International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin
2004-01-01
Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA
9 CFR 113.40 - Dog safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...
2010-07-01
... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...
27 CFR 40.113 - Change in location to another region.
2010-04-01
... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...
40 CFR 600.113-78 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...
40 CFR 600.113-88 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...
40 CFR 600.113-93 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...
40 CFR 63.113 - Process vent provisions-reference control technology.
2010-07-01
... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
Directory of Open Access Journals (Sweden)
Martin H. Johnson
2015-06-01
Full Text Available The role of Jean Purdy in the work leading to the birth of Louise Brown is assessed. We report that Purdy: (i recorded and organized most of the data systematically; (ii probably spent longer working in Oldham than did Edwards; (iii whilst there, was primarily responsible for organizing laboratory supplies, including media preparation and testing; (iv was involved in patient care; and (v was a major source of support to Edwards. We find that Purdy, despite her nursing qualification, was not involved in laparoscopic egg retrieval and clinical aspects, but was focused on basic research activities. The evidence on who was present at embryo transfers is less clear, but suggests that Edwards was present for all, whereas Purdy may have been absent for some. Overall, we conclude that Purdy’s role was a highly significant and under-appreciated element in the achievement of IVF in Oldham.
Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark
DEFF Research Database (Denmark)
Hinsby, K.; Hojberg, A.L.; Engesgaard, P.
2007-01-01
Vertical profiles of the chlorofluorocarbons CFC-11, CFC-12, and CFC-113 penetrating aerobic and anaerobic parts of a shallow sandy aquifer show that the CFC gases are degraded in the Rabis Creek, Denmark...
The simultaneous mass and energy evaporation (SM2E) model.
Choudhary, Rehan; Klauda, Jeffery B
2016-01-01
In this article, the Simultaneous Mass and Energy Evaporation (SM2E) model is presented. The SM2E model is based on theoretical models for mass and energy transfer. The theoretical models systematically under or over predicted at various flow conditions: laminar, transition, and turbulent. These models were harmonized with experimental measurements to eliminate systematic under or over predictions; a total of 113 measured evaporation rates were used. The SM2E model can be used to estimate evaporation rates for pure liquids as well as liquid mixtures at laminar, transition, and turbulent flow conditions. However, due to limited availability of evaporation data, the model has so far only been tested against data for pure liquids and binary mixtures. The model can take evaporative cooling into account and when the temperature of the evaporating liquid or liquid mixture is known (e.g., isothermal evaporation), the SM2E model reduces to a mass transfer-only model.
checkCIF/PLATON report Datablock: Sm
Indian Academy of Sciences (India)
Moiety formula C59 H45 N2 O6 Sm. Sm (C14 H12 N2) ... 4.0 Ratio. PLAT234_ALERT_4_C Large Hirshfeld Difference O4 -- C24 .. 0.16 Ang. ... outliers and unusual parameters, but every test has its limitations and alerts that are not important.
West Foster Creek 2007 Follow-up Habitat Evaluation Procedures (HEP) Report.
Energy Technology Data Exchange (ETDEWEB)
Ashley, Paul R.
2008-02-01
A follow-up habitat evaluation procedures (HEP) analysis was conducted on the West Foster Creek (Smith acquisition) wildlife mitigation site in May 2007 to determine the number of additional habitat units to credit Bonneville Power Administration (BPA) for providing funds to enhance and maintain the project site as partial mitigation for habitat losses associated with construction of Grand Coulee Dam. The West Foster Creek 2007 follow-up HEP survey generated 2,981.96 habitat units (HU) or 1.51 HUs per acre for a 34% increase (+751.34 HUs) above baseline HU credit (the 1999 baseline HEP survey generated 2,230.62 habitat units or 1.13 HUs per acre). The 2007 follow-up HEP analysis yielded 1,380.26 sharp-tailed grouse (Tympanuchus phasianellus) habitat units, 879.40 mule deer (Odocoileus hemionus) HUs, and 722.29 western meadowlark (Sturnella neglecta) habitat units. Mule deer and sharp-tailed grouse habitat units increased by 346.42 HUs and 470.62 HUs respectively over baseline (1999) survey results due largely to cessation of livestock grazing and subsequent passive restoration. In contrast, the western meadowlark generated slightly fewer habitat units in 2007 (-67.31) than in 1999, because of increased shrub cover, which lowers habitat suitability for that species.
21 CFR 113.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-01-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure–function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein–RNA and protein–protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. PMID:27417296
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-09-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure-function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein-RNA and protein-protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. © 2016 Schwer et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.
40 CFR 745.113 - Certification and acknowledgment of disclosure.
2010-07-01
... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...
Preparation and quality control of {sup 153}Sm radiopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
Swasono, R Tamat; Widyastuti, W; Purwadi, B; Laksmi, I [Radioisotope Production Center - BATAN, Jakarta (Indonesia)
1998-10-01
The paper summarizes the preparation and quality control of {sup 153}Sm-EDTMP and three {sup 153}Sm-radiosynovectomy agents. Natural and enriched Sm{sub 2}O{sub 3} (98.7% {sup 152}Sm) irradiated in RSG-GAS 30 MW reactor yielded pure and high specific activity {sup 153}Sm. Labeling of EDTMP with {sup 153}Sm was carried out by mixing {sup 153}SmCl{sub 3} solution of pH 4.0 to an EDTMP solution at room temperature then pH adjustment to 8. The {sup 153}Sm-EDTMP complex was separated from the free {sup 153}Sm{sup +3} on a Chelex 100 column. Radiochemical purity was determined by thin layer chromatography using Cellulose sheets and pyridine: ethanol: water (1: 2: 4) mixture as solvent. The {sup 153}Sm-EDTMP has been shown to be stable for two weeks. Three particulate preparations of {sup 153}Sm used for the irradiation of chronic synovitis have been studied. They are hydroxyapatite particles, human serum albumin microspheres and ferric hydroxide macroaggregates. The {sup 153}Sm-ferric hydroxide macroaggregates were prepared in a single step by coprecipitation of {sup 153}Sm in the formation of Fe(OH){sub 3}. Preparation of {sup 153}Sm-labelled hydroxyapatite particles and {sup 153}Sm-labelled albumin microspheres were carried out by {sup 153}Sm labelling of previously prepared particles. Radiolabelling efficiency were greater than 95% for hydroxyapatite particles and macroaggregates and was lower than 20% for albumin microspheres. The particle sizes were inspected using an optical microscope with a haemocytometer and micrometric ocular. (author)
Wilson, Colin J. N.; Stelten, Mark E.; Lowenstern, Jacob B.
2018-06-01
The youngest major caldera-forming event at Yellowstone was the 630-ka eruption of the Lava Creek Tuff. The tuff as mapped consists of two major ignimbrite packages (members A and B), linked to widespread coeval fall deposits and formation of the Yellowstone Caldera. Subsequent activity included emplacement of numerous rhyolite flows and domes, and development of two structurally resurgent domes (Mallard Lake and Sour Creek) that accommodate strain due to continual uplift/subsidence cycles. Uplifted lithologies previously mapped on and adjacent to Sour Creek dome were thought to include the 2.08-Ma Huckleberry Ridge Tuff, cropping out beneath Lava Creek Tuff members A and B. Mapped outcrops of this Huckleberry Ridge Tuff material were sampled as welded ignimbrite (sample YR345) on Sour Creek dome, and at nearby Bog Creek as welded ignimbrite (YR311) underlain by an indurated lithic lag breccia containing blocks of another welded ignimbrite (YR324). Zircon near-rim U-Pb analyses from these samples yield weighted mean ages of 661 ± 13 ka (YR345: 95% confidence), 655 ± 11 ka (YR311), and 664 ± 15 ka (YR324) (combined weighted mean of 658.8 ± 6.6 ka). We also studied two samples of ignimbrite previously mapped as Huckleberry Ridge Tuff on the northeastern perimeter of the Yellowstone Caldera, 12 km ENE of Sour Creek dome. Sanidines from these samples yield 40Ar/39Ar age estimates of 634.5 ± 6.8 ka (8YC-358) and 630.9 ± 4.1 ka (8YC-359). These age data show that all these units represent previously unrecognized parts of the Lava Creek Tuff and do not have any relationship to the Huckleberry Ridge Tuff. Our observations and data imply that the Lava Creek eruption was more complex than is currently assumed, incorporating two tuff units additional to those currently mapped, and which themselves are separated by a time break sufficient for cooling and some reworking. The presence of a lag breccia suggests that a source vent lay nearby (Caldera boundary in this area
Wilson, Colin J. N.; Stelten, Mark; Lowenstern, Jacob B.
2018-01-01
The youngest major caldera-forming event at Yellowstone was the ~ 630-ka eruption of the Lava Creek Tuff. The tuff as mapped consists of two major ignimbrite packages (members A and B), linked to widespread coeval fall deposits and formation of the Yellowstone Caldera. Subsequent activity included emplacement of numerous rhyolite flows and domes, and development of two structurally resurgent domes (Mallard Lake and Sour Creek) that accommodate strain due to continual uplift/subsidence cycles. Uplifted lithologies previously mapped on and adjacent to Sour Creek dome were thought to include the ~ 2.08-Ma Huckleberry Ridge Tuff, cropping out beneath Lava Creek Tuff members A and B. Mapped outcrops of this Huckleberry Ridge Tuff material were sampled as welded ignimbrite (sample YR345) on Sour Creek dome, and at nearby Bog Creek as welded ignimbrite (YR311) underlain by an indurated lithic lag breccia containing blocks of another welded ignimbrite (YR324). Zircon near-rim U–Pb analyses from these samples yield weighted mean ages of 661 ± 13 ka (YR345: 95% confidence), 655 ± 11 ka (YR311), and 664 ± 15 ka (YR324) (combined weighted mean of 658.8 ± 6.6 ka). We also studied two samples of ignimbrite previously mapped as Huckleberry Ridge Tuff on the northeastern perimeter of the Yellowstone Caldera, ~ 12 km ENE of Sour Creek dome. Sanidines from these samples yield 40Ar/39Ar age estimates of 634.5 ± 6.8 ka (8YC-358) and 630.9 ± 4.1 ka (8YC-359). These age data show that all these units represent previously unrecognized parts of the Lava Creek Tuff and do not have any relationship to the Huckleberry Ridge Tuff. Our observations and data imply that the Lava Creek eruption was more complex than is currently assumed, incorporating two tuff units additional to those currently mapped, and which themselves are separated by a time break sufficient for cooling and some reworking. The presence of a lag breccia suggests that a source
Interaction mode between methylene blue-Sm(III) complex and ...
African Journals Online (AJOL)
Spectroscopic and viscosity methods were applied to investigate the interaction between methylene blue (MB)-Sm(III) complex and herring sperm DNA by using acridine orange as a spectral probe in Tris-HCl buffer (pH 7.40). By means of molar ratio method, the binding ratios between MB-Sm(III)and DNA were determined ...
Radiation damage in SmS, SmSsub(1-x)Psub(x) and SmB6
International Nuclear Information System (INIS)
Morillo, J.; Bordier, G.; de Novion, C.H.; Senateur, J.P.; Jun, J.
1984-08-01
Large conductivity increases under 21 K electron or neutron irradiations are observed in SmS and SmSsub(1-x)Psub(x). It is shown that they are related to Sm defects. A possible mechanism is 4f electron delocalization around radiation defects. In SmB 6 , the low temperature resistivity increase desappears under 21 K irradiation. The thermal stability of the defects is also investigated up to room temperature
Synthesis and DNA interaction of a Sm(III) complex of a Schiff base ...
African Journals Online (AJOL)
The interaction between the Sm(III) complex of an ionic Schiff base [HL]-, derived from vanillin and L-tryptophan, and herring sperm DNA at physiological pH (7.40) has been studied by UV-Vis absorption, fluorescence and viscosity methods. The binding ratios nSm(III) : nK[HL] = 1:1 and nSm(III)L: nDNA =5:1 were confirmed ...
Solid-solid synthesis and structural phase transition process of SmF3
Yan, Qi-Cao; Guo, Xing-Min
2018-04-01
Mazes of contradictory conclusions have been obtained by previous researches about structural phase transition process of SmF3. In this paper, the single crystals of SmF3 (hexagonal and orthorhombic) were prepared by solid-solid synthesis, which have shown gradual changes in crystal growth modes with the increase temperature and holding time. Furthermore, we propose the phase transition process of in SmF3. Hexagonal symmetry of SmF3 (space group Pnma) was prepared firstly by heating Sm2O3 and NH4HF2 over 40 min at 270 °C. And then orthorhombic symmetry of SmF3 (space group P63mc) was obtained by heating hexagonal symmetry over 10 h at 650 °C. The reaction of SmF3 (hexagonal) = SmF3 (orthorhombic) is extremely sluggish at a low temperature (less than 650 °C), which was seen as a Mixed Grown Region.
Surface coating and magnetic properties of Sm2Fe17Nx materials
International Nuclear Information System (INIS)
Noguchi, K.; Machida, K.; Nishimura, M.; Adachi, G.
1998-01-01
Surface coating for finely ground Sm 2 Fe 17 N x (x=-3) powders (diameter 2 Fe 17 N x and (Zn,In)/Cu/Sm 2 Fe 17 N x , showed good oxidation-resistivity and thermal stability compared with the samples prepared without the Cu metal pre-coating, Zn/Sm 2 Fe 17 N x . The epoxy resin- or In metal-bonded magnets produced from the above coated powders, Zn/Cu/Sm 2 Fe 17 N x and (Zn,In)/Cu/Sm 2 Fe 17 N x , under warm molding conditions provided a flux loss of around -15% after standing in air at 120 C for 1000 h, but 30-40% for the conventional injection-type resin-bonded magnets prepared from Nd-Fe-B powders. (orig.)
The high squareness Sm-Co magnet having Hcb=10.6 kOe at 150°C
Directory of Open Access Journals (Sweden)
Hiroaki Machida
2017-05-01
Full Text Available The relationship between magnetic properties and magnetic domain structures of Sm(Fe, Cu, Zr, Co7.5 magnet was investigated. The developed Sm-Co magnet, which is conducted homogenization heat treatment at ingot state, high temperature short time sintering and long time solid solution heat treatment showed the maximum energy product, [BH]m of 34.0 MGOe and the coercivity, Hcb of 11.3 kOe at 20°C respectively. Moreover, Hcb of 10.6 kOe at 150°C was achieved. Heat treated ingot has clear 1-7 phase in mother phase from optical microscope observation. Kerr effect microscope with magnetic field applied was used to investigate magnetic domain structure. Reverse magnetic domains were generated evenly but generation of them from inside grain were not observed. Cell structure was observed by scanning transmission electron microscope and composition analysis was conducted by energy dispersive X-ray spectroscopy. Cell size was approximately 150 ∼ 300 nm, Fe and Cu were clearly separated and concentrated to 2-17 phase and 1-5 phase respectively. Moreover, Cu concentration went up to 40 at% in 1-5 phase. That means the gap of domain wall energy between 1-5 phase and 2-17 phase was increased due to microstructure control by conducting heat treatment for compositional homogeneity.
Evaluation of Radioisotope Production Process of 153Sm and 153Sm-EDTMP Radiopharmaceuticals
International Nuclear Information System (INIS)
Kadarisman; Sri Hastini; Yayan Tahyan; Abidin; Dadang Hafid; Enny Lestari
2007-01-01
Experiments on the process of 153 Sm radioisotope and labeling of 153 Sm-EDTMP radiopharmaceuticals were carried out. This experiments included preparation of Sm 2 O 3 target, dissolution of post irradiation, determination of radioactivity concentration of 153 Sm radioisotope, radionuclide purity, EDTMP labeling, determination of radiochemical purity and pH. In these experiments the total radioactivity 153 Sm product is round about 2845.83 mCi to 36963.31 mCi, or with the radioactivity concentration between 474 mCi/ml to 6160.55 mCi/ml in the SmCl 3 solution form, each its volume is 6.0 ml, and the samarium content is 5.76 mg/ml, and the radionuclide purity of 153 Sm is 100 %. All of the 153 Sm- EDTMP radiopharmaceuticals product are fulfilled requirements the radioactivity concentration, Sm content, radiochemical purity and pH. The radioactivity concentration of 153 Sm-EDTMP radiopharmaceuticals is 37.50 mCi/ml (minimum) to 283.50 mCi/ml (highest). The pH 7.5 were 8 products, and the rest are pH 8.5. Radiochemical purity of 153 Sm-EDTMP are round about 90.00 % to 99.44 %. (author)
Wiley, J.B.
1994-01-01
The U.S. Geological Survey, in cooperation with the National Park Service, studied the frequency and magnitude of flooding near the mouths of five tributaries to the New River in the New River Gorge National River. The 100-year peak discharge at each tributary was determined from regional frequency equations. The 100-year discharge at Wolf Creek, Craig Branch, Manns Creek, Dunloup Creek, and Mill Creek was 3,400 cubic feet per second, 640 cubic feet per second, 8,200 cubic feet per second, 7,100 cubic feet per second, and 9,400 cubic feet per second, respectively. Flood elevations for each tributary were determined by application of a steady-state, one-dimensional flow model. Manning's roughness coefficients for the stream channels ranged from 0.040 to 0.100. Bridges that would be unable to contain the 100-year flood within the bridge opening included: the State Highway 82 bridge on Wolf Creek, the second Fayette County Highway 25 bridge upstream from the confluence with New River on Dunloup Creek, and an abandoned log bridge on Mill Creek.
Distinguishing a SM-like MSSM Higgs boson from SM Higgs boson ...
Indian Academy of Sciences (India)
We explore the possibility of distinguishing the SM-like MSSM Higgs boson from the SM Higgs boson via Higgs boson pair production at future muon collider. We study the behavior of the production cross-section in SM and MSSM with Higgs boson mass for various MSSM parameters tan and A. We observe that at fixed ...
Energy Technology Data Exchange (ETDEWEB)
Kinoshita, N. [Tandem Accelerator Complex, Research Facility Center for Science and Technology, University of Tsukuba (Japan); Paul, M., E-mail: paul@vms.huji.ac.il [Racah Institute of Physics, Hebrew University, Jerusalem 91904 (Israel); Alcorta, M. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Bowers, M.; Collon, P. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Deibel, C.M. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 46624 (United States); DiGiovine, B. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Goriely, S. [Universite Libre de Bruxelles, CP-226, Brussels 1050 (Belgium); Greene, J.P.; Henderson, D.J.; Jiang, C.L. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Kashiv, Y. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); Kay, B.P.; Lee, H.Y.; Marley, S.T. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Nakanishi, T. [Faculty of Chemistry, Institute of Science and Engineering, Kanazawa University (Japan); Pardo, R.C.; Patel, N.; Rehm, K.E. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Robertson, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556-5670 (United States); and others
2013-01-15
The extinct p-process nuclide {sup 146}Sm (t{sub 1/2} = 103 {+-} 5 Myr) is known to have been present in the Early-Solar System and has been proposed as an astrophysical chronometer. {sup 146}Sm is also intensely used to date meteorite and planetary differentiation processes, enhancing the importance of an accurate knowledge of the {sup 146}Sm half-life. We are engaged in a new determination of the {sup 146}Sm half-life in which the {sup 146}Sm/{sup 147}Sm atom ratio is determined by accelerator mass spectrometry at the ATLAS facility of Argonne National Laboratory. In order to reduce systematic errors in the AMS determination of the {sup 146}Sm/{sup 147}Sm ratios (in the range of 10{sup -7}-10{sup -9}), {sup 146}Sm and {sup 147}Sm ions were alternately counted in the same detector in the focal plane of a gas-filled magnet, respectively in continuous-wave and attenuated mode. Quantitative attenuation is obtained with the 12 MHz pulsed and ns-bunched ATLAS beam by chopping beam pulses with an RF sweeper in a ratio (digitally determined) down to 1:10{sup 6}. The experiments and preliminary results are discussed.
Vegetation - Pine Creek WA and Fitzhugh Creek WA [ds484
California Natural Resource Agency — This fine-scale vegetation classification and map of the Pine Creek and Fitzhugh Creek Wildlife Areas, Modoc County, California was created following FGDC and...
International Nuclear Information System (INIS)
Rikard, M.
1991-11-01
The Congaree Swamp National Monument is one of the last significant near virgin tracts of bottom land hardwood forests in the Southeast United States. The study documents a water quality monitoring program on Myers Creek, Reeves Creek and Toms Creek. Basic water quality parameters were analyzed. High levels of aluminum and iron were found, and recommendations were made for further monitoring
Dancer, Peter L; Kleinplatz, Peggy J; Moser, Charles
2006-01-01
This study describes the nature of 24/7 SM slavery as practiced within the SM (sadomasochistic) community. These SM participants, who attempt to live full-time in owner-slave roles, represent a small proportion of those with SM interests. SM slaves have not been studied systematically to determine if and how they differ from other SM practitioners. An online questionnaire was used to obtain responses from individuals who self-identified as slaves. A total of 146 respondents participated, 53% female and 47% male, ranging in age from 18 to 72. We explored the depth of their relationships, how well they approximated "slavery," and how their relationships were structured to maintain distinct roles. Data showed that in long-term SM slave relationships, a power differential exists which extends beyond time-limited SM or sexual interactions. Owners and slaves often use common, daily life experiences or situations, such as the completion of household chores, money management, and morning or evening routines, to distinguish and maintain their respective roles. In addition, contrary to the perception of total submission, results revealed that slaves exercise free will when it is in their best interests to do so. These relationships were long-lasting and satisfying to the respondents.
Water‐Data Report 413723083123801 Crane Creek at Ottawa NWR-2009
Department of the Interior — Water levels and water quality parameters recorded on Crane Creek in 2009. LOCATION: Lat. 41°37'21.347"N, long 83°12'40.758"W, near Oak Harbor, OH. Ottawa County, OH...
Water‐Data Report 413723083123801 Crane Creek at Ottawa NWR-2010
Department of the Interior — Water levels and water quality parameters recorded on Crane Creek in 2010. LOCATION: Lat. 41°37'21.347"N, long 83°12'40.758"W, near Oak Harbor, OH. Ottawa County, OH...
Water‐Data Report 413723083123801 Crane Creek at Ottawa NWR-2011
Department of the Interior — Water levels and water quality parameters recorded on Crane Creek in 2011. LOCATION: Lat. 41°37'21.347"N, long 83°12'40.758"W, near Oak Harbor, OH. Ottawa County, OH...
Distinguishing a SM-like MSSM Higgs boson from SM Higgs boson at muon collider
International Nuclear Information System (INIS)
Singhal, Jai Kumar; Singh, Sardar; Nagawat, Ashok K.
2007-01-01
We explore the possibility of distinguishing the SM-like MSSM Higgs boson from the SM Higgs boson via Higgs boson pair production at future muon collider. We study the behavior of the production cross-section in SM and MSSM with Higgs boson mass for various MSSM parameters tanβ and m A . We observe that at fixed CM energy, in the SM, the total cross-section increases with the increase in Higgs boson mass whereas this trend is reversed for the MSSM. The changes that occur for the MSSM in comparison to the SM predictions are quantified in terms of the relative percentage deviation in cross-section. The observed deviations in cross-section for different choices of Higgs boson masses suggest that the measurements of the cross-section could possibly distinguish the SM-like MSSM Higgs boson from the SM Higgs boson. (author)
Calorimetric investigation on the Pb-Sm and Sn-Sm alloys
International Nuclear Information System (INIS)
Berrada, A.-E.-A.; Claire, Y.; Chafik el Idrissi, M.; Castanet, R.
1997-01-01
The integral enthalpy of formation of the Sm-Pb and Sm-Sn melts at 1203 K, h f , was determined by direct reaction calorimetry (drop method) in the Pb and Sn rich sides with the help of a high-temperature Tian-Calvet calorimeter. The results can be fitted respectively with reference to the mole fraction of samarium, x, as follows: f /kJmol -1 =x(1-x)(-109.8 -372.0.7x) with 0 Sm f /kJmol -1 =x(1- x)(-277.0+105.4x) with 0 Sm -1 respectively. Such negative values suggest the existence of a strong short-range order in the liquid state. The stoichiometry and the thermal stability of these associations needs additional thermodynamic determinations concerning mainly the free enthalpy of formation. It will be determined by Knudsen-effusion combined with mass spetrometry in a further work. (orig.)
Quality control of the 113Sn-113mIn generator
International Nuclear Information System (INIS)
Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.
1989-01-01
Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia
Evaluation of the exothermicity of the chemi-ionization reaction Sm + O → SmO+ + e−
International Nuclear Information System (INIS)
Cox, Richard M; Kim, JungSoo; Armentrout, P. B.; Bartlett, Joshua; VanGundy, Robert A.; Heaven, Michael C.; Ard, Shaun G.; Shuman, Nicholas S.; Viggiano, Albert A.; Melko, Joshua J.
2015-01-01
The exothermicity of the chemi-ionization reaction Sm + O → SmO + + e − has been re-evaluated through the combination of several experimental methods. The thermal reactivity (300–650 K) of Sm + and SmO + with a range of species measured using a selected ion flow tube-mass spectrometer apparatus is reported and provides limits for the bond strength of SmO + , 5.661 eV ≤ D 0 (Sm + -O) ≤ 6.500 eV. A more precise value is measured to be 5.72 5 ± 0.07 eV, bracketed by the observed reactivity of Sm + and SmO + with several species using a guided ion beam tandem mass spectrometer (GIBMS). Combined with the established Sm ionization energy (IE), this value indicates an exothermicity of the title reaction of 0.08 ± 0.07 eV, ∼0.2 eV smaller than previous determinations. In addition, the ionization energy of SmO has been measured by resonantly enhanced two-photon ionization and pulsed-field ionization zero kinetic energy photoelectron spectroscopy to be 5.7427 ± 0.0006 eV, significantly higher than the literature value. Combined with literature bond energies of SmO, this value indicates an exothermicity of the title reaction of 0.14 ± 0.17 eV, independent from and in agreement with the GIBMS result presented here. The evaluated thermochemistry also suggests that D 0 (SmO) = 5.83 ± 0.07 eV, consistent with but more precise than the literature values. Implications of these results for interpretation of chemical release experiments in the thermosphere are discussed
Nagel, A.P.; Vercouteren, W.J.J.C.; Hoek, van der N.; Lohman, T.A.M.; Vermeulen, N.
1996-01-01
Kernbegrippen die bij de discussie van strategisch management (SM) aan de orde komen, zijn productinnovatie op ondernemingsniveau (oftewel strategische productinnovatie, SPI) en technologiestrategie. In dit artikel wordt een raamwerk van SM geintroduceerd. Daartoe worden de verschillende fasen van
Flood-inundation maps for Indian Creek and Tomahawk Creek, Johnson County, Kansas, 2014
Peters, Arin J.; Studley, Seth E.
