals (Sweden)

Yannick Pauchet

Full Text Available Nuptial gifts produced by males and transferred to females during copulation are common in insects. Yet, their precise composition and subsequent physiological effects on the female recipient remain unresolved. Male decorated crickets Gryllodes sigillatus transfer a spermatophore to the female during copulation that is composed of an edible gift, the spermatophylax, and the ampulla that contains the ejaculate. After transfer of the spermatophore, the female detaches the spermatophylax and starts to eat it while sperm from the ampulla are evacuated into the female reproductive tract. When the female has finished consuming the spermatophylax, she detaches the ampulla and terminates sperm transfer. Hence, one simple function of the spermatophylax is to ensure complete sperm transfer by distracting the female from prematurely removing the ampulla. However, the majority of orally active components of the spermatophylax itself and their subsequent effects on female behavior have not been identified. Here, we report the first analysis of the proteome of the G. sigillatus spermatophylax and the transcriptome of the male accessory glands that make these proteins. The accessory gland transcriptome was assembled into 17,691 transcripts whilst about 30 proteins were detected within the mature spermatophylax itself. Of these 30 proteins, 18 were encoded by accessory gland encoded messages. Most spermatophylax proteins show no similarity to proteins with known biological functions and are therefore largely novel. A spermatophylax protein shows similarity to protease inhibitors suggesting that it may protect the biologically active components from digestion within the gut of the female recipient. Another protein shares similarity with previously characterized insect polypeptide growth factors suggesting that it may play a role in altering female reproductive physiology concurrent with fertilization. Characterization of the spermatophylax proteome provides the

Assessment of cadmium accumulation, toxicity, and tolerance in Brassicaceae and Fabaceae plants--implications for phytoremediation.

Science.gov (United States)

Anjum, Naser A; Umar, Shahid; Iqbal, Muhammad

2014-09-01

This study, based on a greenhouse pot culture experiment conducted with 15-day-old rapeseed (Brassica campestris L. cv. Pusa Gold; family Brassicaceae) and moong bean (Vigna radiata L. Wilczek cv. Pusa Ratna; family Fabaceae) plants treated with cadmium (Cd) concentrations (0, 50, and 100 mg kg(-1) soil), investigates their potential for Cd accumulation and tolerance, and dissects the underlying basic physiological/biochemical mechanisms. In both species, plant dry mass decreased, while Cd concentration of both root and shoot increased with increase in soil Cd. Roots harbored a higher amount of Cd (vs. shoot) in B. campestris, while the reverse applied to V. radiata. By comparison, root Cd concentration was higher in B. campestris than in V. radiata. The high Cd concentrations in B. campestris roots and V. radiata shoots led to significant elevation in oxidative indices, as measured in terms of electrolyte leakage, H2O2 content, and lipid peroxidation. Both plants displayed differential adaptation strategies to counteract the Cd burden-caused anomalies in their roots and shoots. In B. campestris, increasing Cd burden led to a significantly decreased reduced glutathione (GSH) content but a significant increase in activities of GSH reductase (GR), GSH peroxidase (GPX), and GSH sulfotransferase (GST). However, in V. radiata, increasing Cd burden caused significant increase in GSH content and GR activity, but a significant decline in activities of GPX and GST. Cross talks on Cd burden of tissues and the adapted Cd tolerance strategies against Cd burden-accrued toxicity indicated that B. campestris and V. radiata are good Cd stabilizer and Cd extractor, respectively, wherein a fine tuning among the major components (GR, GPX, GST, GSH) of the GSH redox system helped the plants to counteract differentially the Cd load-induced anomalies in tissues. On the whole, the physiological/biochemical characterization of the B. campestris and V. radiata responses to varying Cd

The effect of maternal and paternal immune challenge on offspring immunity and reproduction in a cricket.

Science.gov (United States)

McNamara, K B; van Lieshout, E; Simmons, L W

2014-06-01

Trans-generational immune priming is the transmission of enhanced immunity to offspring following a parental immune challenge. Although within-generation increased investment into immunity demonstrates clear costs on reproductive investment in a number of taxa, the potential for immune priming to impact on offspring reproductive investment has not been thoroughly investigated. We explored the reproductive costs of immune priming in a field cricket, Teleogryllus oceanicus. To assess the relative importance of maternal and paternal immune status, mothers and fathers were immune-challenged with live bacteria or a control solution and assigned to one of four treatments in which one parent, neither or both parents were immune-challenged. Families of offspring were reared to adulthood under a food-restricted diet, and approximately 10 offspring in each family were assayed for two measures of immunocompetence. We additionally quantified offspring reproductive investment using sperm viability for males and ovary mass for females. We demonstrate that parental immune challenge has significant consequences for the immunocompetence and, in turn, reproductive investment of their male offspring. A complex interaction between maternal and paternal immune status increased the antibacterial immune response of male offspring. This increased immune response was associated with a reduction in son's sperm viability, implicating a trans-generational resource trade-off between investment into immunocompetence and reproduction. Our data also show that these costs are sexually dimorphic, as daughters did not demonstrate a similar increase in immunity, despite showing a reduction in ovary mass. © 2014 The Authors. Journal of Evolutionary Biology © 2014 European Society For Evolutionary Biology.

Identification, RNAi knockdown, and functional analysis of an ejaculate protein that mediates a postmating, prezygotic phenotype in a cricket.

Directory of Open Access Journals (Sweden)

Jeremy L Marshall

2009-10-01

Full Text Available Postmating, prezygotic phenotypes, especially those that underlie reproductive isolation between closely related species, have been a central focus of evolutionary biologists over the past two decades. Such phenotypes are thought to evolve rapidly and be nearly ubiquitous among sexually reproducing eukaryotes where females mate with multiple partners. Because these phenotypes represent interplay between the male ejaculate and female reproductive tract, they are fertile ground for reproductive senescence--as ejaculate composition and female physiology typically change over an individual's life span. Although these phenotypes and their resulting dynamics are important, we have little understanding of the proteins that mediate these phenotypes, particularly for species groups where postmating, prezygotic traits are the primary mechanism of reproductive isolation. Here, we utilize proteomics, RNAi, mating experiments, and the Allonemobius socius complex of crickets, whose members are primarily isolated from one another by postmating, prezygotic phenotypes (including the ability of a male to induce a female to lay eggs, to demonstrate that one of the most abundant ejaculate proteins (a male accessory gland-biased protein similar to a trypsin-like serine protease decreases in abundance over a male's reproductive lifetime and mediates the induction of egg-laying in females. These findings represent one of the first studies to identify a protein that plays a role in mediating both a postmating, prezygotic isolation pathway and reproductive senescence.

Oxidative stress and the evolution of sex differences in life span and ageing in the decorated cricket, Gryllodes sigillatus.