2016-01-25
Digital flood-inundation maps for a 6.4-mile upper reach of Indian Creek from College Boulevard to the confluence with Tomahawk Creek, a 3.9-mile reach of Tomahawk Creek from 127th Street to the confluence with Indian Creek, and a 1.9-mile lower reach of Indian Creek from the confluence with Tomahawk Creek to just beyond the Kansas/Missouri border at State Line Road in Johnson County, Kansas, were created by the U.S. Geological Survey in cooperation with the city of Overland Park, Kansas. The flood-inundation maps, which can be accessed through the U.S. Geological Survey Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the U.S. Geological Survey streamgages on Indian Creek at Overland Park, Kansas; Indian Creek at State Line Road, Leawood, Kansas; and Tomahawk Creek near Overland Park, Kansas. Near real time stages at these streamgages may be obtained on the Web from the U.S. Geological Survey National Water Information System at http://waterdata.usgs.gov/nwis or the National Weather Service Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at these sites.Flood profiles were computed for the stream reaches by means of a one-dimensional step-backwater model. The model was calibrated for each reach by using the most current stage-discharge relations at the streamgages. The hydraulic models were then used to determine 15 water-surface profiles for Indian Creek at Overland Park, Kansas; 17 water-surface profiles for Indian Creek at State Line Road, Leawood, Kansas; and 14 water-surface profiles for Tomahawk Creek near Overland Park, Kansas, for flood stages at 1-foot intervals referenced to the streamgage datum and ranging from bankfull to the next interval above the 0.2-percent annual exceedance probability flood level (500-year recurrence interval). The
Schwenninger, Susanne Miescher; von Ah, Ueli; Niederer, Brigitte; Teuber, Michael; Meile, Leo
2005-01-01
Lactobacilli isolated from different food and feed samples such as raw milk, cheese, yoghurt, olives, sour dough, as well as corn and grass silage, were screened for their antifungal activities. Out of 1,424 isolates tested, 82 were shown to be inhibitory to different yeasts (Candida spp. and Zygosaccharomyces bailii) and a Penicillium sp., which were previously isolated from spoiled yoghurt and fruits. Carbohydrate fermentation patterns suggested that a substantial portion, 25%, belonged to the Lactobacillus casei group, including L. casei, L. paracasei, and L. rhamnosus. The isolates SM20 (DSM14514), SM29 (DSM14515), and SM63 (DSM14516) were classified by PCR using species-specific primers to target the corresponding type strains (L. casei, L. paracasei, and L. rhamnosus) as controls. Further molecular typing methods such as randomly amplified polymorphic DNA, pulsed-field gel electrophoresis, and sequencing analysis of the 16S rRNA gene allowed classifying strains SM20, SM29, and SM63 as L. paracasei subsp. paracasei in accordance with the new reclassification of the L. casei group proposed by Collins et al.
Coercivity Recovery Effect of Sm-Fe-Cu-Al Alloy on Sm2Fe17N3 Magnet
Otogawa, Kohei; Asahi, Toru; Jinno, Miho; Yamaguchi, Wataru; Takagi, Kenta; Kwon, Hansang
2018-03-01
The potential of a Sm-Fe-Cu-Al binder for improvement of the magnetic properties of Sm2Fe17N3 was examined. Transmission electron microscope (TEM) observation of a Sm-Fe-Cu-Al alloy-bonded Sm2Fe17N3 magnet which showed high coercivity revealed that the Sm-Fe-Cu-Al alloy had an effect of removing the surface oxide layer of the Sm2 Fe17N3 grains. However, the Sm-Fe-Cu-Al binder was contaminated by carbon and nitrogen, which originated from the organic solvent used as the milling medium during pulverization. To prevent carbon and nitrogen contamination, the Sm-Fe- Cu-Al alloy was added directly on the surface of the Sm2Fe17N3 grains by sputtering. Comparing the recovered coercivity per unit amount of the added binder the uncontaminated binder-coated sample had a higher coercivity recovery effect than the milled binder-added sample. These results suggested that sufficient addition of the contamination-free Sm-Fe-Cu-Al binder has the possibility to reduce the amount of binder necessary to produce a high coercive Sm2Fe17N3 magnet.
International Nuclear Information System (INIS)
Bowers, J.A.; Kretchmer, D.W.; Chimney, M.J.
1992-04-01
The Savannah River Site (SRS) encompasses 300 sq mi of the Atlantic Coastal Plain in west-central South Carolina. The Savannah River forms the western boundary of the site. Five major tributaries of the Savannah River -- upper Three Runs Creek, Four Mile Creek, Pen Branch, Steel Creek, and Lower Three Runs Creek -- drain the site. All but Upper Three Runs Creek receive, or in the past received, thermal effluents from nuclear production reactors. In 1985, L Lake, a 400-hectare cooling reservoir, was built on the upper reaches of Steel Creek to receive effluent from the restart of L-Reactor, and protect the lower reaches from thermal impacts. The Steel Creek Biological Monitoring Program was designed to meet envirorunental regulatory requirements associated with the restart of L-Reactor and complements the Biological Monitoring Program for L Lake. This extensive program was implemented to address portions of Section 316(a) of the Clean Water Act. The Department of Energy (DOE) must demonstrate that the operation of L-Reactor will not significantly alter the established aquatic ecosystems
2010-07-13
... TENNESSEE VALLEY AUTHORITY Northeastern Tributary Reservoirs Land Management Plan, Beaver Creek...-managed public land on Beaver Creek, Clear Creek, Boone, Fort Patrick Henry, South Holston, Watauga, and... Proposed Land Use Alternative) identified in the final environmental impact statement (FEIS). Under the...
2013-10-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 3730-005] Salmon Creek Hydroelectric Company, Salmon Creek Hydroelectric Company, LLC; Notice of Transfer of Exemption 1. By letter filed September 23, 2013, Salmon Creek Hydroelectric Company informed the Commission that they have...
Big Bayou Creek and Little Bayou Creek Watershed Monitoring Program
Energy Technology Data Exchange (ETDEWEB)
Kszos, L.A.; Peterson, M.J.; Ryon; Smith, J.G.
1999-03-01
Biological monitoring of Little Bayou and Big Bayou creeks, which border the Paducah Site, has been conducted since 1987. Biological monitoring was conducted by University of Kentucky from 1987 to 1991 and by staff of the Environmental Sciences Division (ESD) at Oak Ridge National Laboratory (ORNL) from 1991 through March 1999. In March 1998, renewed Kentucky Pollutant Discharge Elimination System (KPDES) permits were issued to the US Department of Energy (DOE) and US Enrichment Corporation. The renewed DOE permit requires that a watershed monitoring program be developed for the Paducah Site within 90 days of the effective date of the renewed permit. This plan outlines the sampling and analysis that will be conducted for the watershed monitoring program. The objectives of the watershed monitoring are to (1) determine whether discharges from the Paducah Site and the Solid Waste Management Units (SWMUs) associated with the Paducah Site are adversely affecting instream fauna, (2) assess the ecological health of Little Bayou and Big Bayou creeks, (3) assess the degree to which abatement actions ecologically benefit Big Bayou Creek and Little Bayou Creek, (4) provide guidance for remediation, (5) provide an evaluation of changes in potential human health concerns, and (6) provide data which could be used to assess the impact of inadvertent spills or fish kill. According to the cleanup will result in these watersheds [Big Bayou and Little Bayou creeks] achieving compliance with the applicable water quality criteria.
Temperature dependence of spin and orbital magnetic moments of Sm 4f electrons in (Sm, Gd)Al2
International Nuclear Information System (INIS)
Qiao, S.; Kimura, A.; Adachi, H.; Iori, K.; Miyamoto, K.; Xie, T.; Namatame, H.; Taniguchi, M.; Tanaka, A.; Muro, T.; Imada, S.; Suga, S.
2005-01-01
X-ray magnetic circular dichroism studies were carried out on (Sm, Gd)Al 2 , a ferromagnet without net magnetization at a certain compensation temperature. For Sm 4f electrons, the following understandings were obtained: the magnitude of expectation value of orbital magnetic moment (m L Sm ) is always larger than that of spin one (m S Sm ), so the cancellation of total spin and orbital magnetic moments cannot be achieved only by Sm 4f electrons and the contributions from Gd ions and conduction electrons are important; when the temperature decreases, the magnitude of both m L Sm and m S Sm increases and the gross magnetic moment due to the Sm 4f electrons monotonically deviates from zero. These results tell us that the temperature dependence of magnetic moments related with the electrons other than Sm 4f ones may play important roles in the subtle adjustment of the total spin and orbital magnetic moments to the zero magnetization at the compensation temperature
Dielectric spectroscopy of the SmQ* phase
Perkowski, P.; Bubnov, A.; Piecek, W.; Ogrodnik, K.; Hamplová, V.; Kašpar, M.
2011-11-01
Liquid crystal possessing two biphenyl moieties in the molecular core and lateral chlorine substitution far from the chiral chain has been studied by dielectric spectroscopy. On cooling from the isotropic phase, the material possesses the frustrated smectic Q* (SmQ*) and SmCA* phases. It has been confirmed by dielectric spectroscopy that the SmQ* phase can be related to the SmCA* anti-ferroelectric phase. However, only one relaxation process has been observed in the SmQ* phase, while in the SmCA*, two relaxations are clearly detectable. It seems that the mode found in the SmQ* can be connected with high-frequency anti-phase mode observed in the SmCA* phase. Its relaxation frequency is similar to PH relaxation frequency, but is weaker. The same relaxation has been observed even a few degrees above the SmQ*-Iso phase transition. Another explanation for the mode detected in SmQ* and isotropic phases can be molecular motions around short molecular axis.
2010-07-01
... control information label and engine identification number. 91.113 Section 91.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM... certification—emission control information label and engine identification number. (a) The engine manufacturer...
Energy Technology Data Exchange (ETDEWEB)
Bowers, J.A. [Westinghouse Savannah River Co., Aiken, SC (United States); Toole, M.A.; van Duyn, Y. [Normandeau Associates Inc., New Ellenton, SC (United States)
1992-02-01
The Savannah River Site (SRS) encompasses 300 sq mi of the Atlantic Coastal Plain in west-central South Carolina. Five major tributaries of the Savannah River -- Upper Three Runs Creek, Four Mile Creek, Pen Branch, Steel Creek, and Lower Three Runs Creek -- drain the site. In 1985, L Lake, a 400-hectare cooling reservoir, was built on the upper reaches of Steel Creek to receive effluent from the restart of L-Reactor and to protect the lower reaches from thermal impacts. The Steel Creek Biological Monitoring Program was designed to assess various components of the system and identify and changes due to the operation of L-Reactor or discharge from L Lake. An intensive ecological assessment program prior to the construction of the lake provided baseline data with which to compare data accumulated after the lake was filled and began discharging into the creek. The Department of Energy must demonstrate that the operation of L-Reactor will not significantly alter the established aquatic ecosystems. This report summarizes the results of six years` data from Steel Creek under the L-Lake/Steel Creek Monitoring Program. L Lake is discussed separately from Steel Creek in Volumes NAI-SR-138 through NAI-SR-143.
International Nuclear Information System (INIS)
Bowers, J.A.; Toole, M.A.; van Duyn, Y.
1992-02-01
The Savannah River Site (SRS) encompasses 300 sq mi of the Atlantic Coastal Plain in west-central South Carolina. Five major tributaries of the Savannah River -- Upper Three Runs Creek, Four Mile Creek, Pen Branch, Steel Creek, and Lower Three Runs Creek -- drain the site. In 1985, L Lake, a 400-hectare cooling reservoir, was built on the upper reaches of Steel Creek to receive effluent from the restart of L-Reactor and to protect the lower reaches from thermal impacts. The Steel Creek Biological Monitoring Program was designed to assess various components of the system and identify and changes due to the operation of L-Reactor or discharge from L Lake. An intensive ecological assessment program prior to the construction of the lake provided baseline data with which to compare data accumulated after the lake was filled and began discharging into the creek. The Department of Energy must demonstrate that the operation of L-Reactor will not significantly alter the established aquatic ecosystems. This report summarizes the results of six years' data from Steel Creek under the L-Lake/Steel Creek Monitoring Program. L Lake is discussed separately from Steel Creek in Volumes NAI-SR-138 through NAI-SR-143
Optical isotype shifts of 146Sm and 151Sm
International Nuclear Information System (INIS)
Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; England, J.G.; Grant, I.S.
1984-01-01
We have measured the optical isotope shifts of 146 Sm and 151 Sm by laser resonance fluorescence. From these measurements the changes in the mean square nuclear radii are: delta 2 > (A=144 to 146)=0.266(10) fm 2 , and delta 2 > (A=151 to 152)=0.262(10) fm 2 . These results, together with those of the stable isotopes, show that the average nuclear expansion of samarium can be accounted for by the liquid drop model with deformations. (orig.)
International Nuclear Information System (INIS)
Allen, J.M.; Lucas, S.; Allen, S.K.
1996-01-01
Formation rates and steady-state concentrations of hydroxyl radical ( sm-bullet OH) in illuminated surface water samples collected in west-central Indiana that receive acidic mine drainage runoff are reported. Formation rates for sm-bullet OH in samples were measured by the addition of 1 x 10 -3 M benzene prior to illuminate in order to effectively scavenge all of the sm-bullet OH formed, thereby yielding phenol. The sm-bullet OH formation rates were calculated from the measured phenol formation rates. Steady-state concentrations of sm-bullet OH were measured by the addition of 5 x 10 -7 M nitrobenzene to the samples prior to illumination. Estimated sunlight sm-bullet OH formation rates range from 16 microM h -1 to 265 microM h -1 . Estimated sunlight steady-state sm-bullet OH concentrations range from 6.7 x 10 -15 to 4.0 x 10 -12 M. Both the formation rates and steady-state concentrations for sm-bullet OH are thus two to three orders of magnitude higher than values reported in the literature for other sunlit surface water samples. Due to the very high rates of formation and steady-state concentrations for sm-bullet OH in these samples, the authors conclude that aqueous-phase reactions involving sm-bullet OH represent a significant pathway by which organic pollutants in illuminated surface waters receiving acidic mine drainage runoff may be consumed
Madej, Mary Ann; Bundros, Greg; Klein, Randy
2011-01-01
Revisions to the California Forest Practice Rules since 1974 were intended to increase protection of water quality in streams draining timber harvest areas. The effects of improved timber harvesting methods and road designs on sediment loading are assessed for the Panther Creek basin, a 15.4 km2 watershed in Humboldt County, north coastal California. We compute land use statistics, analyze suspended sediment discharge rating curves, and compare sediment yields in Panther Creek to a control (unlogged) stream, Little Lost Man Creek. From 1978 to 2008, 8.2 km2 (over half the watershed) was clearcut and other timber management activities (thinning, selection cuts, and so forth) affected an additional 5.9 km2. Since 1984, 40.7 km of streams in harvest units received riparian buffer strip protection. Between 2000 and 2009, 22 km of roads were upgraded and 9.7 km were decommissioned, reducing potential sediment production by an estimated 40,000 m3. Road density is currently 3.1 km/km2. Sediment rating curves from 2005 to 2010 indicate a decrease in suspended sediment concentrations when compared to the pre-1996 period, although Panther Creek still has a higher sediment yield on a per unit area basis than the control stream.
Plasma spraying of hard magnetic coatings based on Sm-Co alloys
International Nuclear Information System (INIS)
KrasnoyarskiyRabochiy prospect, Krasnoyarsk, 660014 (Russian Federation))" data-affiliation=" (Siberian State Aerospace University named after Academician M.F. Reshetnev 31 KrasnoyarskiyRabochiy prospect, Krasnoyarsk, 660014 (Russian Federation))" >Saunin, V N; KrasnoyarskiyRabochiy prospect, Krasnoyarsk, 660014 (Russian Federation))" data-affiliation=" (Siberian State Aerospace University named after Academician M.F. Reshetnev 31 KrasnoyarskiyRabochiy prospect, Krasnoyarsk, 660014 (Russian Federation))" >Telegin, S V
2015-01-01
Our research is focused on the formation of hard magnetic coatings by plasma spraying an arc-melted Sm-Co powder. We have studied basic magnetic characteristics depending on the components ratio in the alloy. A sample with a 40 wt.% Sm coating exhibits the highest coercive force (63 kOe) as compared to near-to-zero coercive force in the starting powder. X-ray structure analysis of the starting alloy and the coating reveals that the amount of SmCo 5 phase in the sprayed coating increases occupying up to 2/3 of the sample. We have also studied temperature dependence of the coating and have been able to obtain plasma sprayed permanent magnets operating within the temperature range from -100 to +500 °C. The technique used does not involve any additional thermal treatment and allows a coating to be formed right on the magnetic conductor surface irrespective of the conductor geometry
2012-01-01
VISITS The rules and conditions to be followed for visits in the SM18 Hall are laid out in the EDMS 1205328 document. No visit is allowed without prior reservation. ACCESS Special access right is needed ONLY from 7 p.m. to 7 a.m. and during week-ends. From 1 December, the current SM18 access database will be closed and a new one “SM18-OWH outside normal hours” started from scratch. Requests, via EDH SM18-OWH, will have to be duly justified. For further information, please contact Evelyne Delucinge.
HDDR in Sm-Co alloys - a new method for magnetic hardening of Sm-Co permanent magnets
Energy Technology Data Exchange (ETDEWEB)
Kubis, M.; Handstein, A.; Gebel, B.; Mueller, K.-H.; Schultz, L. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe; Gutfleisch, O. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe]|[Birmingham Univ. (United Kingdom). School of Metallurgy and Materials
1998-07-01
Investigations on the hydrogen absorption behavior of different Sm-Co alloys with 1:5 and 2:17 structure by differential scanning calorimetry (DSC) at enhanced hydrogen pressures between 1 MPa and 7 MPa indicated different hydrogen absorption events. X-ray diffraction (XRD) studies and microstructural investigations showed clearly the disproportionation of the Sm-Co phases into Sm hydride and Co or Co-rich phases for hydrogen pressures above 0.5 MPa. The favourable effect of high hydrogen pressures can be explained in terms of a decrease of the free enthalpy of the samarium hydride for increasing hydrogen pressures. Additionally, Sm-Co alloys of both types were reactively milled under hydrogen at enhanced temperatures. The reactively milled powders showed again the products of the disproportionation reaction. A recombination of Sm-Co phases by removing the hydrogen in a second heat treatment was successful for both methods. Investigations of the magnetic properties showed coercivities {mu}{sub OJ}H{sub C} of up to 2.1 T for high pressure HDDR powders of SmCo{sub 5} material, demonstrating clearly the positive effect of the hydrogen treatment on the coercivity. The reactively milled powders showed for recombination temperatures {<=}700 C a remanence enhancement which could be attributed to the exchange coupling of the nanoscaled grains. A maximum coercivity {mu}{sub OJ}H{sub C} of 3.7 T was achieved for SmCo{sub 5} and a maximum energy product (BH){sub max} of 82 kJ/m{sup 3} was measured for an Sm-rich Sm{sub 2}Co{sub 17} sample. (orig.)
HDDR in Sm-Co alloys - a new method for magnetic hardening of Sm-Co permanent magnets
International Nuclear Information System (INIS)
Kubis, M.; Handstein, A.; Gebel, B.; Mueller, K.-H.; Schultz, L.; Gutfleisch, O.; Birmingham Univ.
1998-01-01
Investigations on the hydrogen absorption behavior of different Sm-Co alloys with 1:5 and 2:17 structure by differential scanning calorimetry (DSC) at enhanced hydrogen pressures between 1 MPa and 7 MPa indicated different hydrogen absorption events. X-ray diffraction (XRD) studies and microstructural investigations showed clearly the disproportionation of the Sm-Co phases into Sm hydride and Co or Co-rich phases for hydrogen pressures above 0.5 MPa. The favourable effect of high hydrogen pressures can be explained in terms of a decrease of the free enthalpy of the samarium hydride for increasing hydrogen pressures. Additionally, Sm-Co alloys of both types were reactively milled under hydrogen at enhanced temperatures. The reactively milled powders showed again the products of the disproportionation reaction. A recombination of Sm-Co phases by removing the hydrogen in a second heat treatment was successful for both methods. Investigations of the magnetic properties showed coercivities μ OJ H C of up to 2.1 T for high pressure HDDR powders of SmCo 5 material, demonstrating clearly the positive effect of the hydrogen treatment on the coercivity. The reactively milled powders showed for recombination temperatures ≤700 C a remanence enhancement which could be attributed to the exchange coupling of the nanoscaled grains. A maximum coercivity μ OJ H C of 3.7 T was achieved for SmCo 5 and a maximum energy product (BH) max of 82 kJ/m 3 was measured for an Sm-rich Sm 2 Co 17 sample. (orig.)
Jia, Yanyan; Bai, Zhenqing; Pei, Tianlin; Ding, Kai; Liang, Zongsuo; Gong, Yuehua
2017-01-01
Subclass III members of the sucrose non-fermenting-1-related protein kinase 2 (SnRK2) play essential roles in both the abscisic acid signaling and abiotic stress responses of plants by phosphorylating the downstream ABA-responsive element (ABRE)-binding proteins (AREB/ABFs). This comprehensive study investigated the function of new candidate genes, namely SmSnRK2.3 , SmSnRK2.6 , and SmAREB1 , with a view to breeding novel varieties of Salvia miltiorrhiza with improved stress tolerance stresses and more content of bioactive ingredients. Exogenous ABA strongly induced the expression of these genes. PlantCARE predicted several hormones and stress response cis -elements in their promoters. SmSnRK2.6 and SmAREB1 showed the highest expression levels in the leaves of S. miltiorrhiza seedlings, while SmSnRK2.3 exhibited a steady expression in their roots, stems, and leaves. A subcellular localization assay revealed that both SmSnRK2.3 and SmSnRK2.6 were located in the cell membrane, cytoplasm, and nucleus, whereas SmAREB1 was exclusive to the nucleus. Overexpressing SmSnRK2.3 did not significantly promote the accumulation of rosmarinic acid (RA) and salvianolic acid B (Sal B) in the transgenic S. miltiorrhiza hairy roots. However, overexpressing SmSnRK2.6 and SmAREB1 increased the contents of RA and Sal B, and regulated the expression levels of structural genes participating in the phenolic acid-branched and side-branched pathways, including SmPAL1 , SmC4H , Sm4CL1 , SmTAT , SmHPPR , SmRAS , SmCHS , SmCCR , SmCOMT , and SmHPPD . Furthermore, SmSnRK2.3 and SmSnRK2.6 interacted physically with SmAREB1. In summary, our results indicate that SmSnRK2.6 is involved in stress responses and can regulate structural gene transcripts to promote greater metabolic flux to the phenolic acid-branched pathway, via its interaction with SmAREB1 , a transcription factor. In this way, SmSnRK2.6 contributes to the positive regulation of phenolic acids in S. miltiorrhiza hairy roots.
Directory of Open Access Journals (Sweden)
Yanyan Jia
2017-08-01
Full Text Available Subclass III members of the sucrose non-fermenting-1-related protein kinase 2 (SnRK2 play essential roles in both the abscisic acid signaling and abiotic stress responses of plants by phosphorylating the downstream ABA-responsive element (ABRE-binding proteins (AREB/ABFs. This comprehensive study investigated the function of new candidate genes, namely SmSnRK2.3, SmSnRK2.6, and SmAREB1, with a view to breeding novel varieties of Salvia miltiorrhiza with improved stress tolerance stresses and more content of bioactive ingredients. Exogenous ABA strongly induced the expression of these genes. PlantCARE predicted several hormones and stress response cis-elements in their promoters. SmSnRK2.6 and SmAREB1 showed the highest expression levels in the leaves of S. miltiorrhiza seedlings, while SmSnRK2.3 exhibited a steady expression in their roots, stems, and leaves. A subcellular localization assay revealed that both SmSnRK2.3 and SmSnRK2.6 were located in the cell membrane, cytoplasm, and nucleus, whereas SmAREB1 was exclusive to the nucleus. Overexpressing SmSnRK2.3 did not significantly promote the accumulation of rosmarinic acid (RA and salvianolic acid B (Sal B in the transgenic S. miltiorrhiza hairy roots. However, overexpressing SmSnRK2.6 and SmAREB1 increased the contents of RA and Sal B, and regulated the expression levels of structural genes participating in the phenolic acid-branched and side-branched pathways, including SmPAL1, SmC4H, Sm4CL1, SmTAT, SmHPPR, SmRAS, SmCHS, SmCCR, SmCOMT, and SmHPPD. Furthermore, SmSnRK2.3 and SmSnRK2.6 interacted physically with SmAREB1. In summary, our results indicate that SmSnRK2.6 is involved in stress responses and can regulate structural gene transcripts to promote greater metabolic flux to the phenolic acid-branched pathway, via its interaction with SmAREB1, a transcription factor. In this way, SmSnRK2.6 contributes to the positive regulation of phenolic acids in S. miltiorrhiza hairy roots.
Enzymatic in-situ generation of H2O2 for decolorization of Acid Blue 113 by fenton process
Directory of Open Access Journals (Sweden)
Karimi Afzal
2012-01-01
Full Text Available Decolorization of Acid Blue 113 in an aqueous medium by bio-Fenton process has been investigated in this research. Enzymatic oxidation of glucose was performed to in-situ generation of H2O2 which was employed to react with Fe2+ for producing hydroxyl radicals. The effect of various parameters include concentrations of 113, glucose, and FeSO4, activity of glucose oxidase (GOx and the effect of pH were assessed. The highest decolorization of AB 113 were achieved at Fe2+ concentration of 0.2 mmol/L, pH =4.0, glucose concentration of 0.018 mol/L, and glucose oxidase activity of 2500 U/L in the constant temperature (23 ±0.1ºC and constant shaking rate (160 r/min, while the concentration of 113 was 40 mg/L. In these conditions, 113 decolorization efficiency after 60 min was obtained about 95%.