Science.gov (United States)

Archer, Catharine R; Sakaluk, Scott K; Selman, Colin; Royle, Nick J; Hunt, John

2013-03-01

The Free Radical Theory of Ageing (FRTA) predicts that oxidative stress, induced when levels of reactive oxygen species exceed the capacity of antioxidant defenses, causes ageing. Recently, it has also been argued that oxidative damage may mediate important life-history trade-offs. Here, we use inbred lines of the decorated cricket, Gryllodes sigillatus, to estimate the genetic (co)variance between age-dependent reproductive effort, life span, ageing, oxidative damage, and total antioxidant capacity within and between the sexes. The FRTA predicts that oxidative damage should accumulate with age and negatively correlate with life span. We find that protein oxidation is greater in the shorter lived sex (females) and negatively genetically correlated with life span in both sexes. However, oxidative damage did not accumulate with age in either sex. Previously we have shown antagonistic pleiotropy between the genes for early-life reproductive effort and ageing rate in both sexes, although this was stronger in females. In females, we find that elevated fecundity early in life is associated with greater protein oxidation later in life, which is in turn positively correlated with the rate of ageing. Our results provide mixed support for the FRTA but suggest that oxidative stress may mediate sex-specific life-history strategies in G. sigillatus. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

What’s in the Gift? Towards a Molecular Dissection of Nuptial Feeding in a Cricket

Science.gov (United States)

Pauchet, Yannick; Wielsch, Natalie; Wilkinson, Paul A.; Sakaluk, Scott K.; Svatoš, Aleš

2015-01-01

Nuptial gifts produced by males and transferred to females during copulation are common in insects. Yet, their precise composition and subsequent physiological effects on the female recipient remain unresolved. Male decorated crickets Gryllodes sigillatus transfer a spermatophore to the female during copulation that is composed of an edible gift, the spermatophylax, and the ampulla that contains the ejaculate. After transfer of the spermatophore, the female detaches the spermatophylax and starts to eat it while sperm from the ampulla are evacuated into the female reproductive tract. When the female has finished consuming the spermatophylax, she detaches the ampulla and terminates sperm transfer. Hence, one simple function of the spermatophylax is to ensure complete sperm transfer by distracting the female from prematurely removing the ampulla. However, the majority of orally active components of the spermatophylax itself and their subsequent effects on female behavior have not been identified. Here, we report the first analysis of the proteome of the G. sigillatus spermatophylax and the transcriptome of the male accessory glands that make these proteins. The accessory gland transcriptome was assembled into 17,691 transcripts whilst about 30 proteins were detected within the mature spermatophylax itself. Of these 30 proteins, 18 were encoded by accessory gland encoded messages. Most spermatophylax proteins show no similarity to proteins with known biological functions and are therefore largely novel. A spermatophylax protein shows similarity to protease inhibitors suggesting that it may protect the biologically active components from digestion within the gut of the female recipient. Another protein shares similarity with previously characterized insect polypeptide growth factors suggesting that it may play a role in altering female reproductive physiology concurrent with fertilization. Characterization of the spermatophylax proteome provides the first step in

Waarnemingen van de veenmol Gryllotalpa gryllotalpa in de duinen van Noord-Holland (Orthoptera).

NARCIS (Netherlands)

Kerkhof, W.

2007-01-01

The mole cricket Gryllotalpa gryllotalpa in de Dutch dunes (Orthoptera) In recent years mole crickets Gryllotalpa gryllotalpa were found at 37 sites in the Dutch dunes. Conservation measures to create moist dune valleys seem to play a positive role for mole crickets. Half of the new records stemmed

EFFICACITE DE L'HYDROXYDE DE CUIVRE CONTRE LA ...

African Journals Online (AJOL)

Repository Agriculture : 70081962. Idrissou-Touré M. 2014. Test d'efficacité du fongi- cide « IDEFIX 40 WP hydroxyde de cuivre. 65,6 g/100 g » contre la nervation noire du chou causée par Xanthomonas campestris pv. campestris. Mémoire de. Master professionnel en Sciences et. Techniques de Production Végétale, Uni-.

Plant and animal species composition and heavy metal content in fly ash ecosystems

International Nuclear Information System (INIS)

Brieger, G.; Wells, J.R.; Hunter, R.D.

1992-01-01

Plant and animal species present on a coal fly ash slurry pond site and a dry deposit site were surveyed and sampled during a two-day period in October. Elemental analyses were determined for most of the species encountered. A total of 48 plant species were observed on the two sites, with 35 species on the wet site, and 20 on the dry site. Eighteen terrestrial and 7 aquatic animal species were found on the wet site, exclusive of vertebrates which were not studied with the exception of a carp (Cyprinus carpio). Eleven terrestrial invertebrate and one aquatic species were observed on the dry site. Neutron activation analysis was carried out for: Se, Hg, Cr, Ni, Zn, Co, Sb, Cd, and As. Using literature values for phytotoxicity, it is concluded that, in general, plants did not accumulate toxic levels of metals. Only one plant (Impatiens biflora Willd.) showed a significant level of Cd. Of 20 plants analyzed on the wet site, 10 had excessive Se concentrations (>5 ppm); on the dry site 6 out of 18 had high Se values. In animals (Gryllus sp.; Melanoplus sp.; Trachelipus sp; Lumbricus terrestris; Physa integra; Cyprinus carpio) the trace metal concentration was generally in between that of control animals and that of the fly ash itself. One exception included Zn, which, although the most variable element examined, was concentrated in all the terrestrial animals to levels higher than in fly ash. Crickets are the most consistent bioconcentrators with Cr, Se, and Zn at higher levels than for control animals. All animals species studied accumulated Se compared to controls. 48 refs., 6 tabs

Biting off more than you can chew: sexual selection on the free amino acid composition of the spermatophylax in decorated crickets

Science.gov (United States)

Gershman, Susan N.; Mitchell, Christopher; Sakaluk, Scott K.; Hunt, John

2012-01-01

Nuptial food gifts function to enhance male fertilization success, but their consumption is not always beneficial to females. In decorated crickets, the spermatophore transferred at mating includes a gelatinous mass, the spermatophylax, which is consumed by females after mating. However, females often discard spermatophylaxes shortly after mating, whereupon they terminate sperm transfer. We hypothesized that females discard gifts based on their assessment of the gift itself, and specifically the composition of free amino acids. We tested this hypothesis by comparing spermatophylaxes discarded by females after mating with those that were destined to be fully consumed, and employed multivariate selection analysis to quantify the strength and form of multivariate sexual selection operating on the free amino acid composition of gifts. The analysis yielded a saddle-shaped fitness surface with two local peaks. Different amino acid profiles appear to elicit continued feeding on the spermatophylax either because they offer the same level of gustatory appeal, or because they differentially affect both the gustatory appeal and texture of the spermatophylax. We conclude that the gustatory response of females to males' nuptial food gifts represents an important avenue of post-copulatory mate choice, imposing significant sexual selection on the free amino acid composition of the spermatophylax. PMID:22357263

Biomonitoring of the genotoxic effects and oxidative potentials of commercial edible dung beetles (Onitis sp.), grasshopper (Caelifera sp.) and mole crickets (Gryllotalpa sp.) in vitro.