Giant magnetic coercivity in YNi{sub 4}B-type SmNi{sub 3}TB (T=Mn–Cu) solid solutions
Energy Technology Data Exchange (ETDEWEB)
Yao, Jinlei; Yan, Chang [Research Center for Solid State Physics and Materials, School of Mathematics and Physics, Suzhou University of Science and Technology, Suzhou 215009 (China); Yapaskurt, V.O. [Department of Petrology, Geological Faculty Moscow State University, Leninskie Gory, Moscow 119992 (Russian Federation); Morozkin, A.V., E-mail: morozkin@tech.chem.msu.ru [Department of Chemistry, Moscow State University, Leninskie Gory, House 1, Building 3, GSP-2, Moscow 119992 (Russian Federation)
2016-12-01
The effects of transition metal substitution for Ni on the magnetic properties of the YNi{sub 4}B-type SmNi{sub 4}B via SmNi{sub 3}TB (T=Mn, Fe, Co, Cu) solid solutions have been investigated. SmNi{sub 4}B, SmNi{sub 3}MnB, SmNi{sub 3}FeB, SmNi{sub 3}CoB and SmNi{sub 3}CuB show ferromagnetic ordering at 40 K, 210 K, 322 K, 90 K and 57 K and field sensitive metamagnetic-like transitions at 15 K, 100 K, 185 K, 55 K and 15 K in a magnetic field of 10 kOe, respectively. The magnetocaloric effects of SmNi{sub 3}TB (T=Mn–Cu) were calculated in terms of isothermal magnetic entropy change (ΔS{sub m}). The magnetic entropy ΔS{sub m} reaches value of –0.94 J/kg K at 40 K for SmNi{sub 4}B, –1.5 J/kg K at 205 K for SmNi{sub 3}MnB, –0.54 J/kg K at 320 K for SmNi{sub 3}FeB, –0.49 J/kg K at 90 K for SmNi{sub 3}CoB and –0.54 J/kg K at 60 K for SmNi{sub 3}CuB in field change of 0–50 kOe around the Curie temperature. They show positive ΔS{sub m} of +0.71 J/kg K at ~10 K for SmNi{sub 4}B, +1.69 J/kg K at 30 K for SmNi{sub 3}MnB, +0.89 J/kg K at 110 K for SmNi{sub 3}FeB, +1.08 J/kg K at 25 K for SmNi{sub 3}CoB and +1.12 J/kg K at 10 K for SmNi{sub 3}CuB in field change of 0–50 kOe around the low temperature metamagnetic-like transition. Below the field induced transition temperature (change of magnetic structure), SmNi{sub 3}TB (T=Mn–Cu) exhibits giant magnetic coercivity of 74 kOe at 5 K for SmNi{sub 4}B, 69 kOe at 20 K (90 kOe at 10 K) for SmNi{sub 3}MnB, 77 kOe at 60 K for SmNi{sub 3}FeB, 88 kOe at 20 K for SmNi{sub 3}CoB and 52 kOe at 5 K for SmNi{sub 3}CuB. - Highlights: • YNi{sub 4}B-type SmNi{sub 3}{Mn, Fe, Co, Ni, Cu}B exhibit the Curie points at 39–322 K. • SmNi{sub 3}{Mn, Fe, Co, Ni, Cu}B show field induced transition at 15–185 K. • SmNi{sub 3}MnB shows huge magnetic hysteresis with coercive field of 69 kOe at 20 K. • SmNi{sub 3}FeB shows huge magnetic hysteresis with coercive field of 77 kOe at 60 K. • SmNi{sub 3}CoB shows giant coercive
The neoproterozoic Goias magmatic arc, central Brazil: a review and new Sm-Nd isotopic data
International Nuclear Information System (INIS)
Pimentel, Marcio Martins; Fuck, Reinhardt Adolfo; Gioia, Simone Maria Costa Lima
2000-01-01
In this study we review the main characteristics and geochronological/isotopic data of metaigneous rocks of the juvenile Neoproterozoic Goias Magmatic Arc in central Brazil. Some new Sm-Nd isotopic data are also presented for both the southern (Arenopolis) and northern (Mara Rosa) sections of the arc. In the south, granitoids of the Choupana-Turvania area yielded a Sm-Nd whole-rock isochron age of 863± 97 Ma and e Nd (T) of +4.1 T D M model ages vary between 0.94 and 1.13 Ga. Metavolcanic rocks in the Pontalina region have a Sm-Nd whole rock isochron age of 762 ± 77 Ma and e Nd (T) of +2.9. T DM values are between 0.96 and 1.10 Ga. In the northern section of the Goias Arc, mylonitic gneisses of the Serra Azul ridge, an important N30E shear zone, were investigated and have a Sm-Nd isochron age of 3058 ± 120 Ma and initial e Nd value of ca.+ 2.1. This data suggests that the Serra Azul ridge might represent either a mylonitized fragment of the Archaen terranes exposed just to the south, or the sialic basement of the Araguaia Belt supracrustal, along the eastern margin of the Amazon Craton. The geochronological data available so far indicate a long history of arc formation and amalgamation on the western margin of the Sao Francisco-Congo continent during the Neoproterozoic. The history of convergence of continental masses is partially coeval with the fragmentation of Rodinia, indicating that the western margin (present geographic reference) of that continent occupied a peripheral setting in the Rodinia super continent. (author)
The neoproterozoic Goias magmatic arc, central Brazil: a review and new Sm-Nd isotopic data
Energy Technology Data Exchange (ETDEWEB)
Pimentel, Marcio Martins; Fuck, Reinhardt Adolfo; Gioia, Simone Maria Costa Lima [Brasilia Univ., DF (Brazil). Inst. de Geociencias]. E-mail: marcio@unb.br
2000-03-01
In this study we review the main characteristics and geochronological/isotopic data of metaigneous rocks of the juvenile Neoproterozoic Goias Magmatic Arc in central Brazil. Some new Sm-Nd isotopic data are also presented for both the southern (Arenopolis) and northern (Mara Rosa) sections of the arc. In the south, granitoids of the Choupana-Turvania area yielded a Sm-Nd whole-rock isochron age of 863{+-} 97 Ma and e{sub Nd} (T) of +4.1 T{sub D}M model ages vary between 0.94 and 1.13 Ga. Metavolcanic rocks in the Pontalina region have a Sm-Nd whole rock isochron age of 762 {+-} 77 Ma and e{sub Nd} (T) of +2.9. T {sub DM} values are between 0.96 and 1.10 Ga. In the northern section of the Goias Arc, mylonitic gneisses of the Serra Azul ridge, an important N30E shear zone, were investigated and have a Sm-Nd isochron age of 3058 {+-} 120 Ma and initial e{sub Nd} value of ca.+ 2.1. This data suggests that the Serra Azul ridge might represent either a mylonitized fragment of the Archaen terranes exposed just to the south, or the sialic basement of the Araguaia Belt supracrustal, along the eastern margin of the Amazon Craton. The geochronological data available so far indicate a long history of arc formation and amalgamation on the western margin of the Sao Francisco-Congo continent during the Neoproterozoic. The history of convergence of continental masses is partially coeval with the fragmentation of Rodinia, indicating that the western margin (present geographic reference) of that continent occupied a peripheral setting in the Rodinia super continent. (author)
Absorption Spectra of BaF2 Sm2O3, Sm, Gd, and Ho Plasmas
Martin, Michael; Bastiani-Ceccotti, Serena
2009-11-01
Knowledge of the opacities of high Z element plasmas is important in indirect drive ICF and the study of stellar evolution. There are few experimental measurements of this quantity, and its theoretical determination is difficult due to the number of possible bound electron configurations. This study aims to better the theoretical understanding of this parameter by looking at the 3d-4f transitions of BaF2, Sm2O3, Sm, Gd, and Ho plasmas at the LULI2000 facility. The plasmas are produced by radiative heating and are cold, 15 -- 40 eV, and relatively dense, ˜ .01gm/cm^3 A plasma is produced by a .5 ns laser pulse irradiating a gold hohlraum and then probed by an x-ray source created by a gold foil irradiated by a 10 ps laser pulse. The transmission is found with simultaneous source and absorption measurements by an x-ray spectrometer in the 8 - 20 å range We will compare the results with statistical atomic structure codes. From this experiment we will gain further insight into the spectral broadening of neighboring Z elements due to changing plasma temperature and into mixture thermodynamics. This is a first step towards an experimental study of astrophysical domains.
Energy Technology Data Exchange (ETDEWEB)
Jennifer M. DeBruyn; Gary S. Sayler [University of Tennessee, Knoxville, TN (United States). Center for Environmental Biotechnology and Department of Microbiology
2009-05-01
The Chattanooga Creek Superfund site (Chattanooga, TN) is one of the most polluted waterways in the southeastern U.S. with high polycyclic aromatic hydrocarbon (PAH) concentrations in the sediments. PAHs associate with suspended solids in the water column, and may be redeposited onto the floodplain. These suspended particles represent an interesting but understudied environment for PAH-degrading microbial communities. This study tested the hypotheses that particle-associated bacterial (PAB) communities have genotypic potential (PAH-dioxygenase genes) and activity (naphthalene and pyrene mineralization), and can contribute to natural attenuation of PAHs in Chattanooga Creek. Upstream of the Superfund site, mineralization ranged from 0.2 to 2.0% of added {sup 14}C-naphthalene and 0 to 0.1% {sup 14}C-pyrene (after 40 h), with first order biodegradation rate constants (k{sub 1}) ranging from 1.09 to 9.18 x 10{sup -5} h{sup -1} and 0 to 1.13 x 10{sup -6} h{sup -1}, respectively. Mineralization was significantly greater in PAB communities within the contaminated zone, with 11.8 to 31.2% {sup 14}C-naphthalene (k{sup 1} 5.34 to 14.2 x 10-4 h{sup -1}) and 1.3 to 6.6% {sup 14}C-pyrene mineralized (k{sub 1} 2.89 to 15.0 x 10{sup -5} h{sup -1}). Abundances of nagAc (naphthalene dioxygenase) and nidA (pyrene dioxygenase) genes indicated that PAB communities harbored populations with genetic potential for both low- and high-molecular weight PAH degradation, and quantification of Mycobacterium 16S rDNA genes indicated that PAH-degrading mycobacteria are also prevalent in this environment. Phylogenetic comparisons (T-RFLPs) between PAB and sediments indicated these microbial communities were taxonomically distinct, but shared some functional similarities, namely PAH catabolic genotypes, mineralization capabilities, and community structuring along a contamination gradient. 38 refs., 4 figs., 2 tabs.
Invertebrates associated with ipomea aquatica in ogbe creek, logos, nigeria
International Nuclear Information System (INIS)
Saliu, J.K.; Fashola, Y.T.
2006-01-01
The association of invertebrates in Ogbe creek with Ipomea aquatica was investigated within the period from 7th September to 30th November, 2001, 167 invertebrates comprising of 19 species were harvested from 73 weeds. Corixa punctata (22.16%) was the most abundant invertebrate on Ipomea aquatica while Gyrinus notator larvae (0.60%) were the least abundant. The roots sheltered the highest number of invertebrates (113), comprising of 12 species recording a species diversity of 5.36 while the stem sheltered the lowest number of invertebrates (10) comprising of 3 species with a species diversity of 2.00. The ability of Ipomea aquaTica to harbour invertebrates was influenced by the morphological form of the plant. The root was the preferred site for the invertebrates because it was a suitable substrate for clinging and nutrient supply. (author)
Rb-Sr and Sm-Nd chronology and genealogy of mare basalts from the Sea of Tranquility
Papanastassiou, D. A.; Depaolo, D. J.; Wasserburg, G. J.
1977-01-01
Rb-Sr and Sm-Nd ages of two Apollo 11 mare basalts, high-K basalt 10072 and low-K basalt 10062, are reported. Rb-Sr, Sm-Nd, and Ar-40-Ar-39 ages are in good agreement and indicate an extensive time interval for filling of the Sea of Tranquility, presumably by thin lava flows, in agreement with similar observations for the Ocean of Storms. Initial Sr and Nd isotopic compositions on Apollo 11 basalts reveal at least two parent sources producing basalts. The Sm-Nd isotopic data demonstrate that low-K and high-Ti basalts from Apollo 11 and 17 derived from distinct reservoirs, while low-Ti Apollo 15 mare basalt sources have Sm/Nd similar to the sources of Apollo 11 basalts. Groupings of mare basalt based on Ti content and on isotopic data do not coincide.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake Creek. 117.331 Section 117.331 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.331 Snake Creek. The draw of the Snake Creek...
SM-1420 computer conjugation with the ES-5017 magnetic tape storage device and the SM-6313 printer
International Nuclear Information System (INIS)
Zhurkin, V.V.; Safonov, A.A.; Troitskij, A.N.
1987-01-01
The flow sheets are given and the methods of the technical implementation of expansion units of SM 5002.4 controllers to connect NML ES-5017 and analogue-digital printer ATsPU SM-6818, respectively, to SM-1420 computer are described
Henretta Creek reclamation project
International Nuclear Information System (INIS)
Pumphrey, J.F.
2009-01-01
Teck Coal Ltd. operates 6 open-pit coal mines, of which 5 are located in the Elk Valley in southeastern British Columbia. The Fording River Operations (FRO) began in 1971 in mining areas in Eagle Mountain, Turnbull Mountain and Henretta Valley. The recovery of approximately 5 million tons of coal from the Henretta Creek Valley posed significant challenges to mine planners, hydrologists and environmental experts because the coal had to be recovered from the valley flanks and also from under the main valley floor, on which the fish-bearing Henretta Creek runs. The Henretta Dragline Mining project was described along with the water control structures and fisheries management efforts for the cutthroat trout. A detailed Environmental Impact Assessment and Stage 1 mining report for the Henretta Valley area was completed in December 1990. FRO was granted a mining and reclamation permit in 1991. A temporary relocation of 1,270 metres was required in in April 1997 in order to enable mining on both sides and below the creek bed. Among the innovative construction techniques was a diversion of Henretta Creek through large diameter steel culverts and a specialized crossing of the creek to allow fish passage. The first water flowed through the reclaimed Henretta Creek channel in late 1998 and the first high flow occurred in the spring of 2000. Teck coal FRO then launched an annual fish and fish habitat monitoring program which focused on the Henretta Creek Reclaimed Channel and Henretta Lake. This document presented the results from the final year, 2006, and a summary of the 7 year aquatic monitoring program. It was concluded that from mining through to reclamation, the Henretta project shows the commitment and success of mining and reclamation practices at Teck Coal. Indicators of the project's success include riparian zone vegetation, fisheries re-establishment, aquatic communities and habitat utilization by terrestrial and avian species. 33 refs., 1 fig.
Småhuse: Indretning og funktion
DEFF Research Database (Denmark)
Hansen, Ernst Jan de Place; Sigbrand, Lone; Frandsen, Anne Kathrine
Denne anvisning omhandler generelle krav og anbefalinger til indretning og funktion af nybyggede småhuse i henhold til bestemmelserne i Bygningsreglement 2010 (BR10). Småhuse - Indretning og funktionSmåhuse omfatter fritliggende og sammenbyggede enfamiliehuse med lodret lejlighedsskel i indtil...
Excited states in 146Sm and 147Sm
International Nuclear Information System (INIS)
Kownacki, J.; Sujkowski, Z.; Hammaren, E.; Liukkonen, E.; Piiparinen, M.; Lindblad, Th.; Ryde, H.
1979-10-01
The sup(144,146)Nd(α,xn) and sup(146,148)Nd( 3 He,xn) reactions with Esub(α) = 20 - 43 MeV and E 3 sub(He) = 19 - 27 MeV are used to investigate excited states in the isotopes 146 Sm and 147 Sm. The experiments involve measurements of singles γ-ray spectra and conversion electron spectra, γ-ray angular distributions and three parameter (E sub(γ)E sub(γ) time) coincidences. From these experiments information is obtained for states with spin up to I = 13 + and I = 27/2 - , respectively, These states are interpeted within the framework of the cluster-vibration model (CVM) as well as the shell model. (author)
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...
Chilean experience in production of therapeutic radiopharmaceuticals labelled with 153Sm and 166Ho
International Nuclear Information System (INIS)
Chandia, M.; Gil, M.G.; Tomicic, M.; Araya, G.; Olea, E.; Chong, G.
1998-01-01
153 Samarium ( 153 Sm) and 166 Holmium ( 166 Ho) were produced at the Nuclear Center of La Reina Research Reactor, Chilean Nuclear Energy Commission. 153 Sm-EDTMP (Ethylenediaminetetramethylene Phosphonate) used for clinical trial of therapy for painful skeletal metastases and labeled particles such as 166 Ho-FHMA (ferric hydroxide macroagregattes) and 153 Sm-HAP (hydroxiapatite particles) used for radiation synevectomy, were labeled. Radionuclide purity of both radionuclides was analyzed by gamma spectrometry using a multichannel gamma spectrometer. Radiochemical labeled reaction parameters of 153 Sm-EDTMP such as: Sm/EDTMP molar ratio, 153 Sm specific activity, labeled pH and temperature, were determined in order to get high radiolabeling yields. Radiochemical Quality Controls of 153 Sm-EDTMP using different chromatographic systems were carried out in order to determine labeling yields. Bodistribution studies were achieved in mice by dissection of animals and by autoradiography of histological slices in rats, after 2h post injection. 153 Sm-HAP and 166 Ho-FHMA labeled particles were prepared using the methods described. Radiochemical purity, in case of radiolabeled particles was carried out by centrifugation, measuring activity in the supernatant and in particles pellet. Physical parameters, such as particle size and range of the radiopharmaceuticals based on particles labeling were evaluated in order to determine the ideal conditions to obtain particles size range between 10 - 40μ. In vitro labeling stability for over seven days and wash out activity by incubation in human synovial fluid after 6 and 24h post labeling, was also studied. 153 Sm-EDTMP was easily labeled with a Radiochemical purity over 99.5% and stable for over 7 days. Biodistribution studies in mice give more than 50% of ID uptake in bone and less than 0,1% in liver this was correlated by autoradiographic image. 153 Sm-HAP and 166 Ho-FHMA were also labeling obtaining radiochemical purity over 95
Scintigraphy of the Placenta With {sup 113m}In
Energy Technology Data Exchange (ETDEWEB)
Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)
1969-05-15
The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)
Barber, Larry B.; Keefe, Steffanie H.; Kolpin, Dana W.; Schnoebelen, Douglas J.; Flynn, Jennifer L.; Brown, Gregory K.; Furlong, Edward T.; Glassmeyer, Susan T.; Gray, James L.; Meyer, Michael T.; Sandstrom, Mark W.; Taylor, Howard E.; Zaugg, Steven D.
2011-01-01
samplings, Boulder Creek downstream from the wastewater treatment plant was 40 percent effluent, and Fourmile Creek downstream from that wastewater treatment plant was 28 percent effluent. At each site, 300 individual constituents were determined to characterize the water. Most of the inorganic constituents were detected in all of the stream and treatment-plant effluent samples, whereas detection of synthetic organic compounds was more limited and contaminants typically occurred only in wastewater treatment-plant effluents and at downstream sites. Concentrations ranged from nanograms per liter to milligrams per liter.
International Nuclear Information System (INIS)
Fan Wei; Zheng Zongyuan; Xu Guangpu
2004-01-01
Objective: To evaluate the effect on survival of Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP) in patients with nasopharyngeal carcinoma (NPC) and multiple bone metastases. Methods: From 1993 to 1999, 160 patients (127 men, 33 women; median age 35 years) presented with NPC and multiple bone metastases. Of these, 40 patients had undergone chemotherapy, and 72 palliative radiotherapy. Patients were randomly divided into four groups: Group 1 (N = 20) received analgesics (control); Groups 2, 3 and 4 (N = 80, 40, and 20, respectively) received one, two or three courses, respectively, of 153Sm-EDTMP (77.7 MBq/kg/course; course interval, 4 wk). Results: Eight patients died of non-cancer-related causes, and 24 were lost to follow-up. The median survival time for Group 1 (7.8 months) was significantly less (p < 0.05) than that of Groups 2, 3 and 4 (11.6, 13.4 and 12.8 months, respectively). Patients given 153Sm-EDTMP who had had revious external radiation survived longer (p < 0.05) than those in the other treatment groups. Conclusions: Internal radiotherapy with 153Sm-EDTMP can extend survival time in patients with nasopharyngeal carcinoma and multiple bone metastases; when combined with external radiotherapy in appropriate patients, its effect on survival time is enhanced.. (authors)
study on 113 Sn-113m In generator of the chromatographic column elution mode
International Nuclear Information System (INIS)
Abdel-Halim, A.A.
2002-01-01
this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days
International Nuclear Information System (INIS)
Zhao Kui; Guo Jiyu; Lu Xiuqin; Cheng Yehao; Huang Xiaolin; Ma Yong; Li Shuyuan; Ruan Ming; Li Zhichang; Jiang Chenglie
1997-01-01
A preliminary result was reported for the experiment to determine the mass of the heavier neutron-rich nucleus 158 Sm using the 160 Gd( 18 O, 20 Ne) two proton transfer reaction in last progress report. The average Q-value of (4.046 +- 0.102) MeV for the 160 Gd( 18 O, 20 Ne) 158 Sm reaction is given. A mass excess for 158 Sm of (-65.738 +- 0.102) MeV was derived. This is the first experimentally measured value of the mass of 158 Sm which is about 450 keV higher than the evaluation value from systematic trends listed in the 1993 atomic mass table. The new prediction shows better agreement with the measured values and a significant improvement over the earlier FRDM (finite-range droplet model) value
Hydrology of the Johnson Creek Basin, Oregon
Lee, Karl K.; Snyder, Daniel T.
2009-01-01
The Johnson Creek basin is an important resource in the Portland, Oregon, metropolitan area. Johnson Creek forms a wildlife and recreational corridor through densely populated areas of the cities of Milwaukie, Portland, and Gresham, and rural and agricultural areas of Multnomah and Clackamas Counties. The basin has changed as a result of agricultural and urban development, stream channelization, and construction of roads, drains, and other features characteristic of human occupation. Flooding of Johnson Creek is a concern for the public and for water management officials. The interaction of the groundwater and surface-water systems in the Johnson Creek basin also is important. The occurrence of flooding from high groundwater discharge and from a rising water table prompted this study. As the Portland metropolitan area continues to grow, human-induced effects on streams in the Johnson Creek basin will continue. This report provides information on the groundwater and surface-water systems over a range of hydrologic conditions, as well as the interaction these of systems, and will aid in management of water resources in the area. High and low flows of Crystal Springs Creek, a tributary to Johnson Creek, were explained by streamflow and groundwater levels collected for this study, and results from previous studies. High flows of Crystal Springs Creek began in summer 1996, and did not diminish until 2000. Low streamflow of Crystal Springs Creek occurred in 2005. Flow of Crystal Springs Creek related to water-level fluctuations in a nearby well, enabling prediction of streamflow based on groundwater level. Holgate Lake is an ephemeral lake in Southeast Portland that has inundated residential areas several times since the 1940s. The water-surface elevation of the lake closely tracked the elevation of the water table in a nearby well, indicating that the occurrence of the lake is an expression of the water table. Antecedent conditions of the groundwater level and autumn
Energy Technology Data Exchange (ETDEWEB)
Meza-Rocha, A.N., E-mail: ameza@fis.cinvestav.mx [Departamento de Física, Universidad Autónoma Metropolitana-Iztapalapa, P.O. Box 55-534, 09340 México D.F., México (Mexico); Speghini, A. [Dipartimento di Biotecnologie, Universita di Verona and INSTM, UdR Verona, Strada Le Grazie 15, I-37314 Verona (Italy); IFAC CNR, Nello Carrara Institute of Applied Physics, MDF Lab, I-50019 Sesto Fiorentino, FI (Italy); Bettinelli, M. [Dipartimento di Biotecnologie, Universita di Verona and INSTM, UdR Verona, Strada Le Grazie 15, I-37314 Verona (Italy); Caldiño, U. [Departamento de Física, Universidad Autónoma Metropolitana-Iztapalapa, P.O. Box 55-534, 09340 México D.F., México (Mexico)
2015-11-15
A spectroscopy study of Sm{sup 3+} and Sm{sup 3+}/Eu{sup 3+} doped zinc phosphate glasses is performed through photoluminescence spectra and decay time profile measurements. Under Sm{sup 3+} excitation at 344 nm, the Sm{sup 3+} singly doped glass shows an orange global emission with x=0.579 and y=0.414 CIE1931 chromaticity coordinates, whereas the Sm{sup 3+}/Eu{sup 3+} co-doped sample exhibits orange overall emissions (x=0.581 and y=0.398, and x=0.595 and y=0.387) and reddish-orange overall emission (x=0.634 and y=0.355) upon excitations at 344, 360 and 393 nm, respectively. Such luminescence from the co-doped sample is originated by the simultaneous emission of Sm{sup 3+} and Eu{sup 3+}. Under Sm{sup 3+} excitation at 344 and 360 nm, the Eu{sup 3+} emission is sensitized and enhanced by Sm{sup 3+} through a non-radiative energy transfer process. The non-radiative nature was inferred from the shortening of the Sm{sup 3+} lifetime observed in the Sm{sup 3+}/Eu{sup 3+} co-doped sample. An analysis of the Sm{sup 3+} emission decay time profiles using the Inokuti–Hirayama model suggests that an electric quadrupole–quadrupole interaction into Sm–Eu clusters might dominate the energy transfer process, with an efficiency of 0.17. - Highlights: • Zinc phosphate glasses are optically activated with Sm{sup 3+}/Eu{sup 3+} (ZPOSmEu). • Non-radiative energy transfer Sm{sup 3+}→Eu{sup 3+} takes place in ZPOSmEu. • ZPOSmEu overall emission can be modulated with the excitation wavelength. • ZPOSmEu might be useful as orange/reddish-orange phosphor for UV-white LEDs.
Probing metastable Sm2+ and optically stimulated tunnelling emission in YPO4: Ce, Sm
DEFF Research Database (Denmark)
Prasad, Amit Kumar; Kook, Myung Ho; Jain, Mayank
2017-01-01
When the model dosimetry system YPO4: Ce3+, Sm3+ is exposed to X-rays, the charge state of the dopants changes, becoming Ce4+ and Sm2+ via hole and electron trapping, respectively which are metastable; the original charge states can be achieved through electron transfer back from Sm2+ to Ce4+ via......) and its temperature dependence to provide insights into thermal quenching, and c) the kinetics of localised recombination from Sm2+ to Ce4+ on nanoseconds to seconds time scales using sub-band-edge excitation....
Luminescence properties of the Sm-doped borate glasses
International Nuclear Information System (INIS)
Kindrat, I.I.; Padlyak, B.V.; Drzewiecki, A.