Science.gov (United States)

Koc, Kubra; Incekara, Umit; Turkez, Hasan

2014-09-01

In this investigation, the genotoxic and oxidative effects of water soluble extracts of dung beetles, flying grasshopper and mole crickets have been assessed on cultured human blood cells. The extracts were added to the culture tubes at 12 different concentrations (0-2000 ppm). Micronucleus test was used to monitor the DNA and the chromosomal damage produced by aqueous extracts in vitro. In addition, to assess the oxidative effects, total antioxidant capacity (TAC) and total oxidant status (TOS) levels were also measured. Our results indicated that these extracts did not show genotoxic effects at the tested concentrations. However, the extracts caused dose-dependent alterations in both TAC and TOS levels. Based on the findings, it was concluded that the studied insects can be consumed safely, but it is necessary to consider the cellular damages which are likely to appear depending on oxidative stress at higher concentrations. It has also been suggested that this in vitro approach for oxidative and genotoxicity assessments may be useful to evaluate the potential health risks of edible insects. © The Author(s) 2014.

Real time expression of ACC oxidase and PR-protein genes mediated by Methylobacterium spp. in tomato plants challenged with Xanthomonas campestris pv. vesicatoria.

Science.gov (United States)

Yim, W J; Kim, K Y; Lee, Y W; Sundaram, S P; Lee, Y; Sa, T M

2014-07-15

Biotic stress like pathogenic infection increases ethylene biosynthesis in plants and ethylene inhibitors are known to alleviate the severity of plant disease incidence. This study aimed to reduce the bacterial spot disease incidence in tomato plants caused by Xanthomonas campestris pv. vesicatoria (XCV) by modulating stress ethylene with 1-aminocyclopropane-1-carboxylate (ACC) deaminase activity of Methylobacterium strains. Under greenhouse condition, Methylobacterium strains inoculated and pathogen challenged tomato plants had low ethylene emission compared to pathogen infected ones. ACC accumulation and ACC oxidase (ACO) activity with ACO related gene expression increased in XCV infected tomato plants over Methylobacterium strains inoculated plants. Among the Methylobacterium spp., CBMB12 resulted lowest ACO related gene expression (1.46 Normalized Fold Expression), whereas CBMB20 had high gene expression (3.42 Normalized Fold Expression) in pathogen challenged tomato. But a significant increase in ACO gene expression (7.09 Normalized Fold Expression) was observed in the bacterial pathogen infected plants. In contrast, Methylobacterium strains enhanced β-1,3-glucanase and phenylalanine ammonia-lyase (PAL) enzyme activities in pathogen challenged tomato plants. The respective increase in β-1,3-glucanase related gene expressions due to CBMB12, CBMB15, and CBMB20 strains were 66.3, 25.5 and 10.4% higher over pathogen infected plants. Similarly, PAL gene expression was high with 0.67 and 0.30 Normalized Fold Expression, in pathogen challenged tomato plants inoculated with CBMB12 and CBMB15 strains. The results suggest that ethylene is a crucial factor in bacterial spot disease incidence and that methylobacteria with ACC deaminase activity can reduce the disease severity with ultimate pathogenesis-related protein increase in tomato. Copyright © 2014 Elsevier GmbH. All rights reserved.

Comparative transcript profiling of fertile and sterile flower buds from multiple-allele-inherited male sterility in Chinese cabbage (Brassica campestris L. ssp. pekinensis).

Science.gov (United States)

Zhou, Xue; Liu, Zhiyong; Ji, Ruiqin; Feng, Hui

2017-10-01

We studied the underlying causes of multiple-allele-inherited male sterility in Chinese cabbage (Brassica campestris L. ssp. pekinensis) by identifying differentially expressed genes (DEGs) related to pollen sterility between fertile and sterile flower buds. In this work, we verified the stages of sterility microscopically and then performed transcriptome analysis of mRNA isolated from fertile and sterile buds using Illumina HiSeq 2000 platform sequencing. Approximately 80% of ~229 million high-quality paired-end reads were uniquely mapped to the reference genome. In sterile buds, 699 genes were significantly up-regulated and 4096 genes were down-regulated. Among the DEGs, 28 pollen cell wall-related genes, 54 transcription factor genes, 45 phytohormone-related genes, 20 anther and pollen-related genes, 212 specifically expressed transcripts, and 417 DEGs located on linkage group A07 were identified. Six transcription factor genes BrAMS, BrMS1, BrbHLH089, BrbHLH091, BrAtMYB103, and BrANAC025 were identified as putative sterility-related genes. The weak auxin signal that is regulated by BrABP1 may be one of the key factors causing pollen sterility observed here. Moreover, several significantly enriched GO terms such as "cell wall organization or biogenesis" (GO:0071554), "intrinsic to membrane" (GO:0031224), "integral to membrane" (GO:0016021), "hydrolase activity, acting on ester bonds" (GO:0016788), and one significantly enriched pathway "starch and sucrose metabolism" (ath00500) were identified in this work. qRT-PCR, PCR, and in situ hybridization experiments validated our RNA-seq transcriptome analysis as accurate and reliable. This study will lay the foundation for elucidating the molecular mechanism(s) that underly sterility and provide valuable information for studying multiple-allele-inherited male sterility in the Chinese cabbage line 'AB01'.

Olfactory signaling of aggressive intent in male-male contests of cave crickets (Troglophilus neglectus; Orthoptera: Rhaphidophoridae.

Directory of Open Access Journals (Sweden)

Nataša Stritih

Full Text Available In animal contests, communicating aggressive motivation is most often mediated by visual or acoustic signals, while chemical signals are not expected to serve such a function since they are less able to be modulated by the sender during the changing behavioral context. We describe a rare example of ephemeral olfactory signals in terrestrial animals, signals that are emitted via protrusive scent glands in male cave crickets Troglophilus neglectus (Orthoptera, Rhaphidophoridae to reflect the state of the signaler's aggression. We correlate the intensity of behaviorally expressed aggression of the individuals in dyadic contests with the frequency and extent of their gland tissue protrusion, the latter serving as an indication of the amount of released odor. We detected large amounts of odor release during brief gland protrusions, and the absence of its release during gland retraction. Males protruded the glands during and after encountering a rival, with the degree of protrusion increasing with the intensity of the signalers' aggression. During the encounters, the degree of gland protrusion increased most strongly with the occurrence of the elevated body posture, directly preceding the attack. This degree was significantly higher in encounter winners than in losers displaying such posture, suggesting the highly important role of the released odor for contest resolution. After the encounters, glands were protruded almost exclusively by winners, apparently announcing victory. We tested for the function of the olfactory signals also directly, by preventing gland tissue protrusion in symmetric and asymmetric treatments of the contestants. Treating only the dominant individuals decreased the percentage of encounters they won by over 60%, while treating both contestants elicited a significant increase in the frequency and duration of fights. During contests, the olfactory signals of T. neglectus apparently function as a highly effective threat, which

Microbial counts of mealworm larvae (Tenebrio molitor) and crickets (Acheta domesticus and Gryllodes sigillatus) from different rearing companies and different production batches.

Science.gov (United States)

Vandeweyer, D; Crauwels, S; Lievens, B; Van Campenhout, L

2017-02-02

The rising interest in insects for human consumption and the changing regulations in Europe require a profound insight into the food safety of insects reared and sold in Western society. The microbial quality of edible insects has only been studied occasionally. This study aimed at generating an overview of intrinsic parameters (pH, water activity and moisture content) and microbial quality of fresh mealworm larvae and crickets for several rearing companies and for several batches per rearer. In total, 21 batches obtained from 7 rearing companies were subjected to analysis of intrinsic parameters, a range of plate counts and presence-absence tests for Salmonella spp. and Listeria monocytogenes. The microbial counts of the fresh insects were generally high. Different rearing batches from a single rearing company showed differences in microbial counts which could not be explained by variations in intrinsic properties. The largest variations were found in numbers of bacterial endospores, psychrotrophs and fungi. Salmonella spp. and L. monocytogenes were not detected in any of the samples. Altogether, our study shows that large variations were found between batches from individual rearers. As a consequence, no overall differences between rearers could be observed. Copyright © 2016 Elsevier B.V. All rights reserved.

JPRS Report, Science & Technology, USSR: Life Sciences.

Science.gov (United States)

1987-06-29

MEDITSINSKAYA BIOTEKHNOLOGIYA, No 11, Nov 85) 20 Xanthomonas Campestris Pv. Oryzae, Rice Seed Bacteriosis Pathogen in the Ukraine (I.B, Koroleva...ethylene, and are active in a series of bioassays on auxins, gibberellins and cytokinins. Nevertheless, according to the character of their biological...CAMPESTRIS PV. ORYZAE, RICE SEED BACTERIOSIS PATHOGEN IN THE UKRAINE Kiev MIKROBIOLOGICHESKIY ZHURNAL in Russian Vol 47, No 6, Nov-Dec 85 (manuscript

SERVICE QUALITY DIMENSIONS IN SPECTATOR SPORT: ANANALYSIS OF THE TWENTY-TWENTYCRICKETLEAGUEMATCHES IN SOUTH AFRICA

Directory of Open Access Journals (Sweden)

B. A Mokoena

2017-01-01

Full Text Available Since their inception, twenty-twenty (T20 cricket league matches have gainedtremendous popularity and areheralded in South Africa with the potential ofincreasingthespectatorsupport base in cricket. The purpose of this studywastoenhance an understanding of service quality by examining theservice qualitydimensions in T20 cricket events in South Africa. A convenience sample of250T20 cricket spectatorsin the Gauteng provinceofSouth Africa participated in asurveyusingastructuredself-administered questionnaire. The factor analysisprocedure resulted in the extraction of six primarydimensions, namely servicepersonnel, game atmosphere, facility access, facility aesthetics, home team qualityand opposing team characteristics. The model was tested using confirmatory factoranalysis, which showed a good-fit of the data to the model.Among the servicequality dimensions, facility access was rated the most important dimension. Thestudy recommends that managers use the suggested dimensional framework tomeasure service quality in T20 cricket. Managers can also use this framework andmeasurement scale as a diagnostic tool to identify strengths and weaknesses in theirservices, thus providing guidance for potential areas of improvement.

Transient behavior of cadmium in a grassland arthropod food chain

International Nuclear Information System (INIS)

Van Hook, R.I.; Yates, A.J.

1975-01-01

Biological assimilation and transport of cadmium were determined for an arthropod food chain in an east Tennessee grassland community. Laboratory experiments demonstrated that there were no significant differences (P greater than 0.05) in assimilation rates (17 percent assimilation per day) or biological half-lives (7 days) of 109 Cd either as soluble nitrate or insoluble oxide in crickets under identical conditions. Field experiments demonstrated that primary consumers (crickets) accumulated 109 Cd much more rapidly (uptake rate = 0.55 day -1 ) than did the spider predators (uptake rate = 0.08 day -1 ). Equilibrium concentrations in crickets were obtained in 9 days (0.04 ppM cadmium), while equilibrium was not reached in spiders during the 30-day study. Food-chain concentration of cadmium did not occur as crickets accumulated levels of cadmium 60 percent of that in their vegetation food sources and spiders accumulated only 70 percent of the cadmium present in the cricket tissues

Effects of plyometric training on achilles tendon properties and shuttle running during a simulated cricket batting innings.

Science.gov (United States)

Houghton, Laurence A; Dawson, Brian T; Rubenson, Jonas

2013-04-01

The aim of this study was to determine whether intermittent shuttle running times (during a prolonged, simulated cricket batting innings) and Achilles tendon properties were affected by 8 weeks of plyometric training (PLYO, n = 7) or normal preseason (control [CON], n = 8). Turn (5-0-5-m agility) and 5-m sprint times were assessed using timing gates. Achilles tendon properties were determined using dynamometry, ultrasonography, and musculoskeletal geometry. Countermovement and squat jump heights were also assessed before and after training. Mean 5-0-5-m turn time did not significantly change in PLYO or CON (pre vs. post: 2.25 ± 0.08 vs. 2.22 ± 0.07 and 2.26 ± 0.06 vs. 2.25 ± 0.08 seconds, respectively). Mean 5-m sprint time did not significantly change in PLYO or CON (pre vs. post: 0.85 ± 0.02 vs. 0.84 ± 0.02 and 0.85 ± 0.03 vs. 0.85 ± 0.02 seconds, respectively). However, inferences from the smallest worthwhile change suggested that PLYO had a 51-72% chance of positive effects but only 6-15% chance of detrimental effects on shuttle running times. Jump heights only increased in PLYO (9.1-11.0%, p force, stiffness, elastic energy, strain, modulus) did not change in PLYO or CON. However, Achilles tendon cross-sectional area increased in PLYO (pre vs. post: 70 ± 7 vs. 79 ± 8 mm, p 0.050). In conclusion, plyometric training had possible benefits on intermittent shuttle running times and improved jump performance. Also, plyometric training increased tendon cross-sectional area, but further investigation is required to determine whether this translates to decreased injury risk.

Effects of Terrestrial Buffer Zones on Amphibians on Golf Courses

Science.gov (United States)

Puglis, Holly J.; Boone, Michelle D.

2012-01-01

A major cause of amphibian declines worldwide is habitat destruction or alteration. Public green spaces, such as golf courses and parks, could serve as safe havens to curb the effects of habitat loss if managed in ways to bolster local amphibian communities. We reared larval Blanchard's cricket frogs (Acris blanchardi) and green frogs (Rana clamitans) in golf course ponds with and without 1 m terrestrial buffer zones, and released marked cricket frog metamorphs at the golf course ponds they were reared in. Larval survival of both species was affected by the presence of a buffer zone, with increased survival for cricket frogs and decreased survival for green frogs when reared in ponds with buffer zones. No marked cricket frog juveniles were recovered at any golf course pond in the following year, suggesting that most animals died or migrated. In a separate study, we released cricket frogs in a terrestrial pen and allowed them to choose between mown and unmown grass. Cricket frogs had a greater probability of using unmown versus mown grass. Our results suggest that incorporating buffer zones around ponds can offer suitable habitat for some amphibian species and can improve the quality of the aquatic environment for some sensitive local amphibians. PMID:22761833

Nitric oxide/cGMP/PKG signaling pathway activated by M1-type muscarinic acetylcholine receptor cascade inhibits Na+-activated K+ currents in Kenyon cells

Science.gov (United States)