2015-01-01
The optical absorption and photoluminescence (emission and excitation) spectra as well as decay kinetics of a series of the Sm-doped glasses with Li 2 B 4 O 7 , LiKB 4 O 7 , CaB 4 O 7 , and LiCaBO 3 compositions were investigated and analysed. The Li 2 B 4 O 7 :Sm, LiKB 4 O 7 :Sm, CaB 4 O 7 :Sm, and LiCaBO 3 :Sm glasses of high optical quality have been obtained from the corresponding polycrystalline compounds in the air atmosphere, using a standard glass technology. On the basis of electron paramagnetic resonance (EPR) and optical spectra analysis it was shown that the samarium impurity is incorporated into the glass network as Sm 3+ (4f 5 , 6 H 5/2 ) ions, exclusively. All observed 4f – 4f transitions of the Sm 3+ centres in the optical absorption and luminescence spectra of the investigated glasses are identified. Most intense emission band of the Sm 3+ ions peaked about 598 nm ( 4 G 5/2 → 6 H 7/2 transition) is characterised by a single exponential decay with typical lifetime values, which depend on the basic glass composition as well as concentration and local structure of the Sm 3+ luminescence centres. The quantum efficiency has been evaluated for observed transitions of the Sm 3+ centres using obtained experimental lifetimes and radiative lifetimes calculated by Judd–Ofelt theory. The calculated high quantum efficiencies and measured quantum yields of luminescence show that the investigated borate glasses are perspective luminescence materials. Energy transfer from the Ce 3+ non-controlled impurity and intrinsic luminescence centres to the Sm 3+ centres has been observed. Peculiarities of the Sm 3+ local structure in the network of investigated glasses have been discussed based on the obtained spectroscopic results and structural data. - Highlights: • The Sm-doped Li 2 B 4 O 7 , LiKB 4 O 7 , CaB 4 O 7 , and LiCaBO 3 glasses of high quality were obtained. • EPR, optical absorption and luminescence spectra of Sm 3+ ions in obtained glasses were
Acute toxicity of injection of 153Sm-EDTMP
International Nuclear Information System (INIS)
Chen Baiwei; Chai Xuehong
2004-01-01
Sm-153 has several distinct advantages as a radiopharmaceutical for the treat of patients with bone to skeletal metastasis. Sm-153 shows high skeletal uptake and rapid blood and nonosseous tissue clearance. Several paper have considered the toxicity of 153Sm-EDTMP. We report the acute toxicity in mice and rats after injection of 153Sm-EDTMP or unlabeled EDTMP. The EDTMP was injected to mice by 9.76, 7.8, 6.25, 5, 4 mg/Kg. The logarithmic dose of EDTMP were given to mice to determine LD50. The LD50 of EDTMP in mice is 7.1 mg/Kg. The decay of 153Sm-EDTMP for 4 months were injected to mice at dose of 225 mg/Kg. 153Sm-EDTMP were given at 4 difference dosage to rats by 74 MBq/Kg, 370 MBq/Kg, 1110 MBq/Kg, 1850 MBq/Kg. The LD50 of 153Sm-EDTMP in rats is more than 370 MBq/Kg. Although the cold EDTMP LD50 was low, chelated with Sm can decrease it's toxicity. The decay 153Sm-EDTMP can be safe at dose of 225 mg/Kg. The clinical dose will be used at 37 MBq/Kg. So there is no need to consider to acute toxicity in clinical used 153Sm-EDTMP in designated regimen because the safe range is wide enough to cover clinical used. (authors)
Molehin, Adebayo J; Sennoune, Souad R; Zhang, Weidong; Rojo, Juan U; Siddiqui, Arif J; Herrera, Karlie A; Johnson, Laura; Sudduth, Justin; May, Jordan; Siddiqui, Afzal A
2017-11-01
Schistosomiasis remains a major global health problem. Despite large-scale schistosomiasis control efforts, clear limitations such as possible emergence of drug resistance and reinfection rates highlight the need for an effective schistosomiasis vaccine. Schistosoma mansoni large subunit of calpain (Sm-p80)-based vaccine formulations have shown remarkable efficacy in protecting against S. mansoni challenge infections in mice and baboons. In this study, we evaluated the cross-species protective efficacy of Sm-p80 vaccine against S. japonicum and S. haematobium challenge infections in rodent models. We also elucidated the expression of Sm-p80 and Sm-p80 ortholog proteins in different developmental stages of S. mansoni, S. haematobium, and S. japonicum. Immunization with Sm-p80 vaccine reduced worm burden by 46.75% against S. japonicum challenge infection in mice. DNA prime/protein boost (1 + 1 dose administered on a single day) resulted in 26.95% reduction in worm burden in S. haematobium-hamster infection/challenge model. A balanced Th1 (IFN-γ, TNF-α, IL-2, and IL-12) and Th2 (IL-4, IgG1) type of responses were observed following vaccination in both S. japonicum and S. haematobium challenge trials and these are associated with the prophylactic efficacy of Sm-p80 vaccine. Immunohistochemistry demonstrated that Sm-p80/Sm-p80 ortholog proteins are expressed in different life cycle stages of the three major human species of schistosomes studied. The data presented in this study reinforce the potential of Sm-p80-based vaccine for both hepatic/intestinal and urogenital schistosomiasis occurring in different geographical areas of the world. Differential expression of Sm-p80/Sm-p80 protein orthologs in different life cycle makes this vaccine potentially useful in targeting different levels of infection, disease, and transmission.
Study of fuel element characteristic of SM and SMP (SM-PRIMA) fuel assemblies
International Nuclear Information System (INIS)
Klinov, A.V.; Kuprienko, V.A.; Lebedev, V.A.; Makhin, V.M.; Tuchnin, L.M.; Tsykanov, V.A.
1999-01-01
The paper discusses the techniques and results of reactor tests and post-reactor investigations of the SM reactor fuel elements and fuel elements developed in the process of designing the specialized PRIMA test reactor with the SM reactor fuel elements used as a prototype and which are referred to as the SMP fuel elements. The behavior of fuel elements under normal operating conditions and under deviation from normal operating conditions was studied to verify the calculation techniques, to check the calculation results during preparation of the SM reactor safety substantiation report and to estimate the possibility of using such fuel elements in other projects. During tests of fuel rods under deviation from normal operating conditions their advantages were shown over fuel elements, the components of which were produced using the Al-based alloys. (author)
Study of hydrogenation of Sm2Fe17-yGay by means of X-ray diffraction
International Nuclear Information System (INIS)
Teresiak, A.; Uhlemann, M.; Kubis, M.; Gebel, B.; Mattern, N.; Mueller, K.-H.
2000-01-01
The hydrogenation process of Sm 2 Fe 17-y Ga y (y=0-2) was studied. X-ray investigations show a decreasing hydrogen solubility in the intermetallic alloy with increasing Ga-content from 4.0±0.3 atoms per formula unit for Sm 2 Fe 17 to 2.85±0.05 for Sm 2 Fe 15 Ga 2 . The larger Ga atoms reduce the size of the interstitial sites and thereby the maximum hydrogen concentration is decreased. The behaviour of the lattice parameters a and c with increasing Ga content points to a changed hydrogen distribution on the interstitial sites, becoming more statistical. In situ observations by means of high temperature X-ray diffraction show that the hydrogen absorption process is diffusion controlled. The hydrogen absorption starts at an annealing temperature of 120-140 C in all cases. The solubility of hydrogen decreases with increasing temperature. The hydrogen is completely desorbed above 350 C in all cases. The absorption/desorption process is reversible between room temperature and 400 C. Annealing at temperatures above 400 C leads to the decomposition of the Sm 2 Fe 17 phase, indicated by emerging of α-Fe. The formation of SmH x is established at 600 C. The decomposition temperature increases with increasing Ga-content. Up to 750 C, only Sm 2 Fe 17 is completely decomposed. (orig.)
Galeone, Daniel G.; Low, Dennis J.
2003-01-01
Powell Creek and Armstrong Creek Watersheds are in Dauphin County, north of Harrisburg, Pa. The completion of the Dauphin Bypass Transportation Project in 2001 helped to alleviate traffic congestion from these watersheds to Harrisburg. However, increased development in Powell Creek and Armstrong Creek Watersheds is expected. The purpose of this study was to establish a baseline for future projects in the watersheds so that the effects of land-use changes on water quality can be documented. The Pennsylvania Department of Environmental Protection (PADEP) (2002) indicates that surface water generally is good in the 71 perennial stream miles in the watersheds. PADEP lists 11.1 stream miles within the Armstrong Creek and 3.2 stream miles within the Powell Creek Watersheds as impaired or not meeting water-quality standards. Siltation from agricultural sources and removal of vegetation along stream channels are cited by PADEP as likely factors causing this impairment.
Garcia, Ana Maria
2009-01-01
A study of the Currituck Sound was initiated in 2005 to evaluate the water chemistry of the Sound and assess the effectiveness of management strategies. As part of this study, the Soil and Water Assessment Tool (SWAT) model was used to simulate current sediment and nutrient loadings for two distinct watersheds in the Currituck Sound basin and to determine the consequences of different water-quality management scenarios. The watersheds studied were (1) Tull Creek watershed, which has extensive row-crop cultivation and artificial drainage, and (2) West Neck Creek watershed, which drains urban areas in and around Virginia Beach, Virginia. The model simulated monthly streamflows with Nash-Sutcliffe model efficiency coefficients of 0.83 and 0.76 for Tull Creek and West Neck Creek, respectively. The daily sediment concentration coefficient of determination was 0.19 for Tull Creek and 0.36 for West Neck Creek. The coefficient of determination for total nitrogen was 0.26 for both watersheds and for dissolved phosphorus was 0.4 for Tull Creek and 0.03 for West Neck Creek. The model was used to estimate current (2006-2007) sediment and nutrient yields for the two watersheds. Total suspended-solids yield was 56 percent lower in the urban watershed than in the agricultural watershed. Total nitrogen export was 45 percent lower, and total phosphorus was 43 percent lower in the urban watershed than in the agricultural watershed. A management scenario with filter strips bordering the main channels was simulated for Tull Creek. The Soil and Water Assessment Tool model estimated a total suspended-solids yield reduction of 54 percent and total nitrogen and total phosphorus reductions of 21 percent and 29 percent, respectively, for the Tull Creek watershed.
Luminescence properties of the Sm-doped borate glasses
Energy Technology Data Exchange (ETDEWEB)
Kindrat, I.I. [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland); Padlyak, B.V., E-mail: B.Padlyak@if.uz.zgora.pl [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland); Vlokh Institute of Physical Optics, 23 Dragomanov Street, 79-005 Lviv (Ukraine); Drzewiecki, A. [University of Zielona Góra, Institute of Physics, Division of Spectroscopy of Functional Materials, 4a Szafrana Street, 65-516 Zielona Góra (Poland)
2015-10-15
The optical absorption and photoluminescence (emission and excitation) spectra as well as decay kinetics of a series of the Sm-doped glasses with Li{sub 2}B{sub 4}O{sub 7}, LiKB{sub 4}O{sub 7}, CaB{sub 4}O{sub 7}, and LiCaBO{sub 3} compositions were investigated and analysed. The Li{sub 2}B{sub 4}O{sub 7}:Sm, LiKB{sub 4}O{sub 7}:Sm, CaB{sub 4}O{sub 7}:Sm, and LiCaBO{sub 3}:Sm glasses of high optical quality have been obtained from the corresponding polycrystalline compounds in the air atmosphere, using a standard glass technology. On the basis of electron paramagnetic resonance (EPR) and optical spectra analysis it was shown that the samarium impurity is incorporated into the glass network as Sm{sup 3+} (4f{sup 5}, {sup 6}H{sub 5/2}) ions, exclusively. All observed 4f – 4f transitions of the Sm{sup 3+} centres in the optical absorption and luminescence spectra of the investigated glasses are identified. Most intense emission band of the Sm{sup 3+} ions peaked about 598 nm ({sup 4}G{sub 5/2} → {sup 6}H{sub 7/2} transition) is characterised by a single exponential decay with typical lifetime values, which depend on the basic glass composition as well as concentration and local structure of the Sm{sup 3+} luminescence centres. The quantum efficiency has been evaluated for observed transitions of the Sm{sup 3+} centres using obtained experimental lifetimes and radiative lifetimes calculated by Judd–Ofelt theory. The calculated high quantum efficiencies and measured quantum yields of luminescence show that the investigated borate glasses are perspective luminescence materials. Energy transfer from the Ce{sup 3+} non-controlled impurity and intrinsic luminescence centres to the Sm{sup 3+} centres has been observed. Peculiarities of the Sm{sup 3+} local structure in the network of investigated glasses have been discussed based on the obtained spectroscopic results and structural data. - Highlights: • The Sm-doped Li{sub 2}B{sub 4}O{sub 7}, LiKB{sub 4}O{sub 7}, Ca
Fracture toughness and flexural strength of Sm(Co,Fe,Cu,Zr)7-8 magnetic alloys
International Nuclear Information System (INIS)
Ren, Libo.; Hadjipanayis, George C.; Parvizi-Majidi, Azar
2003-01-01
This paper presents the results of a parametric investigation of the strength and fracture toughness of Sm 2 Co 17 type permanent magnets in the Sm(Co,Fe,Cu,Zr) 7-8 family of alloys. The strength and fracture toughness of the as-received materials were characterized as a function of temperature, loading direction, and magnetization. Since these magnets are candidates for applications with service temperatures up to 450 deg. C, the effect of thermal exposure on the mechanical properties was determined by characterizing the properties after a thermal treatment of 40 h at 450 deg. C
DEFF Research Database (Denmark)
Larsen, Inge Marie
2001-01-01
Afhandlingen følger opbygningen af og udviklingen i den vestsibiriske smørsektor og den internationale handel med sibirisk smør. Hvordan gik det til, at Rusland blev verdens næststørste smøreksportør? Indfaldsvinkelen er lokal sibirisk, national russisk og global, idet danske og engelske firmaers...
Crystal growth and optical properties of Sm:CaNb2O6 single crystal
International Nuclear Information System (INIS)
Di Juqing; Xu Xiaodong; Xia Changtai; Zeng Huidan; Cheng Yan; Li Dongzhen; Zhou Dahua; Wu Feng; Cheng Jimeng; Xu Jun
2012-01-01
Highlights: ► Sm:CaNb 2 O 6 single crystal was grown by the Czochralski method. ► Thermal expansion coefficients and J–O parameters were calculated. ► We found that this crystal had high quantum efficiency of 97%. - Abstract: Sm:CaNb 2 O 6 single crystal has been grown by the Czochralski method. Its high-temperature X-ray powder diffraction, optical absorption, emission spectroscopic as well as lifetime have been studied. Thermal expansion coefficients (α), J–O parameters (Ω i ), radiative lifetime (τ rad ), branching ratios (β) and stimulated emission cross-sections (σ e ) were calculated. The quantum efficiency (η) was calculated to be 97%. The intense peak emission cross section at 610, 658 nm were calculated to be 2.40 × 10 −21 , 2.42 × 10 −21 cm 2 . These results indicate that Sm:CaNb 2 O 6 crystal has potential use in visible laser and photonic devices area.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Taylor Creek, navigation lock (S-193) across the entrance to Taylor Creek at Lake Okeechobee, Okeechobee, Fla.; use, administration..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.170d Taylor Creek, navigation lock...
Curie temperature rising by fluorination for Sm2Fe17
Directory of Open Access Journals (Sweden)
Matahiro Komuro
2013-02-01
Full Text Available Fluorine atoms can be introduced to Sm2Fe17 using XeF2 below 423 K. The resulting fluorinated Sm2Fe17 powders have ferromagnetic phases containing Sm2Fe17FY1(0
Directory of Open Access Journals (Sweden)
Natan Raimundo Gonçalves de Assis
Full Text Available Schistosomiasis is an important parasitic disease worldwide that affects more than 207 million people in 76 countries and causes approximately 250,000 deaths per year. The best long-term strategy to control schistosomiasis is through immunization combined with drug treatment. Due to the ability of DNA vaccines to generate humoral and cellular immune responses, such vaccines are considered a promising approach against schistosomiasis. Sm29 and tetraspanin-2 (Sm-TSP2 are two proteins that are located in the S. mansoni tegument of adult worms and schistosomula and induce high levels of protection through recombinant protein immunization. In this study, we transfected BHK-21 cells with plasmids encoding Sm29, Sm-TSP2 or a chimera containing both genes. Using RT-PCR analysis and western blot, we confirmed that the DNA vaccine constructs were transcribed and translated, respectively, in BHK-21 cells. After immunization of mice, we evaluated the reduction in worm burden. We observed worm burden reductions of 17-22%, 22%, 31-32% and 24-32% in animals immunized with the pUMVC3/Sm29, pUMVC3/SmTSP-2, pUMVC3/Chimera and pUMVC3/Sm29 + pUMVC3/SmTSP-2 plasmids, respectively. We evaluated the humoral response elicited by DNA vaccines, and animals immunized with pUMVC3/Sm29 and pUMVC3/Sm29 + pUMVC3/SmTSP-2 showed higher titers of anti-Sm29 antibodies. The cytokine profile produced by the spleen cells of immunized mice was then evaluated. We observed higher production of Th1 cytokines, such as TNF-α and IFN-γ, in vaccinated mice and no significant production of IL-4 and IL-5. The DNA vaccines tested in this study showed the ability to generate a protective immune response against schistosomiasis, probably through the production of Th1 cytokines. However, future strategies aiming to optimize the protective response induced by a chimeric DNA construct need to be developed.
Gonçalves de Assis, Natan Raimundo; Batistoni de Morais, Suellen; Figueiredo, Bárbara Castro Pimentel; Ricci, Natasha Delaqua; de Almeida, Leonardo Augusto; da Silva Pinheiro, Carina; Martins, Vicente de Paulo; Oliveira, Sergio Costa
2015-01-01
Schistosomiasis is an important parasitic disease worldwide that affects more than 207 million people in 76 countries and causes approximately 250,000 deaths per year. The best long-term strategy to control schistosomiasis is through immunization combined with drug treatment. Due to the ability of DNA vaccines to generate humoral and cellular immune responses, such vaccines are considered a promising approach against schistosomiasis. Sm29 and tetraspanin-2 (Sm-TSP2) are two proteins that are located in the S. mansoni tegument of adult worms and schistosomula and induce high levels of protection through recombinant protein immunization. In this study, we transfected BHK-21 cells with plasmids encoding Sm29, Sm-TSP2 or a chimera containing both genes. Using RT-PCR analysis and western blot, we confirmed that the DNA vaccine constructs were transcribed and translated, respectively, in BHK-21 cells. After immunization of mice, we evaluated the reduction in worm burden. We observed worm burden reductions of 17-22%, 22%, 31-32% and 24-32% in animals immunized with the pUMVC3/Sm29, pUMVC3/SmTSP-2, pUMVC3/Chimera and pUMVC3/Sm29 + pUMVC3/SmTSP-2 plasmids, respectively. We evaluated the humoral response elicited by DNA vaccines, and animals immunized with pUMVC3/Sm29 and pUMVC3/Sm29 + pUMVC3/SmTSP-2 showed higher titers of anti-Sm29 antibodies. The cytokine profile produced by the spleen cells of immunized mice was then evaluated. We observed higher production of Th1 cytokines, such as TNF-α and IFN-γ, in vaccinated mice and no significant production of IL-4 and IL-5. The DNA vaccines tested in this study showed the ability to generate a protective immune response against schistosomiasis, probably through the production of Th1 cytokines. However, future strategies aiming to optimize the protective response induced by a chimeric DNA construct need to be developed. PMID:25942636
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
Summer food habits and trophic overlap of roundtail chub and creek chub in Muddy Creek, Wyoming
Quist, M.C.; Bower, M.R.; Hubert, W.A.
2006-01-01
Native fishes of the Upper Colorado River Basin have experienced substantial declines in abundance and distribution, and are extirpated from most of Wyoming. Muddy Creek, in south-central Wyoming (Little Snake River watershed), contains sympatric populations of native roundtail chub (Gila robusta), bluehead sucker, (Catostomus discobolus), and flannelmouth sucker (C. tatipinnis), and represents an area of high conservation concern because it is the only area known to have sympatric populations of all 3 species in Wyoming. However, introduced creek chub (Semotilus atromaculatus) are abundant and might have a negative influence on native fishes. We assessed summer food habits of roundtail chub and creek chub to provide information on the ecology of each species and obtain insight on potential trophic overlap. Roundtail chub and creek chub seemed to be opportunistic generalists that consumed a diverse array of food items. Stomach contents of both species were dominated by plant material, aquatic and terrestrial insects, and Fishes, but also included gastropods and mussels. Stomach contents were similar between species, indicating high trophic, overlap. No length-related patterns in diet were observed for either species. These results suggest that creek chubs have the potential to adversely influence the roundtail chub population through competition for food and the native fish assemblage through predation.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...
Fracture toughness and flexural strength of Sm(Co,Fe,Cu,Zr){sub 7-8} magnetic alloys
Energy Technology Data Exchange (ETDEWEB)
Ren, Libo. E-mail: ren@me.udel.edu; Hadjipanayis, George C.; Parvizi-Majidi, Azar
2003-02-01
This paper presents the results of a parametric investigation of the strength and fracture toughness of Sm{sub 2}Co{sub 17} type permanent magnets in the Sm(Co,Fe,Cu,Zr){sub 7-8} family of alloys. The strength and fracture toughness of the as-received materials were characterized as a function of temperature, loading direction, and magnetization. Since these magnets are candidates for applications with service temperatures up to 450 deg. C, the effect of thermal exposure on the mechanical properties was determined by characterizing the properties after a thermal treatment of 40 h at 450 deg. C00.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
Kennedy, Ben W.; Langley, Dustin E.
2007-01-01
Executive Summary The U.S. Geological Survey, in cooperation with the Bureau of Land Management, completed an assessment of hydrology, water quality, and trace-element concentrations in streambed sediment of the upper Birch Creek watershed near Central, Alaska. The assessment covered one site on upper Birch Creek and paired sites, upstream and downstream from mined areas, on Frying Pan Creek and Harrison Creek. Stream-discharge and suspended-sediment concentration data collected at other selected mined and unmined sites helped characterize conditions in the upper Birch Creek watershed. The purpose of the project was to provide the Bureau of Land Management with baseline information to evaluate watershed water quality and plan reclamation efforts. Data collection began in September 2001 and ended in September 2005. There were substantial geomorphic disturbances in the stream channel and flood plain along several miles of Harrison Creek. Placer mining has physically altered the natural stream channel morphology and removed streamside vegetation. There has been little or no effort to re-contour waste rock piles. During high-flow events, the abandoned placer-mine areas on Harrison Creek will likely contribute large quantities of sediment downstream unless the mined areas are reclaimed. During 2004 and 2005, no substantial changes in nutrient or major-ion concentrations were detected in water samples collected upstream from mined areas compared with water samples collected downstream from mined areas on Frying Pan Creek and Harrison Creek that could not be attributed to natural variation. This also was true for dissolved oxygen, pH, and specific conductance-a measure of total dissolved solids. Sample sites downstream from mined areas on Harrison Creek and Frying Pan Creek had higher median suspended-sediment concentrations, by a few milligrams per liter, than respective upstream sites. However, it is difficult to attach much importance to the small downstream increase
Magnetic properties of Sm-based filled skutterudite phosphides
Energy Technology Data Exchange (ETDEWEB)
Giri, R.; Sekine, C.; Shimaya, Y.; Shirotani, I.; Matsuhira, K.; Doi, Y.; Hinatsu, Y.; Yokoyama, M.; Amitsuka, H
2003-05-01
Filled skutterudites SmFe{sub 4}P{sub 12} and SmOs{sub 4}P{sub 12} have been prepared at high temperature and high pressure. The temperature dependence of electrical resistivity in both compounds shows metallic behavior. The magnetic susceptibility and specific heat measurements indicate that SmFe{sub 4}P{sub 12} shows a ferromagnetic ordering at 1.5 K, whereas SmOs{sub 4}P{sub 12} is an antiferromagnet with a T{sub N} of 4.6 K.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
Water quality of the Swatara Creek Basin, PA
McCarren, Edward F.; Wark, J.W.; George, J.R.
1964-01-01
The Swatara Creek of the Susquehanna River Basin is the farthest downstream sub-basin that drains acid water (pH of 4.5 or less) from anthracite coal mines. The Swatara Creek drainage area includes 567 square miles of parts of Schuylkill, Berks, Lebanon, and Dauphin Counties in Pennsylvania.To learn what environmental factors and dissolved constituents in water were influencing the quality of Swatara Creek, a reconnaissance of the basin was begun during the summer of 1958. Most of the surface streams and the wells adjacent to the principal tributaries of the Creek were sampled for chemical analysis. Effluents from aquifers underlying the basin were chemically analyzed because ground water is the basic source of supply to surface streams in the Swatara Creek basin. When there is little runoff during droughts, ground water has a dominating influence on the quality of surface water. Field tests showed that all ground water in the basin was non-acidic. However, several streams were acidic. Sources of acidity in these streams were traced to the overflow of impounded water in unworked coal mines.Acidic mine effluents and washings from coal breakers were detected downstream in Swatara Creek as far as Harper Tavern, although the pH at Harper Tavern infrequently went below 6.0. Suspended-sediment sampling at this location showed the mean daily concentration ranged from 2 to 500 ppm. The concentration of suspended sediment is influenced by runoff and land use, and at Harper Tavern it consisted of natural sediments and coal wastes. The average daily suspended-sediment discharge there during the period May 8 to September 30, 1959, was 109 tons per day, and the computed annual suspended-sediment load, 450 tons per square mile. Only moderate treatment would be required to restore the quality of Swatara Creek at Harper Tavern for many uses. Above Ravine, however, the quality of the Creek is generally acidic and, therefore, of limited usefulness to public supplies, industries and
Canyon Creek: A late Pleistocene vertebrate locality in interior Alaska
Weber, Florence R.; Hamilton, Thomas D.; Hopkins, David M.; Repenning, Charles A.; Haas, Herbert
1981-09-01
The Canyon Creek vertebrate-fossil locality is an extensive road cut near Fairbanks that exposes sediments that range in age from early Wisconsin to late Holocene. Tanana River gravel at the base of the section evidently formed during the Delta Glaciation of the north-central Alaska Range. Younger layers and lenses of fluvial sand are interbedded with arkosic gravel from Canyon Creek that contains tephra as well as fossil bones of an interstadial fauna about 40,000 years old. Solifluction deposits containing ventifacts, wedge casts, and rodent burrows formed during a subsequent period of periglacial activity that took place during the maximum phase of Donnelly Glaciation about 25,000-17,000 years ago. Overlying sheets of eolian sand are separated by a 9500-year-old paleosol that may correlate with a phase of early Holocene spruce expansion through central Alaska. The Pleistocene fauna from Canyon Creek consists of rodents (indicated by burrows), Mammuthus primigenius (woolly mammoth), Equus lambei (Yukon wild ass), Camelops hesternus (western camel), Bison sp. cf. B. crassicornis (large-horned bison), Ovis sp. cf. O. dalli (mountain sheep), Canis sp. cf. C. lupus (wolf), Lepus sp. cf. L. othus or L. arcticus (tundra hare), and Rangifer sp. (caribou). This assemblage suggests an open landscape in which trees and tall shrubs were either absent or confined to sheltered and moist sites. Camelops evidently was present in eastern Beringia during the middle Wisconsin interstadial interval but may have disappeared during the following glacial episode. The stratigraphic section at Canyon Creek appears to demonstrate that the Delta Glaciation of the north-central Alaska Range is at least in part of early Wisconsin age and was separated from the succeeding Donnelly Glaciation by an interstadial rather than interglacial episode.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
23 CFR 660.113 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...
77 FR 10960 - Drawbridge Operation Regulation; Snake Creek, Islamorada, FL
2012-02-24
... Operation Regulation; Snake Creek, Islamorada, FL AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... deviation from the regulation governing the operation of Snake Creek Bridge, mile 0.5, across Snake Creek... schedule of Snake Creek Bridge in Islamorada, Florida. This deviation will result in the bridge opening...