Hasebe, Masaharu

2016-01-01

The interneurons of the mushroom body, known as Kenyon cells, are essential for the long-term memory of olfactory associative learning in some insects. Some studies have reported that nitric oxide (NO) is strongly related to this long-term memory in Kenyon cells. However, the target molecules and upstream and downstream NO signaling cascades are not completely understood. Here we analyzed the effect of the NO signaling cascade on Na+-activated K+ (KNa) channel activity in Kenyon cells of crickets (Gryllus bimaculatus). We found that two different NO donors, S-nitrosoglutathione (GSNO) and S-nitroso-N-acetyl-dl-penicillamine (SNAP), strongly suppressed KNa channel currents. Additionally, this inhibitory effect of GSNO on KNa channel activity was diminished by 1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (ODQ), an inhibitor of soluble guanylate cyclase (sGC), and KT5823, an inhibitor of protein kinase G (PKG). Next, we analyzed the role of ACh in the NO signaling cascade. ACh strongly suppressed KNa channel currents, similar to NO donors. Furthermore, this inhibitory effect of ACh was blocked by pirenzepine, an M1 muscarinic ACh receptor antagonist, but not by 1,1-dimethyl-4-diphenylacetoxypiperidinium iodide (4-DAMP) and mecamylamine, an M3 muscarinic ACh receptor antagonist and a nicotinic ACh receptor antagonist, respectively. The ACh-induced inhibition of KNa channel currents was also diminished by the PLC inhibitor U73122 and the calmodulin antagonist W-7. Finally, we found that ACh inhibition was blocked by the nitric oxide synthase (NOS) inhibitor NG-nitro-l-arginine methyl ester (l-NAME). These results suggested that the ACh signaling cascade promotes NO production by activating NOS and NO inhibits KNa channel currents via the sGC/cGMP/PKG signaling cascade in Kenyon cells. PMID:26984419

Nudiviruses and other large, double-stranded circular DNA viruses of invertebrates: new insights on an old topic.

Science.gov (United States)

Wang, Yongjie; Jehle, Johannes A

2009-07-01

Nudiviruses (NVs) are a highly diverse group of large, circular dsDNA viruses pathogenic for invertebrates. They have rod-shaped and enveloped nucleocapsids, replicate in the nucleus of infected host cells, and possess interesting biological and molecular properties. The unassigned viral genus Nudivirus has been proposed for classification of nudiviruses. Currently, the nudiviruses comprise five different viruses: the palm rhinoceros beetle virus (Oryctes rhinoceros NV, OrNV), the Hz-1 virus (Heliothis zea NV-1, HzNV-1), the cricket virus (Gryllus bimaculatus NV, GbNV), the corn earworm moth Hz-2 virus (HzNV-2), and the occluded shrimp Monodon Baculovirus reassigned as Penaeus monodon NV (PmNV). Thus far, the genomes of OrNV, GbNV, HzNV-1 and HzNV-2 have been completely sequenced. They vary between 97 and 230kbp in size and encode between 98 and 160 open reading frames (ORFs). All sequenced nudiviruses have 33 ORFs in common. Strikingly, 20 of them are homologous to baculovirus core genes involved in RNA transcription, DNA replication, virion structural components and other functions. Another nine conserved ORFs are likely associated with DNA replication, repair and recombination, and nucleotide metabolism; one is homologous to baculovirus iap-3 gene; two are nudivirus-specific ORFs of unknown function. Interestingly, one nudivirus ORF is similar to polh/gran gene, encoding occlusion body protein matrix and being conserved in Alpha- Beta- and Gammabaculoviruses. Members of nudiviruses are closely related and form a monophyletic group consisting of two sister clades of OrNV/GbNV and HzNVs/PmNV. It is proposed that nudiviruses and baculoviruses derived from a common ancestor and are evolutionarily related to other large DNA viruses such as the insect-specific salivary gland hypertrophy virus (SGHV) and the marine white spot syndrome virus (WSSV).

Composição e Diversidade da Fauna de Grilos (Orthoptera: Grylloidea em um Fragmento de Floresta Pluvial Atlântica do Estado do Rio de Janeiro

Directory of Open Access Journals (Sweden)

Camila Santos Oliveira

2013-12-01

Abstract. This study aimed to analyze the fauna of cricket, its relation with different plant compositions, litter level and seasonality effects. Four collections were performed, in four season of the year, between April 2008 and March 2009. It was collected 503 crickets using soil traps, in eight sampling points. The insects collected were identified as the genera Anurogryllus, Argizala, Hygronemobius, Nemobius, Odontogryllus e Pteronemobius. The crickets have no affinity with uncovered soil, decreasing significantly in more impacted places. The litter level did not affect the abundance and the seasonal changes shown importance in the population variation, however, diversity and dominance showed fidelity to environmental changes even in lower abundance. These results show that crickets may be environmental indicators due to the answers the changes in environment.

Cranking up the heat: relationships between energetically costly song features and the increase in thorax temperature in male crickets and katydids.

Science.gov (United States)

Erregger, Bettina; Kovac, Helmut; Stabentheiner, Anton; Hartbauer, Manfred; Römer, Heinrich; Schmidt, Arne K D

2017-07-15

Sexual displays of acoustically signalling insects are used in the context of mate attraction and mate choice. While energetic investment in sound production can increase the reproductive success of the sender, this entails metabolic costs. Resource allocation to sexually selected, reproductive traits can trade off against allocation to naturally selected traits (e.g. growth, immunity) when individuals' energy budgets are limited. Estimating the magnitude of the costs invested in acoustic signalling is necessary to understand this trade-off and its influence on fitness and life history. To compare the costs associated with acoustic signalling for two ensiferan species, we simultaneously took respiratory measurements to record the rate of CO 2 production and used infrared thermography to measure the increase in thorax temperature. Furthermore, to identify what combinations of acoustic parameters were energetically costly for the sender, we recorded the calling songs of 22 different cricket and katydid species for a comparative analysis and measured their thorax temperature while they sang. Acoustic signalling was energetically costly for Mecopoda sp. and Anurogryllus muticus , requiring a 12- and 16-fold increase over resting levels in the CO 2 production rate. Moreover, calling increased thorax temperature, on average by 7.6 and 5.8°C, respectively. We found that the song intensity and effective calling rate, not simply the chirp/trill duty cycle or the pulse rate alone, were good predictors for the thorax temperature increase in males. © 2017. Published by The Company of Biologists Ltd.