33 CFR 117.917 - Battery Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw of...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Rice Creek. 117.324 Section 117.324 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.324 Rice Creek. The CSX Railroad Swingbridge, mile...
33 CFR 117.231 - Brandywine Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Brandywine Creek. 117.231 Section 117.231 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.231 Brandywine Creek. The draw of the...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bear Creek. 117.543 Section 117.543 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.543 Bear Creek. (a) The draws of the Baltimore...
Arterial injury promotes medial chondrogenesis in Sm22 knockout mice.
Shen, Jianbin; Yang, Maozhou; Jiang, Hong; Ju, Donghong; Zheng, Jian-Pu; Xu, Zhonghui; Liao, Tang-Dong; Li, Li
2011-04-01
Expression of SM22 (also known as SM22alpha and transgelin), a vascular smooth muscle cells (VSMCs) marker, is down-regulated in arterial diseases involving medial osteochondrogenesis. We investigated the effect of SM22 deficiency in a mouse artery injury model to determine the role of SM22 in arterial chondrogenesis. Sm22 knockout (Sm22(-/-)) mice developed prominent medial chondrogenesis 2 weeks after carotid denudation as evidenced by the enhanced expression of chondrogenic markers including type II collagen, aggrecan, osteopontin, bone morphogenetic protein 2, and SRY-box containing gene 9 (SOX9). This was concomitant with suppression of VSMC key transcription factor myocardin and of VSMC markers such as SM α-actin and myosin heavy chain. The conversion tendency from myogenesis to chondrogenesis was also observed in primary Sm22(-/-) VSMCs and in a VSMC line after Sm22 knockdown: SM22 deficiency altered VSMC morphology with compromised stress fibre formation and increased actin dynamics. Meanwhile, the expression level of Sox9 mRNA was up-regulated while the mRNA levels of myocardin and VSMC markers were down-regulated, indicating a pro-chondrogenic transcriptional switch in SM22-deficient VSMCs. Furthermore, the increased expression of SOX9 was mediated by enhanced reactive oxygen species production and nuclear factor-κB pathway activation. These findings suggest that disruption of SM22 alters the actin cytoskeleton and promotes chondrogenic conversion of VSMCs.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smith Creek. 117.841 Section 117.841 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.841 Smith Creek. The draw of the S117-S133...
33 CFR 117.335 - Taylor Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Creek. 117.335 Section 117.335 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.335 Taylor Creek. The draw of US441 bridge, mile 0...
Baruch Institute for Marine and Coastal Sciences, Univ of South Carolina — The CREEK Project began in January of 1996 and was designed to help determine the role of oysters, Crassostrea virginica, in tidal creeks of the North Inlet Estuary,...
Assessment of microseeds biodegradability of Sm and Sm:Ba splenic implants in rabbits
International Nuclear Information System (INIS)
Siqueira, Savio Lana; Barroso, Thiago Vinicius Villar; Campos, Tarcisio P.R.
2009-01-01
The radioactive interstitial implants have applications in controlling neoplasm in several regions of the human body. Currently the permanent brachytherapy seeds implanted in the spleen and other organs are made of I-125 seeds. After the total emission of radiation, the metal encapsulated seed remains inert in the implanted area. Seeds of bioactive ceramics have been prepared with Sm-152 incorporation to be activated in Sm-153. This study aimed to develop surgical technique for implanting biodegradable micro-seeds in the spleen of the rabbit. Three micro-seeds were introduced by hypodermic needle in the spleen in eight rabbits by median laparotomy. Subsequently, there were clinical and functional reactions of the animal to the implanted foreign body. The other objective was to perform the animal monitoring by radiography, produced in time sequence, and pathological studies of a fragment of the spleens of rabbits. The results show the effectiveness of surgery, the identification of the implanted material by radiography in vivo, and the biocompatibility of micro-seeds most of Sm and Sm:Ba. These seeds of reduced volume, 0.3x 1.6 mm, could be monitored for radiological studies in 2 periods: early and later implant. On the later studies, radiography was taken at 60d post-implant. Biopsies were taken and radiographs of the samples were also performed for evidencing the degradation state of the seeds. The results of the two groups of four rabbits are presented. They show partial degradation of the seed verified by radiographic contrast which is related to the atomic number of the elements and mass density in the seed. The biopsy showed that the ceramic is clearly absorbed by the spleen tissue and form tissue-implant interface. The histological slides showed an inflammatory reaction with presence of fibrosis of the giant cell foreign body. In conclusion, the radiograph shows a suitable noninvasive technique for monitoring the degradation of micro-seed ceramics in vivo
Assessment of microseeds biodegradability of Sm and Sm:Ba splenic implants in rabbits
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Savio Lana; Barroso, Thiago Vinicius Villar [Faculdade de Ciencias Medicas de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Anatomia; Campos, Tarcisio P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Programa de Ciencias e Tecnicas Nucleares
2009-07-01
The radioactive interstitial implants have applications in controlling neoplasm in several regions of the human body. Currently the permanent brachytherapy seeds implanted in the spleen and other organs are made of I-125 seeds. After the total emission of radiation, the metal encapsulated seed remains inert in the implanted area. Seeds of bioactive ceramics have been prepared with Sm-152 incorporation to be activated in Sm-153. This study aimed to develop surgical technique for implanting biodegradable micro-seeds in the spleen of the rabbit. Three micro-seeds were introduced by hypodermic needle in the spleen in eight rabbits by median laparotomy. Subsequently, there were clinical and functional reactions of the animal to the implanted foreign body. The other objective was to perform the animal monitoring by radiography, produced in time sequence, and pathological studies of a fragment of the spleens of rabbits. The results show the effectiveness of surgery, the identification of the implanted material by radiography in vivo, and the biocompatibility of micro-seeds most of Sm and Sm:Ba. These seeds of reduced volume, 0.3x 1.6 mm, could be monitored for radiological studies in 2 periods: early and later implant. On the later studies, radiography was taken at 60d post-implant. Biopsies were taken and radiographs of the samples were also performed for evidencing the degradation state of the seeds. The results of the two groups of four rabbits are presented. They show partial degradation of the seed verified by radiographic contrast which is related to the atomic number of the elements and mass density in the seed. The biopsy showed that the ceramic is clearly absorbed by the spleen tissue and form tissue-implant interface. The histological slides showed an inflammatory reaction with presence of fibrosis of the giant cell foreign body. In conclusion, the radiograph shows a suitable noninvasive technique for monitoring the degradation of micro-seed ceramics in vivo
Bridge Creek IMW database - Bridge Creek Restoration and Monitoring Project
National Oceanic and Atmospheric Administration, Department of Commerce — The incised and degraded habitat of Bridge Creek is thought to be limiting a population of ESA-listed steelhead (Oncorhynchus mykiss). A logical restoration approach...
Trials to optimize dosimetry for 153Sm-EDTMP therapy to improve therapeutic effects
International Nuclear Information System (INIS)
Riccabona, G.; Moncayo-Naveda, R.; Oberlandstaetter, M.; Donnemiller, E.; Kendler, D.
2001-01-01
In a trial to improve results of therapy with 153 Sm-EDTMP for pain control in patients with disseminated bone metastases dosimetric studies were performed. Out of 30 treated patients 8 were selected for the study at random (5 breast Ca., 3 prostate Ca.). Whole body retention (WBR) of 99m Tc-DPD and 99m Tc-EDTMP was compared with WBR of 153 Sm-EDTMP. Volume of metastases and regional 99 m Tc-phosphonate uptake were assessed by SPECT and conjugated whole body scan data after phantom studies. Effective half-life was estimated also. Clinically results of pain control, side effects and changes of in vitro parameters were followed after therapy for up to 8 months. Therapy was performed in these patients with 55,5 MBq/kg body weight. Results showed an identical pattern of radioactivity distribution on 99 Tc-phosphonate and 153 Sm-EDTMP posttherapy scans, WBR of tracers and therapeutic agent was similar. Tumour volumes were 151-652 mL, count ratios metastases/normal bone 1,72-2,41, so that 6-50% of applied 153 Sm-EDTMP were concentrated in bone lesions. This gave dose estimates of 2,8-13,7 Gy in metastases. Evaluation of clinical results showed that the majority of very good results were observed in patients receiving > 10 Gy (n=3) while with lower doses only 1/4 responded very well. 1 patient was lost to follow-up due to death in the first month after therapy. Moderate and transient myelodepression (platelets) was seen in 3/7 patients without relation to Gy applied. As obviously 153 Sm concentration is not homogenous in bone metastases it can be assumed, that in border zones between tumour and bone 30-40 Gy can be delivered when 10 Gy are calculated for the whole lesion, which would explain the satisfactory therapeutic effect in our study. The dosimetric approach to 153 Sm-EDTMP therapy could necessitate the application of higher amounts of 153 Sm-EDTMP to reach adequate radiation doses in lesions without necessarily increasing risk of myelodepression and with even
The monoclonal antibody SM5-1 recognizes a fibronectin variant which is widely expressed in melanoma
Directory of Open Access Journals (Sweden)
Guo Yajun
2006-01-01
Full Text Available Abstract Background Previously we have generated the monoclonal antibody SM5-1 by using a subtractive immunization protocol of human melanoma. This antibody exhibits a high sensitivity for primary melanomas of 99% (248/250 tested and for metastatic melanoma of 96% (146/151 tested in paraffin embedded sections. This reactivity is superior to the one obtained by HMB-45, anti-MelanA or anti-Tyrosinase and is comparable to anti-S100. However, as compared to anti-S100, the antibody SM5-1 is highly specific for melanocytic lesions since 40 different neoplasms were found to be negative for SM5-1 by immunohistochemistry. The antigen recognized by SM5-1 is unknown. Methods In order to characterize the antigen recognized by mAb SM5-1, a cDNA library was constructed from the metastatic human melanoma cell line SMMUpos in the Uni-ZAP lambda phage and screened by mAb SM5-1. The cDNA clones identified by this approach were then sequenced and subsequently analyzed. Results Sequence analysis of nine independent overlapping clones (length 3100–5600 bp represent fibronectin cDNA including the ED-A, but not the ED-B region which are produced by alternative splicing. The 89aa splicing variant of the IIICS region was found in 8/9 clones and the 120aa splicing variant in 1/9 clones, both of which are included in the CS1 region of fibronectin being involved in melanoma cell adhesion and spreading. Conclusion The molecule recognized by SM5-1 is a melanoma associated FN variant expressed by virtually all primary and metastatic melanomas and may play an important role in melanoma formation and progression. This antibody is therefore not only of value in immunohistochemistry, but potentially also for diagnostic imaging and immunotherapy.
Asotin Creek Model Watershed Plan
Energy Technology Data Exchange (ETDEWEB)
Browne, D.; Holzmiller, J.; Koch, F.; Polumsky, S.; Schlee, D.; Thiessen, G.; Johnson, C.
1995-04-01
The Asotin Creek Model Watershed Plan is the first to be developed in Washington State which is specifically concerned with habitat protection and restoration for salmon and trout. The plan is consistent with the habitat element of the ``Strategy for Salmon``. Asotin Creek is similar in many ways to other salmon-bearing streams in the Snake River system. Its watershed has been significantly impacted by human activities and catastrophic natural events, such as floods and droughts. It supports only remnant salmon and trout populations compared to earlier years. It will require protection and restoration of its fish habitat and riparian corridor in order to increase its salmonid productivity. The watershed coordinator for the Asotin County Conservation District led a locally based process that combined local concerns and knowledge with technology from several agencies to produce the Asotin Creek Model Watershed Plan.
Dudas, F.O.; Ispolatov, V.O.; Harlan, S.S.; Snee, L.W.
2010-01-01
We report geochronological and geochemical data for the calc-alkalic Lowland Creek volcanic field (LCVF) in westcentral Montana. 40Ar/ 39Ar age determinations show that the LCVF was active from 52.9 to 48.6 Ma, with tuff-forming eruptions at 52.9 ?? 0.14 and 51.8 ?? 0.14 Ma. These dates span the age range of vigorous Eocene igneous activity in the Kamloops-Absaroka-Challis belt. The LCVF evolved upward from basal rhyolites (SiO 2>71 wt%) to dacites and andesites (SiO 2 > 62 wt%). Compositional change parallels a transition from early explosive volcanism to late effusive activity. Four geochemical components can be detected in the rocks. A component with 206Pb/204Pb 18.3 and epsilon;Nd>-9 contain a third component; and an andesite with low Nd content and epsilon;Nd near-9 probably contains a fourth component. The first three components probably derive from the lower and middle crust, whereas the fourth is probably from the lithospheric mantle. ?? 2010 by The University of Chicago.
Sandhya, K L; Chandani, A D L; Fukuda, Atsuo; Vij, Jagdish K; Emelyanenko, A V; Ishikawa, Ken
2013-01-01
In the binary mixture phase diagram of MC881 and MC452, the borderline between anticlinic antiferroelectric SmC(A)(*) and synclinic ferroelectric SmC(*) becomes apparently parallel to the temperature ordinate axis at the critical concentration r(c). The free energy difference between SmC(A)(*) and SmC^{*} is extremely small in a wide temperature range near r(c). In such circumstances, by observing Bragg reflection spectra due to the director helical structure and electric-field-induced birefringence, we have observed the continuous change from SmC(A)(*) to SmC(*) for r/~r(c). These intriguing phenomena have been explained, successfully at least in the high-temperature region, by a thermal equilibrium between the synclinic and anticlinic orderings and the resulting Boltzmann distribution for the ratio between them; the thermal equilibrium is considered to be attained in a nonuniform defect-assisted way through solitary waves moving around dynamically. We have also discussed qualitatively an important role played by the effective long-range interlayer interactions in the low-temperature region.
Cannon, M.R.
1985-01-01
Otter Creek drains an area of 709 square miles in the coal-rich Powder River structural basin of southeastern Montana. The Knobloch coal beds in the Tongue River Member of the Paleocene Fort Union Formation is a shallow aquifer and a target for future surface mining in the downstream part of the Otter Creek basin. A mass-balance model was used to estimate the effects of potential mining on the dissolved solids concentration in Otter Creek and in the alluvial aquifer in the Otter Creek valley. With extensive mining of the Knobloch coal beds, the annual load of dissolved solids to Otter Creek at Ashland at median streamflow could increase by 2,873 tons, or a 32-percent increase compared to the annual pre-mining load. Increased monthly loads of Otter Creek, at the median streamflow, could range from 15 percent in February to 208 percent in August. The post-mining dissolved solids load to the subirrigated part of the alluvial valley could increase by 71 percent. The median dissolved solids concentration in the subirrigated part of the valley could be 4,430 milligrams per liter, compared to the pre-mining median concentration of 2,590 milligrams per liter. Post-mining loads from the potentially mined landscape were calculated using saturated-paste-extract data from 506 overburdened samples collected from 26 wells and test holes. Post-mining loads to the Otter Creek valley likely would continue at increased rates for hundreds of years after mining. If the actual area of Knobloch coal disturbed by mining were less than that used in the model, post-mining loads to the Otter Creek valley would be proportionally smaller. (USGS)
Synthesis and bio-evaluation of nano-hydroxyapatite trapped by 153Sm
International Nuclear Information System (INIS)
Bing Wenzeng; Luo Shunzhong; Wen Guanghua; Jiang Shubin; Xiong Xiaoling; Liu Guoping
2006-03-01
After nanoHA was synthesized, 153 Sm-EDTMP-nanoHA and 153 Sm-citrate-nanoHA were prepared and proved stable in vitro. ECT images of New Zealand rabbits injected with 153 Sm-EDTMP-nanoHA had better contrast, skeletal figure visible, liver and spleen clear. The images of 153 Sm-citrate-nanoHA showed a similar results but kidney invisible, which meant 153 Sm-citrate-nanoHA showed a similar results but kidney invisible, which meant 153 Sm-citrate-nanoHA was mainly excreted through liver and gall. 153 Sm-EDTMP-nanoHA's half effective inhibition concentrations to SMMC-7721 and MCF-7 cells were 1.98 g/L and 0.075 g/L respectively and 153 Sm-citrate-nanoHA's were 1.89 g/L and 0.094 g/L proportionally. 153 Sm-EDTMP-nanoHA and 153 Sm-citrate-nanoHA were worthy of a further research because their half effective inhibition concentrations were much lower than ones of the single nanoHA. (authors)
Nanocrystallization in Cu-Zr-Al-Sm Bulk Metallic Glasses
Sikan, Fatih; Yasar, Bengisu; Kalay, Ilkay
2018-04-01
The effect of rare-earth element (Sm) microalloying on the thermal stability and crystallization kinetics of melt-spun ribbons and suction-cast rods of Zr48Cu38.4Al9.6Sm4 alloy were investigated using differential scanning calorimetry (DSC), X-ray diffraction (XRD), transmission electron microscopy (TEM), and atom probe tomography (APT). The XRD results of constant heating rate annealing indicated that amorphous Zr48Cu38.4Al9.6Sm4 melt-spun ribbons devitrifies into Cu2Sm at 673 K (400 °C). The sequence continues with the precipitation of Cu10Zr7 and then these two phases coexist. XRD and TEM studies on 1 mm diameter as suction-cast rods indicated the precipitation of 30-nm-mean size Cu2Sm crystals during solidification. TEM investigation of the isothermal crystallization sequence of melt-spun ribbons and 1-mm-diameter suction-cast rods revealed the precipitation of Cu2Sm nanocrystals at the onset of crystallization and the restriction of the growth of these nanocrystals up to 10 nm diameter with further annealing. APT analysis of 1-mm-diameter suction-cast rods showed that the limited growth of Cu2Sm nanocrystals is due to sluggish diffusion of Sm and Al-Zr pile up at the interface.
Sources of baseflow for the Minnehaha Creek Watershed, Minnesota, US
Nieber, J. L.; Moore, T. L.; Gulliver, J. S.; Magner, J. A.; Lahti, L. B.
2013-12-01
Minnehaha Creek is among the most valued surface water features in the Minneapolis, MN metro area, with a waterfall as it enters the Minnehaha Creek park. Flow in Minnehaha Creek is heavily dependent on discharge from the stream's origin, Lake Minnetonka, the outlet of which is closed during drought periods to maintain water elevations in the lake resulting in low- (or no-) flow conditions in the creek. Stormwater runoff entering directly to the creek from the creek's largely urbanized watershed exacerbates extremes in flow conditions. Given the cultural and ecological value of this stream system, there is great interest in enhancing the cultural and ecosystem services provided by Minnehaha Creek through improvements in streamflow regime by reducing flashiness and sustaining increased low-flows. Determining the potential for achieving improvements in flow requires first that the current sources of water contributing to low-flows in the creek be identified and quantified. Work on this source identification has involved a number of different approaches, including analyses of the streamflow record using a hydrologic system model framework, examination of the Quaternary and bedrock geology of the region, estimation of groundwater-surface water exchange rates within the channel using hyporheic zone temperature surveys and flux meter measurements, and analyses of the stable isotopes of oxygen and hydrogen in samples of stream water, groundwater, and rainfall. Analysis of baseflow recessions using the method of Brutsaert and Nieber (1977) indicates that only a small portion of the catchment, probably the riparian zone, contributes to baseflows. This result appears to be supported by the observation that the limestone/shale bedrock layer underlying the surficial aquifer has a non-zero permeability, and in a significant portion of the watershed the layer has been eroded away leaving the surficial aquifer ';bottomless' and highly susceptible to vertical (down) water loss
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Swan Creek. 9.211 Section 9.211 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS AMERICAN VITICULTURAL AREAS Approved American Viticultural Areas § 9.211 Swan Creek. (a) Name. The name of the viticultural are...
Currents and siltation at Dharamtar creek, Bombay
Digital Repository Service at National Institute of Oceanography (India)
Swamy, G.N.; Kolhatkar, V.M.; Fernandes, A.A.
Hydrographic data collected in Dharamtar Creek during 1976-77 have been analysed. This showed that the waters in the Creek are well mixed and the salinity varied with the tide. The tidal currents are found to be generally strong. The distribution...
DEFF Research Database (Denmark)
Rivera, Tiffany; Storey, Michael; Schmitz, M. D.
2013-01-01
, and have less pronounced positive Ce and negative Eu anomalies, lower incompatible trace element contents, higher TiZR temperatures that range up to 840 °C, and significantly younger dates. The youngest Group A dates yield a weighted mean of 1.1978 ± 0.0046 Ma (2σ, including systematic uncertainties...... with the astronomical age estimate for the Cobb Mountain subchron determined by correlating the oxygen isotope record of the giant piston core MD972143 to the La93(1,1) orbital solution. On the basis of independent radio-isotopic and orbital forcing results, we propose the refined age of 1.1850 ± 0.0016 Ma (2σ external......We report results from a 40Ar/39Ar sanidine and CA-TIMS 238U/206Pb zircon dating study of eruption and crystal residence timescales of the Alder Creek Rhyolite (ACR), California, extruded during the Cobb Mountain normal-polarity subchron (C1r.2n). A 40Ar/39Ar ACR sanidine date of 1.1850 ± 0.0016 Ma...
Gamma ray irradiation characteristics of SM fibers
International Nuclear Information System (INIS)
Ito, Ryuichi; Okano, Hiroaki; Hashiba, Keichi; Nakai, Hisanori
1987-01-01
1.3 μm range single mode (SM) optical fibers have been used for wide application of mainly long distance communication. At present, in order to realize the larger capacity and longer distance between relay points, the development of 1.5 μm range SM fibers of low dispersion and small loss has been actively promoted. As for the radiation withstanding property of SM fibers, report is scarce. The authors reported on the gamma ray irradiation characteristics of 1.3 μm range SM fibers, but since 1.5 μm range SM fibers are designed with the different structure from that of 1.3 μm fibers, it is necessary to evaluate from new viewpoint. In this report, mainly on the structure having triangular distribution, the effect that the manufacturing condition and the structural defects of glass exert on the gamma ray irradiation characteristics is described. The specimens were mainly dispersion shift type fibers (DSF), and for comparison, single window, double window and 1.3 μm SM fibers were examined. Co-60 gamma ray was irradiated, and the optical loss and electron spin resonance were measured. By low temperature and low speed drawing, the good result in the optical loss was obtained. The presence of oxygen at the time of sintering materials had no effect. The dependence of the ESR on the drawing condition was not very remarkable. (Kako, I.)
14 CFR 1240.113 - Financial accounting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...
48 CFR 49.113 - Cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
Uma, V.; Vijayakumar, M.; Marimuthu, K.; Muralidharan, G.
2018-01-01
A new series of Sm3+/Tb3+ codoped telluroborate glasses have been prepared by conventional melt quenching technique with the chemical composition (40-x-y)B2O3+15TeO2+15Li2O+15LiF+15NaF+xTb2O3+ySm2O3 (where x = 0, 0.5; y = 0, 0.05, 0.1, 0.25, 0.5, 1 and 2 wt%). The structural and optical behaviour of the prepared glasses were investigated through Fourier transform infrared spectroscopy (FTIR), optical absorption, photoluminescence and lifetime measurements. The fundamental vibrational units of the borate and tellurite network have been identified through FTIR spectra. Nephelauxetic ratio (βbar) and bonding parameter (δ) values indicate that the Smsbnd O bonds are ionic in nature. The characteristic emissions of terbium (543 nm, green) and samarium (645 nm, orange-red) were observed while exciting the Tb3+ ions. Higher magnitude of asymmetric intensity ratio (AIR) values confirms the higher asymmetry around the Sm3+ ion site. Decay profiles of Tb3+ ions (5D4 state) and Sm3+ ions (4G9/2 state) exhibit double exponential nature. The nature of interaction between the donor (Tb3+) and acceptor (Sm3+) has been analyzed through Inokuti-Hirayama (IH) model. Energy transfer from Tb3+ to Sm3+ ions is dominated by dipole-dipole type interaction. TBLT0.5S glass possess the better colour coordinates (0.41, 0.45) and colour correlated temperature (CCT) value (3524 K) and the same is suggested for eye safe warm white light emitting applications.
42 CFR 56.113 - Grantee accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...
Hagstrum, J.T.; Swanson, D.A.; Snee, L.W.
1998-01-01
Paleomagnetic study of the intrusive suite of Kidd Creek in the southern Washington Cascades (23 sites in dikes and sills) was undertaken to help determine if these rocks are comagmatic and whether they postdate regional folding of the volcanic arc. Fission track and 40Ar-39Ar age determinations indicate an age of ???12.7 Ma (middle Miocene) for these rocks. The similarity of normal-polarity characteristic directions for most samples corroborate the available geochemical data indicating that these rocks are most likely comagmatic. Reversed-polarity directions for samples from four sites, however, show that emplacement of Kidd Creek intrusions spanned at least one reversal of the geomagnetic field. The paleomagnetic directions for the dikes and sills fail a fold test at the 99% confidence level indicating that the Kidd Creek rocks postdate regional folding. The mean in situ direction also indicates that the Kidd Creek and older rocks have been rotated 22?? ?? 6?? clockwise about a vertical or near-vertical axis from the expected Miocene direction. Compression and regional folding of the Cascade arc in southern Washington therefore had ended by ???12 Ma prior to the onset of deformation resulting in rotation of these rocks.
Baruch Institute for Marine and Coastal Sciences, Univ of South Carolina — A group of eight intertidal creeks with high densities of oysters, Crassostrea virginica, in North Inlet Estuary, South Carolina, USA were studied using a replicated...