Chloroplast Redox Status Modulates Genome-Wide Plant Responses during the Non-host Interaction of Tobacco with the Hemibiotrophic Bacterium Xanthomonas campestris pv. vesicatoria

Directory of Open Access Journals (Sweden)

Juan J. Pierella Karlusich

2017-07-01

Full Text Available Non-host resistance is the most ample and durable form of plant resistance against pathogen infection. It includes induction of defense-associated genes, massive metabolic reprogramming, and in many instances, a form of localized cell death (LCD at the site of infection, purportedly designed to limit the spread of biotrophic and hemibiotrophic microorganisms. Reactive oxygen species (ROS have been proposed to act as signals for LCD orchestration. They are produced in various cellular compartments including chloroplasts, mitochondria and apoplast. We have previously reported that down-regulation of ROS build-up in chloroplasts by expression of a plastid-targeted flavodoxin (Fld suppressed LCD in tobacco leaves inoculated with the non-host bacterium Xanthomonas campestris pv. vesicatoria (Xcv, while other defensive responses were unaffected, suggesting that chloroplast ROS and/or redox status play a major role in the progress of LCD. To better understand these effects, we compare here the transcriptomic alterations caused by Xcv inoculation on leaves of Fld-expressing tobacco plants and their wild-type siblings. About 29% of leaf-expressed genes were affected by Xcv and/or Fld. Surprisingly, 5.8% of them (1,111 genes were regulated by Fld in the absence of infection, presumably representing pathways responsive to chloroplast ROS production and/or redox status during normal growth conditions. While the majority (∼75% of pathogen-responsive genes were not affected by Fld, many Xcv responses were exacerbated, attenuated, or regulated in opposite direction by expression of this protein. Particularly interesting was a group of 384 genes displaying Xcv responses that were already triggered by Fld in the absence of infection, suggesting that the transgenic plants had a larger and more diversified suite of constitutive defenses against the attacking microorganism compared to the wild type. Fld modulated many genes involved in pathogenesis, signal

Modelling the distribution of the invasive Roesel’s bush-cricket (Metrioptera roeselii in a fragmented landscape

Directory of Open Access Journals (Sweden)

Sonja Preuss

2011-11-01

Full Text Available The development of conservation strategies to mitigate the impact of invasive species requires knowledge of the species ecology and distribution. This is, however, often lacking as collecting biological data may be both time-consuming and resource intensive. Species distribution models can offer a solution to this dilemma by analysing the species-environment relationship with help of Geographic information systems (GIS. In this study, we model the distribution of the non-native bush-cricket Metrioptera roeselii in the agricultural landscape in mid-Sweden where the species has been rapidly expanding in its range since the 1990s. We extract ecologically relevant landscape variables from Swedish CORINE land-cover maps and use species presence-absence data from large-scale surveys to construct a species distribution model (SDM. The aim of the study is to increase the knowledge of the species range expansion pattern by examining how its distribution is affected by landscape composition and structure, and to evaluate SDM performance at two different spatial scales. We found that models including data on a scale of 1 × 1 km were able to explain more of the variation in species distribution than those on the local scale (10 m buffer on each side of surveyed road. The amount of grassland in the landscape, estimated from the area of arable land, pasture and rural settlements, was a good predictor of the presence of the species on both scales. The measurements of landscape structure – linear elements and fragmentation - gave ambivalent results which differed from previous small scaled studies on species dispersal behaviour and occupancy patterns. The models had good predictive ability and showed that areas dominated by agricultural fields and their associated grassland edges have a high probability being colonised by the species. Our study identified important landscape variables that explain the distribution of M. roeselii in Mid-Sweden that may also

Embryo Localization Enhances the Survival of Acidovorax citrulli in Watermelon Seeds.

Science.gov (United States)

Dutta, Bhabesh; Schneider, Raymond W; Robertson, Clark L; Walcott, Ronald R

2016-04-01

Acidovorax citrulli, the causal agent of bacterial fruit blotch (BFB) of cucurbits has been observed to survive for >34 years in stored melon and watermelon seeds. To better understand this remarkable longevity, we investigated the bacterium's tolerance to desiccation and the effect of bacterial localization in different watermelon seed tissues on its survival. We compared the ability of A. citrulli to tolerate desiccation on filter paper discs and on host (watermelon) and nonhost (cabbage, corn and tomato) seeds to two seedborne (Xanthomonas campestris pv. campestris and Pantoea stewartii subsp. stewartii) and one soilborne (Ralstonia solanacearum) plant-pathogenic bacteria. A. citrulli survival on dry filter paper (>12 weeks) was similar to that of X. campestris pv. campestris but longer than P. stewartii subsp. stewartii. Ralstonia solanacearum survived longer than all other bacteria tested. On all seeds tested, A. citrulli and X. campestris pv. campestris populations declined by 5 orders of magnitude after 12 weeks of incubation at 4°C and 50% relative humidity, while R. solanacearum populations declined by 3 orders. P. stewartii subsp. stewartii was not recovered after 12 weeks of incubation. To determine the effect of tissue localization on bacterial survival, watermelon seeds infested with A. citrulli by flower stigma inoculation (resulting in bacterial localization in the embryo/endosperm) or by ovary pericarp inoculations (resulting in bacterial localization under the testa) were treated with peroxyacetic acid or chlorine (Cl2) gas. Following these treatments, a significantly higher reduction in BFB seed-to-seedling transmission was observed for seeds generated by ovary pericarp inoculation (≥89.5%) than for those generated by stigma inoculation (≤76.5%) (Pseed coat, suggesting that tissue localization is important for bacterial survival in seed. This observation was confirmed when P. stewartii subsp. stewartii survived significantly longer in stigma

Female choice for male cuticular hydrocarbon profile in decorated crickets is not based on similarity to their own profile.

Science.gov (United States)

Steiger, S; Capodeanu-Nägler, A; Gershman, S N; Weddle, C B; Rapkin, J; Sakaluk, S K; Hunt, J

2015-12-01

Indirect genetic benefits derived from female mate choice comprise additive (good genes) and nonadditive genetic benefits (genetic compatibility). Although good genes can be revealed by condition-dependent display traits, the mechanism by which compatibility alleles are detected is unclear because evaluation of the genetic similarity of a prospective mate requires the female to assess the genotype of the male and compare it to her own. Cuticular hydrocarbons (CHCs), lipids coating the exoskeleton of most insects, influence female mate choice in a number of species and offer a way for females to assess genetic similarity of prospective mates. Here, we determine whether female mate choice in decorated crickets is based on male CHCs and whether it is influenced by females' own CHC profiles. We used multivariate selection analysis to estimate the strength and form of selection acting on male CHCs through female mate choice, and employed different measures of multivariate dissimilarity to determine whether a female's preference for male CHCs is based on similarity to her own CHC profile. Female mating preferences were significantly influenced by CHC profiles of males. Male CHC attractiveness was not, however, contingent on the CHC profile of the choosing female, as certain male CHC phenotypes were equally attractive to most females, evidenced by significant linear and stabilizing selection gradients. These results suggest that additive genetic benefits, rather than nonadditive genetic benefits, accrue to female mate choice, in support of earlier work showing that CHC expression of males, but not females, is condition dependent. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.

Sorted gene genealogies and species-specific nonsynonymous substitutions point to putative postmating prezygotic isolation genes in Allonemobius crickets

Directory of Open Access Journals (Sweden)

Suegene Noh

2016-02-01

Full Text Available In the Allonemobius socius complex of crickets, reproductive isolation is primarily accomplished via postmating prezygotic barriers. We tested seven protein-coding genes expressed in the male ejaculate for patterns of evolution consistent with a putative role as postmating prezygotic isolation genes. Our recently diverged species generally lacked sequence variation. As a result, ω-based tests were only mildly successful. Some of our genes showed evidence of elevated ω values on the internal branches of gene trees. In a couple of genes, these internal branches coincided with both species branching events of the species tree, between A. fasciatus and the other two species, and between A. socius and A. sp. nov. Tex. In comparison, more successful approaches were those that took advantage of the varying degrees of lineage sorting and allele sharing among our young species. These approaches were particularly powerful within the contact zone. Among the genes we tested we found genes with genealogies that indicated relatively advanced degrees of lineage sorting across both allopatric and contact zone alleles. Within a contact zone between two members of the species complex, only a subset of genes maintained allelic segregation despite evidence of ongoing gene flow in other genes. The overlap in these analyses was arginine kinase (AK and apolipoprotein A-1 binding protein (APBP. These genes represent two of the first examples of sperm maturation, capacitation, and motility proteins with fixed non-synonymous substitutions between species-specific alleles that may lead to postmating prezygotic isolation. Both genes express ejaculate proteins transferred to females during copulation and were previously identified through comparative proteomics. We discuss the potential function of these genes in the context of the specific postmating prezygotic isolation phenotype among our species, namely conspecific sperm precedence and the superior ability of

The effect of spin in swing bowling in cricket: model trajectories for spin alone

Science.gov (United States)

Robinson, Garry; Robinson, Ian

2015-02-01

In ‘swing’ bowling, as employed by fast and fast-medium bowlers in cricket, back-spin along the line of the seam is normally applied in order to keep the seam vertical and to provide stability against ‘wobble’ of the seam. Whilst spin is normally thought of as primarily being the slow bowler's domain, the spin applied by the swing bowler has the side-effect of generating a lift or Magnus force. This force, depending on the orientation of the seam and hence that of the back-spin, can have a side-ways component as well as the expected vertical ‘lift’ component. The effect of the spin itself, in influencing the trajectory of the fast bowler's delivery, is normally not considered, presumably being thought of as negligible. The purpose of this paper is to investigate, using calculated model trajectories, the amount of side-ways movement due to the spin and to see how this predicted movement compares with the total observed side-ways movement. The size of the vertical lift component is also estimated. It is found that, although the spin is an essential part of the successful swing bowler's delivery, the amount of side-ways movement due to the spin itself amounts to a few centimetres or so, and is therefore small, but perhaps not negligible, compared to the total amount of side-ways movement observed. The spin does, however, provide a considerable amount of lift compared to the equivalent delivery bowled without spin, altering the point of pitching by up to 3 m, a very large amount indeed. Thus, for example, bowling a ball with the seam pointing directly down the pitch and not designed to swing side-ways at all, but with the amount of back-spin varied, could provide a very powerful additional weapon in the fast bowler's arsenal. So-called ‘sling bowlers’, who use a very low arm action, can take advantage of spin since effectively they can apply side-spin to the ball, giving rise to a large side-ways movement, ˜ 20{}^\\circ cm or more, which certainly is

Production and certain properties of biopolymers used in drilling

Energy Technology Data Exchange (ETDEWEB)

Dedusenko, G Y; Gvozdyak, R I; Kolodkova, N M; Matyshevskaya, M S; Mayko, I I

1977-01-01

Biopolymers, belonging to modified polysaccharides, obtained by the action of Xanthomonas campestris bacteria on glucose and containing its substances, are used as the main component in clayless polymer muds. As a result of research performed at the laboratory of phytopathogenic bacteria in the IMV AN USSR, the producent strain of polysaccharide has been revealed and the nutritive medium chosen. Results are given of an analysis of the best Soviet samples of biopolymers created in the IMV AN USSR, produced using various strains of Xanthomonas bacteria. Rheological properties of aqueous dispersions of the biopolymer Keltsan are studied. The flow curves are recorded on the Fann rotation viscosimeter. The research performed enables determination that for fermentation can be used the bacteria Xanthomonas campestris, X. begonia, and X. molvacearum; and bacteria belonging to X. Campestris used to produce a sample batch of biopolymer, yielding the greatest amount of polysaccharide. The work results in development of a nutritive medium based on available Soviet materials, promoting formation of polysaccharide.

The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.

Science.gov (United States)

Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S

2006-12-01

The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 281 ... ... nature of cricket injuries in elite South African schoolboy cricketers, Abstract PDF ... children on the East Rand on the usage of nutritional supplements ... hydrotherapy and land-based rehabilitation in soccer players after ...

Little evidence for intralocus sexual conflict over the optimal intake of nutrients for life span and reproduction in the black field cricket Teleogryllus commodus.

Science.gov (United States)

Rapkin, James; Archer, C Ruth; Grant, Charles E; Jensen, Kim; House, Clarissa M; Wilson, Alastair J; Hunt, John

2017-09-01

There is often large divergence in the effects of key nutrients on life span (LS) and reproduction in the sexes, yet nutrient intake is regulated in the same way in males and females given dietary choice. This suggests that the sexes are constrained from feeding to their sex-specific nutritional optima for these traits. Here, we examine the potential for intralocus sexual conflict (IASC) over optimal protein and carbohydrate intake for LS and reproduction to constrain the evolution of sex-specific nutrient regulation in the field cricket, Teleogryllus commodus. We show clear sex differences in the effects of protein and carbohydrate intake on LS and reproduction and strong positive genetic correlations between the sexes for the regulated intake of these nutrients. However, the between-sex additive genetic covariance matrix had very little effect on the predicted evolutionary response of nutrient regulation in the sexes. Thus, IASC appears unlikely to act as an evolutionary constraint on sex-specific nutrient regulation in T. commodus. This finding is supported by clear sexual dimorphism in the regulated intake of these nutrients under dietary choice. However, nutrient regulation did not coincide with the nutritional optima for LS or reproduction in either sex, suggesting that IASC is not completely resolved in T. commodus. © 2017 The Author(s). Evolution published by Wiley Periodicals, Inc. on behalf of The Society for the Study of Evolution.

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 5. Bernoulli Runs Using 'Book Cricket' to Evaluate Cricketers. Anand Ramalingam. General Article Volume 17 Issue 5 May 2012 pp 441-453. Fulltext. Click here to view fulltext PDF. Permanent link:

Resonance journal of science education

Indian Academy of Sciences (India)

Resonance journal of science education. May 2012 Volume 17 Number 5. SERIES ARTICLES. 436 Dawn of Science. The Quest for Power. T Padmanabhan. GENERAL ARTICLES. 441 Bernoulli Runs Using 'Book Cricket' to Evaluate. Cricketers. Anand Ramalingam. 454 Wilhelm Ostwald, the Father of Physical Chemistry.

Biomimetic micromechanical adaptive flow-sensor arrays

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Floris, J.; Dijkstra, Marcel; Lammerink, Theodorus S.J.; Wiegerink, Remco J.

2007-01-01

We report current developments in biomimetic flow-sensors based on flow sensitive mechano-sensors of crickets. Crickets have one form of acoustic sensing evolved in the form of mechanoreceptive sensory hairs. These filiform hairs are highly perceptive to low-frequency sound with energy sensitivities

SAJSM 543.indd

African Journals Online (AJOL)

The youth cricketers sustained more back and trunk injuries, recurrent injuries and ... implement an educational process of injury prevention and management. ... Sport Bureau, Nelson Mandela Metropolitan University, Port Elizabeth, South Africa .... the time of the year when no specific cricket practice or matches took.

Metagenetic analysis of the bacterial communities of edible insects from diverse production cycles at industrial rearing companies.