24 CFR 27.113 - Foreclosure costs.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...
10 CFR 71.113 - Document control.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...
International Nuclear Information System (INIS)
Gasiglia, Haroldo Taurian
2000-01-01
This work presents a study on the preparation of the complexes 1 53S m - EDTMP, 153 Sm - HEDP, 153 Sm - NTMP, 153 Sm - DTPMP and 153 Sm - HDTMP at room temperature. The preparation of the complex 153 Sm - HDTMP, under heating (70 - 72 deg C), was also studied. Several factors affecting the 153 Sm - EDTMP complexing yields were studied, due to its importance for use in Nuclear Medicine. These factors were: the molar ratio [ligand] / [metal], the ligand concentration and the incubation time of the mixture ligand-metal. The preparation of this complex, in low molar ratios, was also investigated. A study of the 153 Sm - EDTMP concerning the 'in vitro' stability, when this complex was prepared in low radioactive concentrations was performed. A study on the temperature influence on its degradation, when this complex was obtained in higher radioactive concentrations, was also performed. The preparation of the complexes 153 Sm - HEDP, 153 Sm - NTMP, 153 Sm - DTPMP and 153 Sm - HDTMP was investigated by preparing the complexes in two situations: high molar ratio and ligand concentration and low molar ratio and ligand concentration. The 'in vitro' stability of each complex, obtained in low radioactive concentration was studied. In the specific case of the complex 153 Sm - HDTMP, its biological distribution in mice was performed. All the complexes were investigated by high performance liquid chromatography (HPLC) and its complexing yields were determined by other three chromatographic processes: ionic exchange, thin layer chromatography (TLC - SG) and paper chromatography. The chromatographic processes were performed by association with specific radiochemical techniques. This work also presents a comparative study on the chromatograms obtained by thin layer chromatography (TLC - SG) and paper chromatography, when evaluated by the technique of cutting the strips into pieces and the chromatograms performed directly on a radiochromatography. The shape of the chromatograms and R
9 CFR 113.7 - Multiple fractions.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
Structural and Magnetic Properties of Sm Implanted GaN
International Nuclear Information System (INIS)
Li-Juan, Jiang; Xiao-Liang, Wang; Hong-Ling, Xiao; Zhan-Guo, Wang; Chun, Feng; Ming-Lan, Zhang; Jian, Tang
2009-01-01
The structural and magnetic properties of Sm ion-implanted GaN with different Sm concentrations are investigated. XRD results do not show any peaks associated with second phase formation. Magnetic investigations performed by superconducting quantum interference device reveal ferromagnetic behavior with an ordering temperature above room temperature in all the implanted samples, while the effective magnetic moment per Sm obtained from saturation magnetization gives a much higher value than the atomic moment of Sm. These results could be explained by the phenomenological model proposed by Dhar et al. [Phys. Rev. Lett. 94(2005)037205, Phys. Rev. B 72(2005)245203] in terms of a long-range spin polarization of the GaN matrix by the Sm atoms. (condensed matter: electronicstructure, electrical, magnetic, and opticalproperties)
Production of high-specific activity radionuclides using SM high-flux reactor
International Nuclear Information System (INIS)
Karelin, Ye.A.; Toporov, Yu.G.; Filimonov, V.T.; Vakhetov, F.Z.; Tarasov, V.A.; Kuznetsov, R.A.; Lebedev, V.M.; Andreev, O.I.; Melnik, M.I.; Gavrilov, V.D.
1997-01-01
The development of High Specific Activity (HSA) radionuclides production technologies is one of the directions of RIAR activity, and the high flux research reactor SM, having neutron flux density up to 2.10 15 cm -2 s 1 in a wide range of neutron spectra hardness, plays the principal role in this development. The use of a high-flux reactor for radionuclide production provides the following advantages: production of radionuclides with extremely high specific activity, decreasing of impurities content in irradiated targets (both radioactive and non-radioactive), cost-effective use of expensive isotopically enriched target materials. The production technologies of P-33, Gd-153, W-188, Ni-63, Fe-55,59, Sn-113,117m,119m, Sr- 89, applied in industry, nuclear medicine, research, etc, were developed by RIAR during the last 5-10 years. The research work included the development of calculation procedures for radionuclide reactor accumulation forecast, experimental determination of neutron cross-sections, the development of irradiated materials reprocessing procedures, isolation and purification of radionuclides. The principal results are reviewed in the paper. (authors)
Emission properties of Sm(III) complex having ten-coordination structure
International Nuclear Information System (INIS)
Hasegawa, Yasuchika; Tsuruoka, Shin-ichi; Yoshida, Takahiko; Kawai, Hideki; Kawai, Tsuyoshi
2008-01-01
Sammarium(III) complex having ten-coordination structure, bis-(1,10-phenanthroline)tris-(hexafluoroacetylacetonato)samarium(III) (Sm(hfa) 3 (phen) 2 ) was prepared by chelation of tris-(hexafluoroacetylacetonato) samarium(III) (Sm(hfa) 3 (H 2 O) 2 ) with 1,10-phenantroline (phen). The characteristic ten-coordination structure of Sm(hfa) 3 (phen) 2 was determined by 1 H NMR and elemental analyses. Strong deep-red emission (λ max =643 nm) and narrow emission band (FWHM=5 nm) of Sm(hfa) 3 (phen) 2 originated from electronic allowed transition from characteristics ten coordinate structure. The emission quantum yields Sm(hfa) 3 (phen) 2 excited at absorption bands of ligands and Sm(III) ion were found to be 0.36 and 1.4%, respectively
Lambert, Rebecca B.; Opsahl, Stephen P.; Musgrove, MaryLynn
2017-12-22
Located in south-central Texas, the Geronimo Creek and Plum Creek watersheds have long been characterized by elevated nitrate concentrations. From April 2015 through March 2016, an assessment was done by the U.S. Geological Survey, in cooperation with the Guadalupe-Blanco River Authority and the Texas State Soil and Water Conservation Board, to characterize nitrate concentrations and to document possible sources of elevated nitrate in these two watersheds. Water-quality samples were collected from stream, spring, and groundwater sites distributed across the two watersheds, along with precipitation samples and wastewater treatment plant (WWTP) effluent samples from the Plum Creek watershed, to characterize endmember concentrations and isotopic compositions from April 2015 through March 2016. Stream, spring, and groundwater samples from both watersheds were collected during four synoptic sampling events to characterize spatial and temporal variations in water quality and chemical loadings. Water-quality and -quantity data from the WWTPs and stream discharge data also were considered. Samples were analyzed for major ions, selected trace elements, nutrients, and stable isotopes of water and nitrate.The dominant land use in both watersheds is agriculture (cultivated crops, rangeland, and grassland and pasture). The upper part of the Plum Creek watershed is more highly urbanized and has five major WWTPs; numerous smaller permitted wastewater outfalls are concentrated in the upper and central parts of the Plum Creek watershed. The Geronimo Creek watershed, in contrast, has no WWTPs upstream from or near the sampling sites.Results indicate that water quality in the Geronimo Creek watershed, which was evaluated only during base-flow conditions, is dominated by groundwater, which discharges to the stream by numerous springs at various locations. Nitrate isotope values for most Geronimo Creek samples were similar, which indicates that they likely have a common source (or
19 CFR 113.35 - Individual sureties.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...
7 CFR 1710.113 - Loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...
Phase formation and crystallization behavior of melt spun Sm-Fe-based alloys
International Nuclear Information System (INIS)
Shield, J.E.
1999-01-01
The phase formation and microstructures of Sm-Fe alloys have been investigated at Sm levels of 11 and 17 atomic percent and with alloying additions of Ti and C. At lower Sm content, virtually phase pure SmFe 7 formed, while higher Sm content resulted in the formation of SmFe 7 , SmFe 2 and amorphous phases. The addition of Ti and C resulted in greater stability and a larger volume fraction of the amorphous phase. The binary Sm-Fe alloys at both Sm levels had tremendously variable microstructures, with large discrepancies in grain size and phase distribution from region to region. The addition of Ti and C tended to result in a more homogeneous microstructure, as well as a refinement in the microstructural scale. (orig.)
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
33 CFR 117.1001 - Cat Point Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cat Point Creek. 117.1001 Section 117.1001 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Virginia § 117.1001 Cat Point Creek. The draw of the...
33 CFR 117.705 - Beaver Dam Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Beaver Dam Creek. 117.705 Section 117.705 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.705 Beaver Dam Creek. The draw of the...
33 CFR 117.800 - Mill Neck Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mill Neck Creek. 117.800 Section 117.800 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.800 Mill Neck Creek. The draw of the...
In vivo and in vitro binding assay of 153Sm-EDTMP
International Nuclear Information System (INIS)
Chen Daming; Wang Yuqing; Jin Xiaohai; Fan Hongqiang; Bai Hongsheng; Jia Bin; Zhang Jingming
1999-01-01
With the waters ultra hydrogel TM 120 μm hplc column (7.7 mm x 300 mm), several experiments have been finished, including the in vitro binding assay of 153 Sm-EDTMP, 153 SmCl 3 with the Cys, BSA, mouse plasma; HPLC analysis of the urine and the extracting solution of liver homogenate after having injected the 153 Sm-EDTMP and 153 SmCl 3 2h; HPLC analysis of the production ( 153 Sm-EDTMP) radiation self-decomposition with large dose. For the HPLC analysis, the condition is the mobile phase of 0.85 mol/mL PBS (pH7.5), flow rate of 0.5 mL/min, sampling of 15 μL. The results are following: (1) The 153 SmCl 3 not only is able to bind with the mouse plasma in vitro, but also is able to be absorbed by liver in vivo; (2) 153 Sm-EDTMP is not bind with the mouse plasma, the Cys and BSA in vitro and vivo; 153 Sm-EDTMP is not found in the extracted solution of liver homogenate at n(EDTMP): n(Sm) ≥ 5:1; 153 Sm-EDTMP is not decomposed in the urine, 1 53 Sm-EDTMP is stable in vivo; (3) 153 Sm-EDTMP radiation self-decomposition is not detected with large dose in the term of validity (6 d), but two small degradation peaks have been found in the production solution after 60 d, the radiochemistry purity of production is always great than 98% during the period
Abdelfatah, Eihab; Page, Andrew; Sacks, Justin; Pierorazio, Phillip; Bivalacqua, Trinity; Efron, Jonathan; Terezakis, Stephanie; Gearhart, Susan; Fang, Sandy; Safar, Bashar; Pawlik, Timothy M; Armour, Elwood; Hacker-Prietz, Amy; Herman, Joseph; Ahuja, Nita
2017-06-01
Intraoperative radiotherapy (IORT) has advantages over external beam radiation therapy (EBRT). Few studies have described side effects associated with its addition. We evaluated our institution's experience with abdominopelvic IORT to assess safety by postoperative complication rates. Prospectively collected IRB-approved database of all patients receiving abdominopelvic IORT (via high dose rate brachytherapy) at Johns Hopkins Hospital between November 2006 and May 2014 was reviewed. Patients were discussed in multidisciplinary conferences. Those selected for IORT were patients for whom curative intent resection was planned for which IORT could improve margin-negative resection and optimize locoregional control. Perioperative complications were classified via Clavien-Dindo scale for postoperative surgical complications. A total of 113 patients were evaluated. Most common diagnosis was sarcoma (50/113, 44%) followed by colorectal cancer (45/113, 40%), most of which were recurrent (84%). There were no perioperative deaths. A total of 57% of patients experienced a complication Grade II or higher: 24% (27/113) Grade II; 27% (30/113) Grade III; 7% (8/113) Grade IV. Wound complications were most common (38%), then gastrointestinal (25%). No radiotherapy variables were significantly associated with complications on uni/multi-variate analysis. Our institution's experience with IORT demonstrated historically expected postoperative complication rates. IORT is safe, with acceptable perioperative morbidity. © 2017 Wiley Periodicals, Inc.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...
Elevation - LiDAR Survey Minnehaha Creek, MN Watershed
Army Corps of Engineers, Department of the Army, Department of Defense — LiDAR Bare-Earth Grid - Minnehaha Creek Watershed District. The Minnehaha Creek watershed is located primarily in Hennepin County, Minnesota. The watershed covers...
2010-07-01
... CATEGORY Potassium Metal Production Subcategory § 415.113 Effluent limitations guidelines representing the...): There shall be no discharge of process wastewater pollutants to navigable waters. ...
Leaching kinetic of Nd. Y, Pr and Sm in rare earth hydroxide (REOH) use nitric acid
Purwani, MV; Suyanti
2018-02-01
The purpose of this study were to determine the order of reaction, rate reaction constant and activation energy of reaction Y(OH)3, Nd(OH)3, Pr(OH)3 and Sm(OH)3 with HNO3. The rate reaction constant is necessary to determine the residence time in the design of continuously stirred tank reactor (CSTR). The studied parameters were leaching temperature (60 - 90 °C) and leaching time (0-15 minutes). From the resulting data can be concluded that the leaching process were strongly influenced by the time and temperature process. Leaching rare earth hydroxide (REOH) using nitric acid follows second order. At leaching 10 grams of REOH using 40 ml HNO3 0.0576 mol were obtained maximum conversion at 90 °C and leaching time 15 minutes for Y was 0.95 (leaching efficiency was 95%), for Nd was 0.97 ( leaching efficiency was 97%), for Pr was 0.94 (leaching efficiency was 94%) and for Sm was 0.94 (leaching efficiency was 94%). The largest activation energy was Y of 23.34 kJ/mol followed by Pr of 20.00 kJ/mol, Sm of 17.94 kJ/mol and the smallest was Nd of 16.39 kJ/mol. The relationship between the rate constant of the reaction with T for Y was kY = 338.26 e-23,34/RT, for Nd was kNd = 33.69 e -16,39 / RT, for Pr was kPr = 102.04 e-20 / RT and for Sm adalah was kSm = 50.16 e-17,94/RT
Energy Technology Data Exchange (ETDEWEB)
Krishnan, M. [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Department of Physics, National Institute of Technology Calicut, Calicut 673601 (India); Predeep, P. [Department of Physics, National Institute of Technology Calicut, Calicut 673601 (India); Sridhara Rao, D.V. [Defence Metallurgical Research Laboratories, Hyderabad 500058 (India); Prajapat, C.L.; Singh, M.R. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Barshilia, Harish C. [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Chowdhury, P., E-mail: pchowdhury@nal.res.in [Surface Engineering Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India)
2017-05-15
Hard magnetic thin films with high coercivity were fabricated by magnetron sputtering on MgO(100) and quartz substrates. The films were grown by depositing sequentially Sm and Co layers at an elevated substrate temperature of 500 °C. Subsequent post-annealing was carried out at various temperatures in range of 500–700 °C to form Sm-Co hard magnetic thin films. X-ray diffraction studies revealed the formation of randomly oriented SmCo{sub 5} crystallites on quartz substrate, whereas, a textured growth of Sm{sub 2}Co{sub 7} with strong (110) crystalline phases was observed on MgO substrate. Microstructural analyses were carried out using Transmission Electron Microscopy (TEM) for samples grown on MgO substrate at 650 °C and inferred the presence of high density planar defects along with large grain boundaries. Further microdiffraction studies confirmed the presence of SmCo{sub 3} as an impurity phase in the films. Magnetic hysteresis measurements indicate the square hysteresis behaviors with high coercivity value of 3.1 T and 2.7 T for 650 °C annealed samples on both MgO and quartz substrates, respectively. The origin of such high coercivity value was then correlated with pinning type of spin reversal mechanism as confirmed through the analyses of demagnetization curves. The magnetic force microscopy images for films on MgO substrate, annealed at 650 °C, revealed the presence of magnetic domains with size higher than 1 µm. The formed magnetic domains lacked well defined boundaries indicating an enhanced exchange coupling between the grain clusters. - Highlights: • Ewald technique in micromagnetic simulations with periodic boundary conditions. • Effect of micromagnetic parameters on hysteresis in exchange spring magnets. • Importance of the interface exchange coupling for hard-soft nanocomposites. • Geometry dependence of the optimal soft phase size in exchange spring magnets.
Directory of Open Access Journals (Sweden)
Clarice Carvalho Alves
2015-02-01
Full Text Available BACKGROUND: A vaccine against schistosomiasis would have a great impact in disease elimination. Sm29 and Sm22.6 are two parasite tegument proteins which represent promising antigens to compose a vaccine. These antigens have been associated with resistance to infection and reinfection in individuals living in endemic area for the disease and induced partial protection when evaluated in immunization trials using naïve mice. METHODOLOGY/PRINCIPALS FINDINGS: In this study we evaluated rSm29 and rSm22.6 ability to induce protection in Balb/c mice that had been previously infected with S. mansoni and further treated with Praziquantel. Our results demonstrate that three doses of the vaccine containing rSm29 were necessary to elicit significant protection (26%-48%. Immunization of mice with rSm29 induced a significant production of IL-2, IFN-γ, IL-17, IL-4; significant production of specific antibodies; increased percentage of CD4+ central memory cells in comparison with infected and treated saline group and increased percentage of CD4+ effector memory cells in comparison with naïve Balb/c mice immunized with rSm29. On the other hand, although immunization with Sm22.6 induced a robust immune response, it failed to induce protection. CONCLUSION/SIGNIFICANCE: Our results demonstrate that rSm29 retains its ability to induce protection in previously infected animals, reinforcing its potential as a vaccine candidate.
Preliminary Chemical and Biological Assessment of Ogbe Creek ...
African Journals Online (AJOL)
USER
The study was aimed at assessing the quality of water from the Ogbe Creek ... indicated the impact of the perturbational stress on the organisms inhabiting the creek. ... experiences seasonal flooding which introduces a lot of detritus and ...
Plankton biodiversity of Dharamtar creek adjoining Mumbai harbour
Digital Repository Service at National Institute of Oceanography (India)
Tiwari, L.R.; Nair, V.R.
rich plankton community. However, recent industrial development along the banks of creek may pose the problem due to waste disposal into this creek system. Losses of marine life diversity are largely the results of conflicting uses, in particular...
Hydrogen-induced amorphization of SmFe{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Kubis, M.; Handstein, A.; Gebel, B.; Gutfleisch, O.; Mueller, K.-H.; Schultz, L. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe
2000-07-01
The hydrogen absorption behavior of SmFe{sub 3} (PuNi{sub 3}-type structure) was observed in the range from 0.05 to 4 MPa by differential scanning calorimetry. The structural changes were observed by X-ray diffraction measurements. For pressures below 0.8 MPa two exothermic reactions were found which are attributed (i) to the interstitial absorption and (ii) to the disproportionation into SmH{sub 2} and {alpha}-Fe. For higher hydrogen pressures, the second exothermic peak occured at significantly lower temperatures and splitted into two peaks. The first one was identified as the exothermic signal of the hydrogen-induced amorphization of the SmFe{sub 3} hydride. The second peak is caused by the precipitation of SmH{sub 2} and {alpha}-Fe from the amorphous material. (orig.)
International Nuclear Information System (INIS)
Sajimol, R.; Bera, S.; Nalini, S.; Sivaraman, N.; Joseph, M.; Kumar, T.
2016-01-01
Rate of evaporation of Sm and Nd from their mixture was studied based on their ion intensities using thermal ionization mass spectrometry. Because of the comparatively larger evaporation rate of Sm, it was found possible to get the isotopic composition of Nd (fission product monitor) free from isobaric interference of Sm isotopes. The decrease in ion intensity of Sm was studied as a function of time and filament temperature. Based on this study, an easy and time effective method for the determination of burn-up of spent nuclear fuel was examined and the results are compared with that obtained by the conventional method. Typical burn-up value obtained for a pressurized heavy water reactor fuel dissolver solution using the direct method by preferential evaporation of Sm is: 0.84 at.%, whereas the one obtained by the use of conventional method is 0.82 at.%. In both the cases, Nd was employed as the fission product monitor. (author)
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
77 FR 5201 - Drawbridge Operation Regulation; Bear Creek, Dundalk, MD
2012-02-02
...-AA09 Drawbridge Operation Regulation; Bear Creek, Dundalk, MD AGENCY: Coast Guard, DHS. ACTION: Notice... operation of the Baltimore County highway bridge at Wise Avenue across Bear Creek, mile 3.4, between Dundalk... Avenue across Bear Creek, mile 3.4 between Dundalk and Sparrows Point, MD. This change would require the...
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
New neutron-rich isotope production in 154Sm+160Gd
Directory of Open Access Journals (Sweden)
Ning Wang
2016-09-01
Full Text Available Deep inelastic scattering in 154Sm+160Gd at energies above the Bass barrier is for the first time investigated with two different microscopic dynamics approaches: improved quantum molecular dynamics (ImQMD model and time dependent Hartree–Fock (TDHF theory. No fusion is observed from both models. The capture pocket disappears for this reaction due to strong Coulomb repulsion and the contact time of the di-nuclear system formed in head-on collisions is about 700 fm/c at an incident energy of 440 MeV. The isotope distribution of fragments in the deep inelastic scattering process is predicted with the simulations of the latest ImQMD-v2.2 model together with a statistical code (GEMINI for describing the secondary decay of fragments. More than 40 extremely neutron-rich unmeasured nuclei with 58≤Z≤76 are observed and the production cross sections are at the order of μb to mb. The multi-nucleon transfer reaction of Sm+Gd could be an alternative way to synthesize new neutron-rich lanthanides which are difficult to be produced with traditional fusion reactions or fission of actinides.
International Nuclear Information System (INIS)
Raut, R.; Ganguly, S.; Kshetri, R.; Banerjee, P.; Bhattacharya, S.; Dasmahapatra, B.; Mukherjee, A.; Mukherjee, G.; Sarkar, M. Saha; Goswami, A.; Gangopadhyay, G.; Mukhopadhyay, S.; Krishichayan,; Chakraborty, A.; Ghughre, S. S.; Bhattacharjee, T.; Basu, S. K.
2006-01-01
The high spin states of 143 Sm have been studied by in-beam γ-spectroscopy following the reaction 130 Te( 20 Ne,7n) 143 Sm at E lab =137 MeV, using a Clover detector array. More than 50 new gamma transitions have been placed above the previously known J π =23/2 - , 30 ms isomer at 2795 keV. The level scheme of 143 Sm has been extended up to 12 MeV and spin-parity assignments have been made to most of the newly proposed level. Theoretical calculation with the relativistic mean field approach using blocked BCS method, has been performed. A sequence of levels connected by M1 transitions have been observed at an excitation energy ∼8.6 MeV. The sequence appears to be a magnetic rotational band from systematics
Chemical methods for Sm-Nd separation and its application in isotopic geological dating
International Nuclear Information System (INIS)
Guo Qifeng.
1990-01-01
Three chemical methods for Sm-Nd separation are mainly desribed: low chromatography of butamone-ammonium thiocyanate for hight concentration Sm and Nd separation, P 240 column chromatography for medium concentration Sm-Nd separation, and pressure ion exchange for low concentration Sm-Nd. The first Sm-Nd synchrone obtained in China with Sm-Nd methods is introduced and Sm-Nd isotopic geological dating in Early Archaean rocks in eastern Hebei has been determined
48 CFR 432.113 - Customary contract financing.
2010-10-01
... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...
Smáčivost povrchových úprav DPS
Minář, Jan
2016-01-01
Tato bakalářská práce se zabývá měřením smáčecích charakteristik pomocí metody smáčecích vah u vzorků různých povrchových úprav od firmy Gatema. Věnuje se vlivu izotermálního stárnutí a přetavovacích procesů na smáčecí charakteristiky povrchových úprav ENIG, bezolovnatý HAL a imerzní cín. U povrchové úpravy imerzním cínem je sledován vliv intermetalické vrstvy na celkovou smáčivost. Dále se zabývá smáčivostí vrstvy niklu, po odstripování zlata, u povrchové úpravy ENIG. This bachelor’s thes...
VUV light induced valence degeneration in Sm over-layer on HOPG
International Nuclear Information System (INIS)
Kutluk, G; Nakatake, M; Arita, M; Namatame, H; Taniguchi, M; Ishitobi, Y; Sumida, H
2013-01-01
Systematic investigation of the influence of vacuum ultraviolet (VUV) irradiation on the valence degeneration in a Sm over-layer on a HOPG substrate was performed using in-situ photoemission spectroscopy (XPS, UPS, and ARPES) for the Sm coverage regime of 0.05-3.6 Å. This investigation confirmed that VUV irradiation-induced degeneration of divalent Sm exerts a more profound effect than Sm contamination during photoemission spectroscopy even under UHV. We found that the charge transfer occurs mainly from divalent Sm to the HOPG surface.
β-decay spectroscopy of neutron-rich 160,161,162Sm isotopes
Directory of Open Access Journals (Sweden)
Patel Z.
2016-01-01
Full Text Available Neutron-rich 160,161,162Sm isotopes have been populated at the RIBF, RIKEN via β first time. β-coincident γ rays were observed in all three isotopes including γ rays from the isomeric decay of 160Sm and 162Sm. The isomers in 160Sm and 162Sm have previously been observed but have been populated via β decay for the first time. The isomeric state in 162Sm is assigned a 4−v72+[ 633 ]⊗v12−[ 521 ]${4^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes v{{1 \\over 2}^ - }\\left[ {521} \\right]$ configuration based on the decay pattern. The level schemes of 160Sm and 162Sm are presented. The ground states in the parent nuclei 160Pm and 162Pm are both assigned a 6−v72+[633]⊗π52−[532]${6^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes \\pi {{5 \\over 2}^ - }\\left[ {532} \\right]$ configuration based on the population of states in the daughter nuclei. Blocked BCS calculations were performed to further investigate the spin-parities of the ground states in 160Pm, 161Pm, and 162Pm, and the isomeric state in 162Sm
Higher-order scalar interactions and SM vacuum stability
Energy Technology Data Exchange (ETDEWEB)
Lalak, Zygmunt; Lewicki, Marek; Olszewski, Paweł [Institute of Theoretical Physics, Faculty of Physics, University of Warsawul. Hoża 69, Warsaw (Poland)
2014-05-26
Investigation of the structure of the Standard Model effective potential at very large field strengths opens a window towards new phenomena and can reveal properties of the UV completion of the SM. The map of the lifetimes of the vacua of the SM enhanced by nonrenormalizable scalar couplings has been compiled to show how new interactions modify stability of the electroweak vacuum. Whereas it is possible to stabilize the SM by adding Planck scale suppressed interactions and taking into account running of the new couplings, the generic effect is shortening the lifetime and hence further destabilisation of the SM electroweak vacuum. These findings have been illustrated with phase diagrams of modified SM-like models. It has been demonstrated that stabilisation can be achieved by lowering the suppression scale of higher order operators while picking up such combinations of new couplings, which do not deepen the new minima of the potential. Our results show the dependence of the lifetime of the electroweak minimum on the magnitude of the new couplings, including cases with very small couplings (which means very large effective suppression scale) and couplings vastly different in magnitude (which corresponds to two different suppression scales)
75 FR 8036 - Monitor-Hot Creek Rangeland Project
2010-02-23
... DEPARTMENT OF AGRICULTURE Forest Service Monitor-Hot Creek Rangeland Project AGENCY: Forest... Rangeland Project area. The analysis will determine if a change in management direction for livestock grazing is needed to move existing resource conditions within the Monitor-Hot Creek Rangeland Project area...
Slowey, Aaron J.; Rytuba, James J.; Hothem, Roger L.; May, Jason T.
2007-01-01
appreciable source of sulfate and carbonate to James Creek, because the spring water was enriched in sulfate (130 mg/L) and carbonate (430 mg/L as CaCO3) compared to James Creek water (70 to 100 mg/L SO42- and 110 to 170 mg/L as CaCO3) at the time of sampling. Concentrations of mercury in active channel sediment from James Creek are variable and potentially high, on the basis of chemical analysis (2.5 to 17 _g/g-wet sediment) and easily visible cinnabar grains in panned concentrates. Average (geometric mean) organic mercury (presumably monomethyl mercury (MMHg); ?2.3.3) concentrations in several invertebrate taxa collected from the James Creek watershed locations were higher than invertebrates taken from a Northern California location lacking a known point source of mercury. The mean proportion of MMHg to total mercury in James Creek predatory insect samples was 40 percent (1 standard deviation = 30 percent); only 40 percent of all insect samples had a MMHg/HgT proportion greater than 0.5. The low proportions of MMHg measured in invertebrates in James Creek and the presence of cinnabar in the creek suggest that some invertebrates may have anomolously high Hg concentrations as a result of the injestion or adhesion of extremely fine-grained cinnabar particles. Interpretation of HgT in frogs and fish as an indicator of mercury reactivity, biouptake, or trophic transfer is limited, pending MMHg measuremens, by the possibility of these whole-body samples having contained cinnabar particles at the time of analysis. To minimize this limitation, the gastrointestinal tracts and external surfaces of all amphibians, where cinnabar most likely resides, were carefully flushed to remove any visible particles. However, extremely fine-grained, invisible, adhesive cinnabar particles likely exist in the amphibians' habitats. HgT in foothill yellow-legged frogs collected from the James Creek study area, ranging from 0.1 to 0.6 ug/g Hg, was on average twice that of an extensive
Synthesis and magnetic properties of SmOOH crystals
Energy Technology Data Exchange (ETDEWEB)
Samata, Hiroaki, E-mail: samata@maritime.kobe-u.ac.jp [Graduate School of Maritime Sciences, Kobe University, Fukaeminami, Higashinada, Kobe, Hyogo 658-0022 (Japan); Hanioka, Masashi [Graduate School of Maritime Sciences, Kobe University, Fukaeminami, Higashinada, Kobe, Hyogo 658-0022 (Japan); Ozawa, Tadashi C. [Materials Development Group, Superconducting Properties Unit, National Institute for Materials Science, Sengen, Tsukuba, Ibaraki 305-0047 (Japan)
2016-01-15
Samarium oxyhydroxide (SmOOH) crystals were synthesized using a flux method. The as-grown crystals were yellowish, transparent, and elongated with a maximum length of approximately 1.0 mm. SmOOH adopts a monoclinic structure in the space group P2{sub 1}/m with a=0.4356 nm, b=0.3766 nm, c=0.6139 nm, and β=108.464°. The magnetic susceptibility of the SmOOH crystals exhibited typical Van Vleck paramagnetism, and the experimental data at temperatures above 200 K were in close agreement with the calculated results using a spin-orbit coupling constant λ=443 K (308 cm{sup −1}). - Highlights: • SmOOH crystals were synthesized via flux method and characterized. • Magnetic susceptibilities above 200 K agreed with theoretical Van Vleck values. • Discrepancies were observed at lower temperatures based on the crystalline field.
Preparation of an sup(113m) indium generator
International Nuclear Information System (INIS)
Ling, H.W.
1979-01-01
This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt
International Nuclear Information System (INIS)
Matscha, G.; Sutherland, D.
2005-06-01
This report summarized a baseline monitoring program for the Lynx Creek, Brenot Creek, and Portage Creek watersheds located near Hudson's Hope, British Columbia (BC). The monitoring program was designed to more accurately determine the effects of potential coalbed gas developments in the region, as well as to assess levels of agricultural and forest harvesting, and the impacts of current land use activities on water quantity and quality. Water quality was sampled at 18 sites during 5 different flow regimes, including summer and fall low flows; ice cover; spring run-off; and high flows after a heavy summer rain event. Sample sites were located up and downstream of both forest and agricultural activities. The water samples were analyzed for 70 contaminants including ions, nutrients, metals, hydrocarbons, and hydrocarbon fractions. Results showed that while many analyzed parameters met current BC water quality guidelines, total organic carbon, manganese, cadmium, E. coli, fecal coliforms, and fecal streptococci often exceeded recommended guidelines. Aluminum and cobalt values exceeded drinking water guidelines. The samples also had a slightly alkaline pH and showed high conductance. A multiple barrier approach was recommended to reduce potential risks of contamination from the watersheds. It was concluded that a more refined bacteria source tracking method is needed to determine whether fecal pollution has emanated from human, livestock or wildlife sources. 1 tab., 9 figs
5 CFR 831.113 - Payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...
Wolf Creek Generating Station containment model
International Nuclear Information System (INIS)
Nguyen, D.H.; Neises, G.J.; Howard, M.L.
1995-01-01
This paper presents a CONTEMPT-LT/28 containment model that has been developed by Wolf Creek Nuclear Operating Corporation (WCNOC) to predict containment pressure and temperature behavior during the postulated events at Wolf Creek Generating Station (WCGS). The model has been validated using data provided in the WCGS Updated Safety Analysis Report (USAR). CONTEMPT-LT/28 model has been used extensively at WCGS to support plant operations, and recently, to support its 4.5% thermal power uprate project
A mangrove creek restoration plan utilizing hydraulic modeling.
Marois, Darryl E; Mitsch, William J
2017-11-01
Despite the valuable ecosystem services provided by mangrove ecosystems they remain threatened around the globe. Urban development has been a primary cause for mangrove destruction and deterioration in south Florida USA for the last several decades. As a result, the restoration of mangrove forests has become an important topic of research. Using field sampling and remote-sensing we assessed the past and present hydrologic conditions of a mangrove creek and its connected mangrove forest and brackish marsh systems located on the coast of Naples Bay in southwest Florida. We concluded that the hydrology of these connected systems had been significantly altered from its natural state due to urban development. We propose here a mangrove creek restoration plan that would extend the existing creek channel 1.1 km inland through the adjacent mangrove forest and up to an adjacent brackish marsh. We then tested the hydrologic implications using a hydraulic model of the mangrove creek calibrated with tidal data from Naples Bay and water levels measured within the creek. The calibrated model was then used to simulate the resulting hydrology of our proposed restoration plan. Simulation results showed that the proposed creek extension would restore a twice-daily flooding regime to a majority of the adjacent mangrove forest and that there would still be minimal tidal influence on the brackish marsh area, keeping its salinity at an acceptable level. This study demonstrates the utility of combining field data and hydraulic modeling to aid in the design of mangrove restoration plans.
Surface-water resources of Polecat Creek basin, Oklahoma
Laine, L.L.
1956-01-01
A compilation of basic data on surface waters in Polecat Creek basin is presented on a monthly basis for Heyburn Reservoir and for Polecat Creek at Heyburn, Okla. Chemical analyses are shown for five sites in the basin. Correlation of runoff records with those for nearby basins indicates that the average annual runoff of the basin above gaging station at Heyburn is 325 acre-feet per square mile. Estimated duration curves of daily flow indicate that under natural conditions there would be no flow in Polecat Creek at Heyburn (drainage area, 129 square miles) about 16 percent of the time on an average, and that the flow would be less than 3 cubic feet per second half of the time. As there is no significant base flow in the basin, comparable low flows during dry-weather periods may be expected in other parts of the basin. During drought periods Heyburn Reservoir does not sustain a dependable low-water flow in Polecat Creek. Except for possible re-use of the small sewage effluent from city of Sapulpa, dependable supplies for additional water needs on the main stem will require development of supplemental storage. There has been no regular program for collection of chemical quality data in the basin, but miscellaneous analyses indicate a water of suitable quality for municipal and agricultural uses in Heyburn Reservoir and Polecat Creek near Heyburn. One recent chemical analysis indicates the possibility of a salt pollution problem in the Creek near Sapulpa. (available as photostat copy only)
Gaderer, Romana; Lamdan, Netta L; Frischmann, Alexa; Sulyok, Michael; Krska, Rudolf; Horwitz, Benjamin A; Seidl-Seiboth, Verena
2015-01-16
The proteins Sm1 and Sm2 from the biocontrol fungus Trichoderma virens belong to the cerato-platanin protein family. Members of this family are small, secreted proteins that are abundantly produced by filamentous fungi with all types of life-styles. Some species of the fungal genus Trichoderma are considered as biocontrol fungi because they are mycoparasites and are also able to directly interact with plants, thereby stimulating plant defense responses. It was previously shown that the cerato-platanin protein Sm1 from T. virens - and to a lesser extent its homologue Epl1 from Trichoderma atroviride - induce plant defense responses. The plant protection potential of other members of the cerato-platanin protein family in Trichoderma, however, has not yet been investigated. In order to analyze the function of the cerato-platanin protein Sm2, sm1 and sm2 knockout strains were generated and characterized. The effect of the lack of Sm1 and Sm2 in T. virens on inducing systemic resistance in maize seedlings, challenged with the plant pathogen Cochliobolus heterostrophus, was tested. These plant experiments were also performed with T. atroviride epl1 and epl2 knockout strains. In our plant-pathogen system T. virens was a more effective plant protectant than T. atroviride and the results with both Trichoderma species showed concordantly that the level of plant protection was more strongly reduced in plants treated with the sm2/epl2 knockout strains than with sm1/epl1 knockout strains. Although the cerato-platanin genes sm1/epl1 are more abundantly expressed than sm2/epl2 during fungal growth, Sm2/Epl2 are, interestingly, more important than Sm1/Epl1 for the promotion of plant protection conferred by Trichoderma in the maize-C. heterostrophus pathosystem.
The ternary systems Sc-Sm(Dy)-Si at 870 K
International Nuclear Information System (INIS)
Kotur, B.Ya.; Mokra, I.Ya.; Toporinskij, A.Ya.
1991-01-01
Isothermal cross sections of the ternary systems Sc-Sm-Si and Sc-Dy-Si at 870 K have been plotted. Investigation of scandium and disprosium in ternary systems have been examined by X-ray diffraction and microstructure analysis. Besides literary data on binary systems Sc-Si, Sm-Si, Dy-Si have been used. Formation of limited (Sc-Sm-Si, Sc-Dy-Si) and continuous (Sc-Dy-Si) solid solutions based on bisilicides of Sc and Sm(Dy) is discovered. Two and five ternary compounds in Sc-Sm-Si and Sc-Dy-Si systems have been determined and their crystal structure has been established. When investigating of Sc-(rare earth element)-Si ternary systems and should take into account the specific interaction of scandium and samarium with REE
Bulk magnetic characterization of RCaCrO4 (Rrl02=Y, Pr, Sm ) oxides
International Nuclear Information System (INIS)
Martinez, J.L.; Fernandez-Diaz, M.T.; Chen, Q.; Prieto, C.; Andres, A. de; Saez-Puche, R.; Romero, J.
1995-01-01
The system RCaCrO 4 (R=Y, Sm, Pr) presents an orthorhombic structure (space group Bmab) at room temperature (RT), similar to that observed in La 2 MO 4 (M=Cu, Ni, Co). The magnetic susceptibility for RCaCrO 4 shows a weak temperature dependence down to 250 K, probably due to the antiferromagnetic ordering of the Cr sublattice above RT. Below RT there is a strong upturn anomaly at 210, 190 and 130 K for Pr, Sm and Y, respectively. This anomaly is associated with the appearance of a weak ferromagnetic component, and could be related to a low temperature structural phase transition, similar to that observed in the related compounds R 2 NiO 4 or La 1.88 Ba 0.12 CuO 4 . In the case of YCaCrO 4 this ferromagnetic component produces a hysteresis curve at 4.5 K with a coercive field of 0.7 T. For PrCaCrO 4 the coercive field is very small ( 4 shows a more complicated behavior with a low temperature magnetic transition (T N2 ∼40 K), which could be associated with either the antiferromagnetic ordering of the Sm sublattice or a spin reorientation in the Cr sublattice. ((orig.))
Miller, Todd S.; Karig, Daniel E.
2010-01-01
In 2002, the U.S. Geological Survey, in cooperation with the Tompkins County Planning Department began a series of studies of the stratified-drift aquifers in Tompkins County to provide geohydrologic data for planners to develop a strategy to manage and protect their water resources. This aquifer study in lower Sixmile Creek and Willseyville Creek trough is the second in a series of aquifer studies in Tompkins County. The study area is within the northern area of the Appalachian Plateau and extends about 9 miles from the boundary between Tompkins County and Tioga County in the south to just south of the City of Ithaca in the north. In lower Sixmile Creek and Willseyville Creek trough, confined sand and gravel aquifers comprise the major water-bearing units while less extensive unconfined units form minor aquifers. About 600 people who live in lower Sixmile Creek and Willseyville Creek trough rely on groundwater from the stratified-drift aquifer system. In addition, water is used by non-permanent residents such as staff at commercial facilities. The estimated total groundwater withdrawn for domestic use is about 45,000 gallons per day (gal/d) or 0.07 cubic foot per second (ft3/s) based on an average water use of 75 gal/d per person for self-supplied water systems in New York. Scouring of bedrock in the preglacial lower Sixmile Creek and Willseyville Creek valleys by glaciers and subglacial meltwaters truncated hillside spurs, formed U-shaped, transverse valley profiles, smoothed valley walls, and deepened the valleys by as much as 300 feet (ft), forming a continuous trough. The unconsolidated deposits in the study area consist mostly of glacial drift, both unstratified drift (till) and stratified drift (laminated lake, deltaic, and glaciofluvial sediments), as well as some post-glacial stratified sediments (lake-bottom sediments that were deposited in reservoirs, peat and muck that were deposited in wetlands, and alluvium deposited by streams). Multiple advances and
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
2010-04-01
... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...
34 CFR 668.113 - Request for review.
2010-07-01
... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...
46 CFR 113.25-6 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...
14 CFR 1214.113 - Allocation of risk.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...
Klimaforsøg med fravænnede smågrise
DEFF Research Database (Denmark)
Feenstra, A.
Publikationen belyser betydningen af luftfugtighed og ventilationsluftmængder for smågrise. Undersøgelsen var led i bestræbelserne på at nedbringe energiforbruget i smågrisestalde, og resultaterne viser at ventilationsmængden kan formindskes uden skadelige virkninger for dyrene.......Publikationen belyser betydningen af luftfugtighed og ventilationsluftmængder for smågrise. Undersøgelsen var led i bestræbelserne på at nedbringe energiforbruget i smågrisestalde, og resultaterne viser at ventilationsmængden kan formindskes uden skadelige virkninger for dyrene....
Goncharov, I; Palfi, Z; Bindereif, A; Michaeli, S
1999-04-30
Trans-splicing in trypanosomes involves the addition of a common spliced leader (SL) sequence, which is derived from a small RNA, the SL RNA, to all mRNA precursors. The SL RNA is present in the cell in the form of a ribonucleoprotein, the SL RNP. Using conventional chromatography and affinity selection with 2'-O-methylated RNA oligonucleotides at high ionic strength, five proteins of 70, 16, 13, 12, and 8 kDa were co-selected with the SL RNA from Leptomonas collosoma, representing the SL RNP core particle. Under conditions of lower ionic strength, additional proteins of 28 and 20 kDa were revealed. On the basis of peptide sequences, the gene coding for a protein with a predicted molecular weight of 11.9 kDa was cloned and identified as homologue of the cis-spliceosomal SmE. The protein carries the Sm motifs 1 and 2 characteristic of Sm antigens that bind to all known cis-spliceosomal uridylic acid-rich small nuclear RNAs (U snRNAs), suggesting the existence of Sm proteins in trypanosomes. This finding is of special interest because trypanosome snRNPs are the only snRNPs examined to date that are not recognized by anti-Sm antibodies. Because of the early divergence of trypanosomes from the eukaryotic lineage, the trypanosome SmE protein represents one of the primordial Sm proteins in nature.
Miller, Todd S.
2015-11-20
In 2006, the U.S. Geological Survey, in cooperation with the Town of Danby and the Tompkins County Planning Department, began a study of the stratified-drift aquifers in the upper Buttermilk Creek and Danby Creek valleys in the Town of Danby, Tompkins County, New York. In the northern part of the north-draining upper Buttermilk Creek valley, there is only one sand and gravel aquifer, a confined basal unit that overlies bedrock. In the southern part of upper Buttermilk Creek valley, there are as many as four sand and gravel aquifers, two are unconfined and two are confined. In the south-draining Danby Creek valley, there is an unconfined aquifer consisting of outwash and kame sand and gravel (deposited by glacial meltwaters during the late Pleistocene Epoch) and alluvial silt, sand, and gravel (deposited by streams during the Holocene Epoch). In addition, throughout the study area, there are several small local unconfined aquifers where large tributaries deposited alluvial fans in the valley.
6 CFR 11.3 - Demand for payment.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...
9 CFR 113.4 - Exemptions to tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...
Crystallographic characterization of divalent organosamarium compound (C5H5)2Sm(THF)2
International Nuclear Information System (INIS)
Jagannatha Swamy, S.
2002-01-01
The single pot reaction between SmX 2 (X = Cl - , I - ) and BuLi in THF at -40 degC, followed by the addition of C 5 H 5 - Na + results in a dark red solution. Leaving the concentrated reaction mixture at -25 degC for two days in a deep freezer results in the formation of the crystals of the compound, (C 5 H 5 ) 2 ; Sm(THF) 2 . The compound is insoluble in any solvent and it has been characterized by conventional methods. The crystals are monoclinic with space group C2/c, and a = 13.416(1), b = 9.644(1), c = 14.129(2) pm, β109.873(9) 0 and z = 4 for ρcalcd = 1.64 g cm -3 . Least squares refinement on the basis of 1804 observed reflections has led to a final R value of 0.037 and R w = 0.054. (author)
Synthesis and photoluminescence properties of Sm3+-doped CaWO4 nanoparticles
International Nuclear Information System (INIS)
Xiao Qi; Zhou Qitao; Li Ming
2010-01-01
The Sm 3+ -doped CaWO 4 nanoparticles were synthesized by hydrothermal method. The room temperature photoluminescence (PL) spectra of Sm 3+ -doped CaWO 4 nanoparticles doped with different Sm 3+ concentrations under 405 nm excitation have been investigated. The PL spectra showed four strong emission peaks at 460, 571, 609, and 653 nm. The first emission peak at 460 nm could be due to a structural defect of the lattice, an oxygen-deficient WO 3 complex. The other three emissions at 571, 609, and 653 nm were due to the f-f forbidden transitions of the 4f electrons of Sm 3+ , corresponding to 4 G 5/2 → 6 H 5/2 (571 nm), 6 H 7/2 (609 nm), and 6 H 9/2 (653 nm), respectively. In addition, the optimum Sm 3+ concentration in CaWO 4 nanoparticles for optical emission was determined to be 1.0%. The Sm 3+4 G 5/2 → 6 H 7/2 (609 nm) emission intensity of Sm 3+ -doped CaWO 4 nanoparticles significantly increased with the increase of Sm 3+ concentration, and showed a maximum when Sm 3+ doping content was 1.0%. If Sm 3+ concentration continued to increase, namely more than 1.0%, the Sm 3+4 G 5/2 → 6 H 7/2 emission intensity would decrease. The present materials might be a promising phosphor for white-light LED applications.
Antimony substitution in SmFeAsO
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Daniel; Braun, Hans F. [Universitaet Bayreuth (Germany)
2015-07-01
In the iron based compounds structural and magnetic phase transitions can be suppressed by applying external hydrostatic pressure and superconductivity emerges. Beside hydrostatic pressure, it is possible to apply chemical pressure by the substitution of atoms in the compounds with smaller ones. Such a substitution was successful for example in LaFeAs{sub 1-x}P{sub x}O, where the parent compound shows a structural and a spin-density-wave transition and the P doped samples become superconducting. We are interested in the opposite way and substitute the As by the bigger Sb. In literature, the substitution in the La-1111 compounds was possible up to a substitution level of 40 %. With Sm, instead of La, we used a smaller rare-earth metal. We present the results obtained on polycrystalline samples characterized by Xray powder diffraction and resistivity measurements.
Sorption of samarium in soils: influence of soil properties and Sm concentration
Energy Technology Data Exchange (ETDEWEB)
Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)
2014-07-01
Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous
76 FR 65118 - Drawbridge Operation Regulation; Bear Creek, Sparrows Point, MD
2011-10-20
...-AA09 Drawbridge Operation Regulation; Bear Creek, Sparrows Point, MD AGENCY: Coast Guard, DHS. ACTION... regulation. The Baltimore County Revenue Authority (Dundalk Avenue) highway toll drawbridge across Bear Creek... applicable or necessary. Basis and Purpose The drawbridge across Bear Creek, mile 1.5 was removed and...
Determination of the {sup 151}Sm half-life
Energy Technology Data Exchange (ETDEWEB)
Be, Marie-Martine; Cassette, Philippe [CEA, LIST, Gif sur Yvette (France). LNE-Laboratoire National Henri Becquerel; Isnard, Helene [CEA-LANIE, Gif sur Yvette (France); and others
2015-07-01
New measurements have been undertaken to determine the half-life of {sup 151}Sm. A pure {sup 151}Sm solution was obtained after chemical separation from a samarium solution resulting from the dissolution of an irradiated samarium sample. The concentration of {sup 151}Sm in the solution was measured by mass spectrometry, combined with the isotope dilution technique. The activity of the solution was measured by liquid scintillation counting by six European laboratories as part of an international comparison. These combined results lead to a half-life of T{sub 1/2} = 94.6(6)a.
46 CFR 113.05-7 - Environmental tests.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...
9 CFR 113.33 - Mouse safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...
Energy Technology Data Exchange (ETDEWEB)
Daniel, Mitch; Gebhards, John
2003-05-01
The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek through artificial propagation. Adult chinook salmon collection and spawning began in 1998. A total of 114 fish were collected from Johnson Creek and 54 fish (20 males and 34 females) were retained for Broodstock. All broodstock were transported to Lower Snake River Compensation Plan's South Fork Salmon River adult holding and spawning facility, operated by the Idaho Department of Fish and Game. The remaining 60 fish were released to spawn naturally. An estimated 155,870 eggs from Johnson Creek chinook spawned at the South Fork Salmon River facility were transported to the McCall Fish Hatchery for rearing. Average fecundity for Johnson Creek females was 4,871. Approximately 20,500 eggs from females with high levels of Bacterial Kidney Disease were culled. This, combined with green-egg to eyed-egg survival of 62%, resulted in about 84,000 eyed eggs produced in 1998. Resulting juveniles were reared indoors at the McCall Fish Hatchery in 1999. All of these fish were marked with Coded Wire Tags and Visual Implant Elastomer tags and 8,043 were also PIT tagged. A total of 78,950 smolts were transported from the McCall Fish Hatchery and released directly into Johnson Creek on March 27, 28, 29, and 30, 2000.
Anti-skin-aging benefits of exopolymers from Aureobasidium pullulans SM2001.
Kim, Kyung Hu; Park, Soo Jin; Lee, Ji Eun; Lee, Young Joon; Song, Chang Hyun; Choi, Seong Hun; Ku, Sae Kwang; Kang, Su Jin
2014-01-01
There have been many attempts to search for affordable and effective functional cosmetic ingredients, especially from natural sources. As research into developing a functional cosmetic ingredient, we investigated whether exopolymers from Aureobasidium pullulans SM2001 (E-AP-SM2001) exert antioxidant, antiwrinkle, whitening, and skin moisturizing effects. Antioxidant effects of E-AP-SM2001 were determined by measuring free radical scavenging capacity and superoxide dismutase (SOD)-like activity. Antiwrinkle effects were assessed through the inhibition of hyaluronidase, elastase, collagenase, and matrix metalloproteinase (MMP)-1. Whitening effects were measured by tyrosinase inhibition assay, and by melanin formation test in B16/F10 melanoma cells. Skin moisturizing effects were detected by mouse skin water content test. E-AP-SM2001 showed potent DPPH radical scavenging activity and SOD-like effects. Additionally, hyaluronidase, elastase, collagenase, and MMP-1 activities were significantly inhibited by E-AP-SM2001. We also observed that E-AP-SM2001 effectively reduced melanin production by B16/F10 melanoma cells and mushroom tyrosinase activities. Furthermore, significant increases in skin water content were detected in E-AP-SM2001- treated mouse skin, as compared with vehicle-treated control skin. Notably, a mask pack containing E-AP-SM2001 showed a >twofold more extensive moisturizing effect compared with one containing Saccharomycopsis ferment filtrate. Our results suggest that E-AP-SM2001 has adequate antiaging, antiwrinkle, and whitening benefits and skin moisturizing effect. These effects involve reducing hyaluronidase, elastase, collagenase, and MMP-1 activities, as well as inhibition of melanin production and tyrosinase activities. Therefore, the antioxidant E-AP-SM2001 may serve as a predictable functional ingredient.