Science.gov (United States)

Vandeweyer, D; Crauwels, S; Lievens, B; Van Campenhout, L

2017-11-16

Despite the continuing development of new insect-derived food products, microbial research on edible insects and insect-based foods is still very limited. The goal of this study was to increase the knowledge on the microbial quality of edible insects by comparing the bacterial community composition of mealworms (Tenebrio molitor) and crickets (Acheta domesticus and Gryllodes sigillatus) from several production cycles and rearing companies. Remarkable differences in the bacterial community composition were found between different mealworm rearing companies and mealworm production cycles from the same company. In comparison with mealworms, the bacterial community composition of the investigated crickets was more similar among different companies, and was highly similar between both cricket species investigated. Mealworm communities were dominated by Spiroplasma and Erwinia species, while crickets were abundantly colonised by (Para)bacteroides species. With respect to food safety, only a few operational taxonomic units could be associated with potential human pathogens such as Cronobacter or spoilage bacteria such as Pseudomonas. In summary, our results implicate that at least for cricket rearing, production cycles of constant and good quality in terms of bacterial composition can be obtained by different rearing companies. For mealworms however, more variation in terms of microbial quality occurs between companies. Copyright © 2017 Elsevier B.V. All rights reserved.

EXPERIENCE-BASED TYPOLOGY OF SPECTATORS AT AN ...

African Journals Online (AJOL)

martinette kruger

experience. Key words: Market segmentation; Cricket spectators; Cricket Sixes tournament; ... to enjoy various sports as a form of entertainment, to grow tourism, to grow sport participation and ..... e. D is ta n ce. Figure 1. THREE CLUSTER SOLUTION: WARD'S METHOD WITH SQUARED ..... positive word-of-mouth referrals.

2009 USCG Innovation Expo

Science.gov (United States)

2009-11-19

Inspired Building A termite mound can seem eerily like a skyscraper, especially when you consider the mount’s efficient regulation of air flow...cricket that uses its burrow to amplify sound. New Klipsch speakers are created by studying how Egyptian mole crickets amplify sounds Slide # 19 Termite

INCIDENCE AND NATURE OF EPIDEMIOLOGICAL INJURIES TO ...

African Journals Online (AJOL)

ELITE SOUTlI AFRICAN CRICKET. PLAYERS. R A Stretch. Objectives. The study investigated the incidence and nature of injuries sustained by elite cricketers during a season and the possible risk factors associated with these injuries. Methods. Fourteen physiotherapists and three doctors recorded 163 injuries sustained ...

Biomimetic flow sensors for environmental awareness

NARCIS (Netherlands)

Krijnen, Gijsbertus J.M.; Dagamseh, A.M.K.

Crickets possess hairy organs attached to their abdomen, the so-called cerci. These cerci contain highly flow-sensitive mechanosensors that enable the crickets to monitor the flow-field around them and react to specific stimuli form the environment, e.g. air-movements generated by hunting spiders.

Paternity of offspring in multiply-mated, female crickets: the effect of nuptial food gifts and the advantage of mating first

Science.gov (United States)

Calos, J. B.; Sakaluk, S. K.

1998-01-01

The spermatophore transferred by male decorated crickets (Gryllodes sigillatus) includes a large gelatinous mass, the spermatophylax, that is consumed by the female after mating. This nuptial gift preoccupies the female while sperm are discharged from the remaining portion of the spermatophore, the sperm ampulla, into her reproductive tract. There is considerable variation in the mass of the spermatophylax, and about half of all males produce spermatophylaxes that are too small to ensure complete sperm transfer. We tested two hypotheses concerning the maintenance of this variation: (i) males trade-off investment in spermatophylaxes against copulation frequency; and (ii) males synthesize the largest spermatophylaxes of which they are physiologically capable. Males synthesizing large and small food gifts were permitted multiple mating opportunities with the same females, and allozyme markers were used to establish the paternity of offspring. There was a significant advantage to those males that mated first irrespective of gift size. This advantage probably arose, in part, because the sperm of first males would have had exclusive access to females' eggs during the first 24 hours of oviposition, and underscores the benefits of matings with virgin females. The paternity of 'small-gift' males increased with gift mass, but there was no such increase in 'large-gift' males. This difference probably stems from the relationship between gift mass and sperm transfer: most of the gifts of the large-gift males would have been above the threshold needed to achieve complete inseminations, whereas those of small-gift males would have been below the threshold. Within mating-order positions, there was no significant difference in the paternity of large-gift and small-gift males, a result seemingly consistent with the 'trade-off' hypothesis. However, there was no correlation between spermatophylax mass and male mating frequency, so that the mechanism by which small-gift males offset

Incidence and nature of epidemiological injuries to elite South ...

African Journals Online (AJOL)

Objectives. The study investigated the incidence and nature of injuries sustained by elite cricketers during a season and the possible risk factors associated with these injuries. Methods. Fourteen physiotherapists and three doctors recorded 163 injuries sustained by 88 cricketers. Results. Bowling accounted for 40.5% of the ...

Isolation and structure elucidation of neuropeptides of the AKH/RPCH family in long-horned grasshoppers (Ensifera).

Science.gov (United States)

Gäde, G

1992-11-01

An identical neuropeptide was isolated by reversed-phase high-performance liquid chromatography from the corpora cardiaca of the king cricket, Libanasidus vittatus, and the two armoured ground crickets, Heterodes namaqua and Acanthoproctus cervinus. The crude gland extracts had adipokinetic activity in migratory locusts, hypertrehalosaemic activity in American cockroaches and a slight hypertrehalosaemic, but no adipokinetic, effect in armoured ground crickets. The primary structure of this neuropeptide was determined by pulsed-liquid phase sequencing employing Edman chemistry after enzymically deblocking the N-terminal 5-oxopyrrolidine-2-carboxylic acid residue. The C-terminus was also blocked, as indicated by the lack of digestion by carboxypeptidase A. The peptide was assigned the structure [symbol: see text]Glu-Leu-Asn-Phe-Ser-Thr-Gly-TrpNH2, previously designated Scg-AKH-II. The corpora cardiaca of the cricket Gryllodes sigillatus contained a neuropeptide which differed in retention time from the one isolated from the king and armoured ground crickets. The structure was assigned as [symbol: see text]Glu-Val-Asn-Phe-Ser-Thr-Gly-TrpNH2, previously designated Grb-AKH. This octapeptide caused hyperlipaemia in its donor species. The presence of the same peptide, Scg-AKH-II, in the two primitive infraorders of Ensifera, and the different peptide, Grb-AKH, in the most advanced infraorder of Ensifera, supports the evolutionary trends assigned formerly from morphological and physiological evidence.

Author Details

African Journals Online (AJOL)

Mckinon, W. Vol 25, No 3 (2013) - Articles Side-to-side asymmetry in absolute and relative muscle thickness of the lateral abdominal wall in cricket pace bowlers. Abstract PDF · Vol 27, No 3 (2015) - Articles Cricket pace bowling: The trade-off between optimising knee angle for performance advantages v. injury prevention

Performing “responsibility” and “conspiracy” through press ...

African Journals Online (AJOL)

In 2003, the Australian cricketer Shane Warne was suspected and convicted of doping. The purpose of this article was to understand how he tried to resolve the problem/dilemma of being suspected and convicted of doping through three press statements, which he delivered to the media during the 2003 Cricket World Cup ...