Electrochemical preparation of Al–Sm intermetallic compound whisker in LiCl–KCl Eutectic Melts
International Nuclear Information System (INIS)
Ji, De−Bin; Yan, Yong−De; Zhang, Mi−Lin; Li, Xing; Jing, Xiao−Yan; Han, Wei; Xue, Yun; Zhang, Zhi−Jian; Hartmann, Thomas
2015-01-01
Highlights: • The reduction process of Sm(III) was investigated in LiCl–KCl melt on an aluminum electrode at 773 K. • Al–Sm alloy with different phase structure (Al 2 Sm and Al 3 Sm) was prepared by potentiostatic electrolysis on an aluminum electrode with the change of electrolytic potentials and time in LiCl–KCl–SmCl 3 melts. • Al − Sm alloy containing whiskers (Al 4 Sm) was obtained by potentiostatic electrolysis (−2.10 V) on an aluminum electrode for 7 hours with the change of electrolytic temperature and cooling rate in LiCl–KCl–SmCl 3 (16.5 wt. %) melts. The results from micro–hardness test and potentiodynamic polarization test show the micro hardness and corrosion property are remarkably improved with the help of Al–Sm intermetallic compound whiskers. - Abstract: This work presents the electrochemical study of Sm(III) on an aluminum electrode in LiCl–KCl melts at 773 K by different electrochemical methods. Three electrochemical signals in cyclic voltammetry, square wave voltammetry, open circuit chronopotentiometry, and cathode polarization curve are attributed to different kinds of Al–Sm intermetallic compounds, Al 2 Sm, Al 3 Sm, and Al 4 Sm, respectively. Al–Sm alloy with different phase structure (Al 2 Sm and Al 3 Sm) could be obtained by the potentiostatic electrolysis with the change of electrolytic potentials and time. Al–Sm alloy containing whiskers (Al 4 Sm) was obtained by potentiostatic electrolysis (−2.10 V) on an aluminum electrode for 7 hours with the change of electrolytic temperature and cooling rate in LiCl–KCl–SmCl 3 (16.5 wt. %) melts. The XRD and SEM&EDS were employed to investigate the phase composition and microstructure of Al–Sm alloy. SEM analysis shows that lots of needle−like precipitates formed in Al–Sm alloy, and their ratios of length to diameter are found to be greater than 10 to 1. The TEM and electron diffraction pattern were performed to investigate the crystal structure of the
Superconductivity at 43K in SmFeAsO1-xFx
Chen, X. H.; Wu, T.; Wu, G.; Liu, R. H.; Chen, H.; Fang, D. F.
2008-06-01
Since the discovery of high-transition-temperature (high-Tc) superconductivity in layered copper oxides, extensive effort has been devoted to exploring the origins of this phenomenon. A Tc higher than 40K (about the theoretical maximum predicted from Bardeen-Cooper-Schrieffer theory), however, has been obtained only in the copper oxide superconductors. The highest reported value for non-copper-oxide bulk superconductivity is Tc = 39K in MgB2 (ref. 2). The layered rare-earth metal oxypnictides LnOFeAs (where Ln is La-Nd, Sm and Gd) are now attracting attention following the discovery of superconductivity at 26K in the iron-based LaO1-xFxFeAs (ref. 3). Here we report the discovery of bulk superconductivity in the related compound SmFeAsO1-xFx, which has a ZrCuSiAs-type structure. Resistivity and magnetization measurements reveal a transition temperature as high as 43K. This provides a new material base for studying the origin of high-temperature superconductivity.
75 FR 68780 - Cedar Creek Wind Energy, LLC; Notice of Filing
2010-11-09
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. RC11-1-000] Cedar Creek Wind Energy, LLC; Notice of Filing November 2, 2010. Take notice that on October 27, 2010, Cedar Creek Wind Energy, LLC (Cedar Creek) filed an appeal with the Federal Energy Regulatory Commission (Commission) of...
National Oceanic and Atmospheric Administration, Department of Commerce — The BCPITTAGS database is used to store data from an Oncorhynchus mykiss (steelhead/rainbow trout) population dynamics study in Big Creek, a coastal stream along the...
Hydrology of Bishop Creek, California: An Isotopic Analysis
Michael L. Space; John W. Hess; Stanley D. Smith
1989-01-01
Five power generation plants along an eleven kilometer stretch divert Bishop Creek water for hydro-electric power. Stream diversion may be adversely affecting the riparian vegetation. Stable isotopic analysis is employed to determine surface water/ground-water interactions along the creek. surface water originates primarily from three headwater lakes. Discharge into...
Isotope shifts and hyperfine splittings in 144-154Sm I
International Nuclear Information System (INIS)
England, J.G.; Grant, I.S.; Newton, G.W.A.; Walker, P.M.
1990-01-01
The isotope shifts and hyperfine splittings have been measured in 144-154 Sm I using the crossed-beam laser fluorescence method. Transitions at 598.98 nm and 570.68 nm were investigated for all isotopes except 146 Sm and 153 Sm, in which measurements were only obtained at 570.68 nm. Laser-induced fluorescence has not previously been reported for 145 Sm. The magnetic dipole and electric quadrupole moments of the odd isotopes and the changes in mean square radii of the even ones are shown to be consistent with the information obtained from nuclear spectroscopy. (author)
9 CFR 113.326 - Avian Pox Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...
9 CFR 113.39 - Cat safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 113.43-5 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...
Guided ion beam and theoretical studies of the bond energy of SmS+
Armentrout, P. B.; Demireva, Maria; Peterson, Kirk A.
2017-12-01
Previous work has shown that atomic samarium cations react with carbonyl sulfide to form SmS+ + CO in an exothermic and barrierless process. To characterize this reaction further, the bond energy of SmS+ is determined in the present study using guided ion beam tandem mass spectrometry. Reactions of SmS+ with Xe, CO, and O2 are examined. Results for collision-induced dissociation processes with all three molecules along with the endothermicity of the SmS+ + CO → Sm+ + COS exchange reaction are combined to yield D0(Sm+-S) = 3.37 ± 0.20 eV. The CO and O2 reactions also yield a SmSO+ product, with measured endothermicities that indicate D0(SSm+-O) = 3.73 ± 0.16 eV and D0(OSm+-S) = 1.38 ± 0.27 eV. The SmS+ bond energy is compared with theoretical values characterized at several levels of theory, including CCSD(T) complete basis set extrapolations using all-electron basis sets. Multireference configuration interaction calculations with explicit spin-orbit calculations along with composite thermochemistry using the Feller-Peterson-Dixon method and all-electron basis sets were also explored for SmS+, and for comparison, SmO, SmO+, and EuO.
Evaluation of energy deposition by 153Sm in small samples
International Nuclear Information System (INIS)
Cury, M.I.C.; Siqueira, P.T.D.; Yoriyaz, H.; Coelho, P.R.P.; Da Silva, M.A.; Okazaki, K.
2002-01-01
Aim: This work presents evaluations of the absorbed dose by 'in vitro' blood cultures when mixed with 153 Sm solutions of different concentrations. Although 153 Sm is used as radiopharmaceutical mainly due to its beta emission, which is short-range radiation, it also emits gamma radiation which has a longer-range penetration. Therefore it turns to be a difficult task to determine the absorbed dose by small samples where the infinite approximation is no longer valid. Materials and Methods: MCNP-4C (Monte Carlo N - Particle transport code) has been used to perform the evaluations. It is not a deterministic code that calculates the value of a specific quantity solving the physical equations involved in the problem, but a virtual experiment where the events related to the problems are simulated and the concerned quantities are tallied. MCNP also stands out by its possibilities to specify geometrically any problem. However, these features, among others, turns MCNP in a time consuming code. The simulated problem consists of a cylindrical plastic tube with 1.5 cm internal diameter and 0.1cm thickness. It also has 2.0 cm height conic bottom end, so that the represented sample has 4.0 ml ( consisted by 1 ml of blood and 3 ml culture medium). To evaluate the energy deposition in the blood culture in each 153 Sm decay, the problem has been divided in 3 steps to account to the β- emissions (which has a continuum spectrum), gammas and conversion and Auger electrons emissions. Afterwards each emission contribution was weighted and summed to present the final value. Besides this radiation 'fragmentation', simulations were performed for many different amounts of 153 Sm solution added to the sample. These amounts cover a range from 1μl to 0.5 ml. Results: The average energy per disintegration of 153 Sm is 331 keV [1]. Gammas account for 63 keV and β-, conversion and Auger electrons account for 268 keV. The simulations performed showed an average energy deposition of 260 ke
Prediction of the new efficient permanent magnet SmCoNiFe3
Söderlind, P.; Landa, A.; Locht, I. L. M.; Åberg, D.; Kvashnin, Y.; Pereiro, M.; Däne, M.; Turchi, P. E. A.; Antropov, V. P.; Eriksson, O.
2017-09-01
We propose a new efficient permanent magnet, SmCoNiFe3, which is a development of the well-known SmCo5 prototype. More modern neodymium magnets of the Nd-Fe-B type have an advantage over SmCo5 because of their greater maximum energy products due to their iron-rich stoichiometry. Our new magnet, however, removes most of this disadvantage of SmCo5 while preserving its superior high-temperature efficiency over the neodymium magnets. We show by means of first-principles electronic-structure calculations that SmCoNiFe3 has very favorable magnetic properties and could therefore potentially replace SmCo5 or Nd-Fe-B types in various applications.
Ege, John R.; Leavesley, G.H.; Steele, G.S.; Weeks, J.B.
1978-01-01
The U.S. Geological Survey is cooperating with the U.S. Bureau of Mines in the selection of a site for a shaft and experimental mine to be constructed in the Piceance Creek basin, Rio Blanco County, Colo. The Piceance Creek basin, an asymmetric, northwest-trending large structural downwarp, is located approximately 40 km (25 mi) west of the town of Meeker in Rio Blanco County, Colo. The oil-shale, dawsonite, nahcolite, and halite deposits of the Piceance Creek basin occur in the lacustrine Green River Formation of Eocene age. In the basin the Green River Formation comprises three members. In ascending order, they are the Douglas Creek, the Garden Gulch, and the Parachute Creek Members, Four sites are presented for consideration and evaluated on geology and hydrology with respect to shale-oil economics. Evaluated criteria include: (1) stratigraphy, (2) size of site, (3) oil-shale yield, (4) representative quantities of the saline minerals dawsonite and nahcolite, which must be present with a minimum amount of halite, (5) thickness of a 'leached' saline zone, (6) geologic structure, (7) engineering characteristics of rock, (8) representative surface and ground-water conditions, with emphasis on waste disposal and dewatering, and (9) environmental considerations. Serious construction and support problems are anticipated in sinking a deep shaft in the Piceance Creek basin. The two major concerns will be dealing with incompetent rock and large inflow of saline ground water, particularly in the leached zone. Engineering support problems will include stabilizing and hardening the rock from which a certain amount of ground water has been removed. The relative suitability of the four potential oil-shale experimental shaft sites in the Piceance Creek basin has been considered on the basis of all available geologic, hydrologic, and engineering data; site 2 is preferred to sites 1, 3, and 4, The units in this report are presented in the form: metric (English). Both units of
2013-10-25
...] Notice of Availability of the Final Environmental Impact Statement for the Jump Creek, Succor Creek, and... Field Office Jump Creek, Succor Creek and Cow Creek Watersheds grazing permit renewal, and by this... in the Federal Register. ADDRESSES: Copies of the Jump Creek, Succor Creek and Cow Creek Watersheds...
Flood-Inundation Maps for Sugar Creek at Crawfordsville, Indiana
Martin, Zachary W.
2016-06-06
Digital flood-inundation maps for a 6.5-mile reach of Sugar Creek at Crawfordsville, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind. Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at this site (NWS site CRWI3).Flood profiles were computed for the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind., reach by means of a one-dimensional step-backwater hydraulic modeling software developed by the U.S. Army Corps of Engineers. The hydraulic model was calibrated using the current stage-discharge rating at the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind., and high-water marks from the flood of April 19, 2013, which reached a stage of 15.3 feet. The hydraulic model was then used to compute 13 water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum ranging from 4.0 ft (the NWS “action stage”) to 16.0 ft, which is the highest stage interval of the current USGS stage-discharge rating curve and 2 ft higher than the NWS “major flood stage.” The simulated water-surface profiles were then combined with a Geographic Information System digital elevation model (derived from light detection and ranging [lidar]) data having a 0.49-ft root mean squared error and 4.9-ft horizontal resolution) to delineate the area flooded at each stage.The availability
1983-07-01
occurred within 40 miles of’ the site. Most of these earthquakes appear to be related to activity on the Elsinore, Agua Caliente, and offshore faults. The...device would be required by the Sweetwater Authority to prevent contamination of potable water lines. TELEGRAPH CANYON CREEK - - Recommended Plant List A
2013-05-03
...] Notice of Availability of the Draft Environmental Impact Statement for the Jump Creek, Succor Creek, and... the Jump Creek, Succor Creek, and Cow Creek Watersheds Grazing Permit Renewal and by this notice is... receive written comments on the Draft EIS for the Jump Creek, Succor Creek, and Cow Creek Watersheds...
Superconductivity in Sm-doped CaFe2As2 single crystals
Dong-Yun, Chen; Bin-Bin, Ruan; Jia, Yu; Qi, Guo; Xiao-Chuan, Wang; Qing-Ge, Mu; Bo-Jin, Pan; Tong, Liu; Gen-Fu, Chen; Zhi-An, Ren
2016-06-01
In this article, the Sm-doping single crystals Ca1 - x Sm x Fe2As2 (x = 0 ˜ 0.2) were prepared by the CaAs flux method, and followed by a rapid quenching treatment after the high temperature growth. The samples were characterized by structural, resistive, and magnetic measurements. The successful Sm-substitution was revealed by the reduction of the lattice parameter c, due to the smaller ionic radius of Sm3+ than Ca2+. Superconductivity was observed in all samples with onset T c varying from 27 K to 44 K upon Sm-doping. The coexistence of a collapsed phase transition and the superconducting transition was found for the lower Sm-doping samples. Zero resistivity and substantial superconducting volume fraction only happen in higher Sm-doping crystals with the nominal x > 0.10. The doping dependences of the c-axis length and onset T c were summarized. The high-T c observed in these quenched crystals may be attributed to simultaneous tuning of electron carriers doping and strain effect caused by lattice reduction of Sm-substitution. Project supported by the National Natural Science Foundation of China (Grant No. 11474339), the National Basic Research Program of China (Grant Nos. 2010CB923000 and 2011CBA00100), and the Strategic Priority Research Program of the Chinese Academy of Sciences (Grant No. XDB07020100).
Evaluation the homogenisation behaviour of Sm-Fe-Nb materials by Moessbauer spectroscopy
International Nuclear Information System (INIS)
Sinan, S. A.; Muryaed, Y.; Alhweg, F. A.
2004-01-01
The microstructure of cast and annealed Sm-Fe-Nb materials were investigated by Moessbauer spectroscopy. The aim of the present work is to study the effect of Nb additions upon the microstructure of Sm 2 Fe 17 material and evaluation the homogenisation behaviour of different Sm-Fe-Nb materials. The niobium free cast material consisting of the Sm 2 Fe 17 phase and significant amounts of the free iron (α -Fe). Therefore, the homogenisation process is necessary to eliminate the free iron and produce a single Sm 2 Fe 17 phase material. This process takes long annealing time, up to seven days. The Sm 9 .5 Fe 8 7.5 Nb 3 alloy contains the lowest amount of α-Fe among, the Sm-Fe-Nb materials. Thus the homogenisation step was carried out with treatment time (12 hours) smaller than the reported annealing time of Nb-free material (Sm 2 Fe 17 ). Therefore, the addition of at 3% Nb reduces the manufacturing cost of the Sm 2 Fe 17 and makes this based material for permanent magnets, more industrially desirable, due to elimination the free iron with lowest treatment time. Also it was found that the existence of the paramagnetic NbFe 2 phase becomes higher after the homogenisation process, which can be explained due to the diffusion of Nb from Sm 2 Fe 17 phase to paramagnetic NbFe 2 phase, during the annealing process. (authors)
Pine Creek Ranch, FY 2001 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Berry, Mark E.
2001-11-01
Pine Creek Ranch was purchased in 1999 by the Confederated Tribes of Warm Springs using Bonneville Power Administration Fish and Wildlife Habitat Mitigation funds. The 25,000 acre property will be managed in perpetuity for the benefit of fish and wildlife habitat. Major issues include: (1) Restoring quality spawning and rearing habitat for stealhead. Streams are incised and fish passage barriers exist from culverts and possibly beaver dams. In addition to stealhead habitat, the Tribes are interested in overall riparian recovery in the John Day River system for wildlife habitat, watershed values and other values such as recreation. (2) Future grazing for specific management purposes. Past grazing practices undoubtedly contributed to current unacceptable conditions. The main stem of Pine Creek has already been enrolled in the CREP program administered by the USDA, Natural Resource Conservation Service in part because of the cost-share for vegetation restoration in a buffer portion of old fields and in part because of rental fees that will help the Tribes to pay the property taxes. Grazing is not allowed in the riparian buffer for the term of the contract. (3) Noxious weeds are a major concern. (4) Encroachment by western juniper throughout the watershed is a potential concern for the hydrology of the creek. Mark Berry, Habitat Manager, for the Pine Creek Ranch requested the Team to address the following objectives: (1) Introduce some of the field staff and others to Proper Functioning Condition (PFC) assessments and concepts. (2) Do a PFC assessment on approximately 10 miles of Pine Creek. (3) Offer management recommendations. (4) Provide guidelines for monitoring.
The SM and MIR reactors operation experience
International Nuclear Information System (INIS)
Kuprienko, V.A.; Klinov, A.V.; Svyatkin, M.N.; Shamardin, V.K.
1995-01-01
The SM and MIR operation experience show that continuous work on the problem of ageing, in all its aspects, allows for prolongation of the research plant life cycle by several folds as compared to the initial project. The redesigned SM-3 reactor will operate for another 20 years. The similar result is expected from the MIR planned reconstruction which scope will be the topic of future presentations. (orig.)
Aligned, plasma sprayed SmCo5 deposits
International Nuclear Information System (INIS)
Kumar, K.; Das, D.
1986-01-01
Highly aligned SmCo 5 deposits were produced using plasma spraying. c-axis alignment, normal to the plane of the deposit, was achieved by depositing the Sm-Co alloys on steel substrates maintained at high temperatures. The substrates were heated by the plasma flame to obtain the high temperatures. The attainment of a range of substrate temperatures was made possible through control over the geometry of the substrate
Graczyk, David J.; Walker, John F.; Bannerman, Roger T.; Rutter, Troy D.
2012-01-01
In many watersheds, nonpoint-source contamination is a major contributor to water-quality problems. In response to the recognition of the importance of nonpoint sources, the Wisconsin Nonpoint Source Water Pollution Abatement Program (Nonpoint Program) was enacted in 1978. This report summarizes the results of a study to assess the effectiveness of watershed-management practices for controlling nonpoint-source contamination for the Eagle Creek and Joos Valley Creek Watersheds. Streamflow-gaging stations equipped for automated sample collection and continuous recording of stream stage were installed in July 1990 at Eagle and Joos Valley Creeks and were operated through September 2007. In October 1990, three rain gages were installed in each watershed and were operated through September 2007. Best-Management Practices (BMPs) were installed during 1993 to 2000 in Eagle and Joos Valley Creeks and were tracked throughout the study period. By the year 2000, a majority of the BMPs were implemented in the two watersheds and goals set by the Wisconsin Department of Natural Resources and the local Land Conservation Department had been achieved for the two study watersheds (Wisconsin Department of Natural Resources, 1990). The distributions of the rainstorms that produced surface runoff and storm loads were similar in the pre-BMP (1990-93) and post-BMP implementation (2000-07) periods for both Eagle and Joos Valley Creeks. The highest annual streamflow occurred at both sites in water year 1993, which corresponded to the greatest above normal nonfrozen precipitation measured at two nearby NOAA weather stations. The minimum streamflow occurred in water year 2007 at both sites. Base-flow and stormwater samples were collected and analyzed for suspended solids, total phosphorus, and ammonia nitrogen. For both Eagle and Joos Valley Creeks the median concentrations of suspended solids and total phosphorus in base flow were lower during the post-BMP period compared to the pre
Vegetation survey of Four Mile Creek wetlands. [Savannah River Plant
Energy Technology Data Exchange (ETDEWEB)
Loehle, C.
1990-11-01
A survey of forested wetlands along upper Four Mile Creek was conducted. The region from Road 3 to the creek headwaters was sampled to evaluate the composition of woody and herbaceons plant communities. All sites were found to fall into either the Nyssa sylvatica (Black Gum) -- Persea borbonia (Red Bay) or Nyssa sylvatica -- Acer rubrum (Red Maple) types. These community types are generally species-rich and diverse. Previous studies (Greenwood et al., 1990; Mackey, 1988) demonstrated contaminant stress in areas downslope from the F- and H-Area seepage basins. In the present study there were some indications of contaminant stress. In the wetland near H-Area, shrub basal area, ground cover stratum species richness, and diversity were low. In the area surrounding the F-Area tree kill zone, ground cover stratum cover and shrub basal area were low and ground cover stratum species richness was low. The moderately stressed site at F-Area also showed reduced overstory richness and diversity and reduced ground cover stratum richness. These results could, however, be due to the very high basal area of overstory trees in both stressed F-Area sites that would reduce light availability to understory plants. No threatened or endangered plant species were found in the areas sampled. 40 refs., 4 figs., 8 tabs.
The electrodeposition of 149Sm targets for (n,α) studies
International Nuclear Information System (INIS)
Ingelbrecht, C.; Ambeck-Madsen, J.; Teipel, K.; Robouch, P.; Arana, G.; Pomme, S.
1999-01-01
A method of electrodeposition from ethanol was developed for the production of 149 Sm targets of area 50x60 mm 2 to be used for (n,α) experiments. Targets of 60 μg cm -2 Sm were obtained with a Sm yield of 50% and a Sm mass fraction of 35% after calcination of the layers at 450 deg. C. Target substrates were 20 μm aluminium foils mounted on brass frames. A water cooling jig was constructed to protect the glue used for mounting during the calcination process. The layers were characterized by inductively coupled plasma source mass spectrometry (ICP-MS) and by neutron activation analysis (NAA)
Streamflow conditions along Soldier Creek, Northeast Kansas
Juracek, Kyle E.
2017-11-14
The availability of adequate water to meet the present (2017) and future needs of humans, fish, and wildlife is a fundamental issue for the Prairie Band Potawatomi Nation in northeast Kansas. Because Soldier Creek flows through the Prairie Band Potawatomi Nation Reservation, it is an important tribal resource. An understanding of historical Soldier Creek streamflow conditions is required for the effective management of tribal water resources, including drought contingency planning. Historical data for six selected U.S. Geological Survey (USGS) streamgages along Soldier Creek were used in an assessment of streamflow characteristics and trends by Juracek (2017). Streamflow data for the period of record at each streamgage were used to compute annual mean streamflow, annual mean base flow, mean monthly flow, annual peak flow, and annual minimum flow. Results of the assessment are summarized in this fact sheet.
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
Role of SM22 in the differential regulation of phasic vs. tonic smooth muscle
Ali, Mehboob
2015-01-01
Preliminary proteomics studies between tonic vs. phasic smooth muscles identified three distinct protein spots identified to be those of transgelin (SM22). The latter was found to be distinctly downregulated in the internal anal sphincter (IAS) vs. rectal smooth muscle (RSM) SMC. The major focus of the present studies was to examine the differential molecular control mechanisms by SM22 in the functionality of truly tonic smooth muscle of the IAS vs. the adjoining phasic smooth muscle of the RSM. We monitored SMC lengths before and after incubation with pFLAG-SM22 (for SM22 overexpression), and SM22 small-interfering RNA. pFLAG-SM22 caused concentration-dependent and significantly greater relaxation in the IAS vs. the RSM SMCs. Conversely, temporary silencing of SM22 caused contraction in both types of the SMCs. Further studies revealed a significant reverse relationship between the levels of SM22 phosphorylation and the amount of SM22-actin binding in the IAS and RSM SMC. Data showed higher phospho-SM22 levels and decreased SM22-actin binding in the IAS, and reverse to be the case in the RSM SMCs. Experiments determining the mechanism for SM22 phosphorylation in these smooth muscles revealed that Y-27632 (Rho kinase inhibitor) but not Gö-6850 (protein kinase C inhibitor) caused concentration-dependent decreased phosphorylation of SM22. We speculate that SM22 plays an important role in the regulation of basal tone via Rho kinase-induced phosphorylation of SM22. PMID:25617350
A metastable Mg11Sm phase obtained by rapid solidification
International Nuclear Information System (INIS)
Budurov, S.
1993-01-01
Molten Mg-Sm alloys with a Sm concentration of 4.93, 6.86, and 8.35 at.% were rapidly soldified with the aid of a shock wave gun device. Investigations of the obtained splats were performed with the aid of DSC, X-ray analysis, and metallography. Rapid soldification of the eutectic MgSm 8.35 alloy forms a new Im3m-type phase. (orig.)
Missing link between the Hayward and Rodgers Creek faults.
Watt, Janet; Ponce, David; Parsons, Tom; Hart, Patrick
2016-10-01
The next major earthquake to strike the ~7 million residents of the San Francisco Bay Area will most likely result from rupture of the Hayward or Rodgers Creek faults. Until now, the relationship between these two faults beneath San Pablo Bay has been a mystery. Detailed subsurface imaging provides definitive evidence of active faulting along the Hayward fault as it traverses San Pablo Bay and bends ~10° to the right toward the Rodgers Creek fault. Integrated geophysical interpretation and kinematic modeling show that the Hayward and Rodgers Creek faults are directly connected at the surface-a geometric relationship that has significant implications for earthquake dynamics and seismic hazard. A direct link enables simultaneous rupture of the Hayward and Rodgers Creek faults, a scenario that could result in a major earthquake ( M = 7.4) that would cause extensive damage and loss of life with global economic impact.
33 CFR 136.113 - Other compensation.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...
2010-07-01
... KOOTENAI BASIN: Ball Creek, Boundary Creek, Brush Creek, Cabin Creek, Caribou Creek, Cascade Creek, Cooks...), Setzer Creek, Sherlock Creek, Simmons Creek, Siwash Creek, Skookum Creek, Thomas Creek, Thorn Creek... Creek, Cold Creek, Collie Creek, Colt Creek, Cook Creek, Corley Creek, Cornish Creek, Cottonwood Creek...
Low temperature preparation and superconductivity of F-doped SmFeAsO
Energy Technology Data Exchange (ETDEWEB)
Chen, Y.L.; Cui, Y.J. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Cheng, C.H. [School of Materials Science and Engineering, University of New South Wales, Sydney, 2052 NSW (Australia); Yang, Y.; Wang, L.; Li, Y.C.; Zhang, Y. [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Zhao, Y., E-mail: yzhao@swjtu.edu.c [Key Laboratory of Magnetic Levitation Technologies and Maglev Trains (Ministry of Education of China), Superconductivity R and D Center (SRDC), Mail Stop 165, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Materials Science and Engineering, University of New South Wales, Sydney, 2052 NSW (Australia)
2010-11-01
A low temperature (1100 deg. C) process of preparing F-doped SmFeAsO samples has been developed using SmF{sub 3} with nanometer scale as the source of fluorine. A series of the SmFeAsO{sub 1-x}F{sub x} (x = 0, 0.05, 0.1, 0.15, 0.2, 0.25, 0.3) samples have been prepared using the present method. Compared with previous reports, the present SmF{sub 3} is more effective to introduce F into SmFeAsO system in which a transition temperature of 39 K can be observed when x = 0.05. The superconductivity is definitely enhanced with the increasing F-doping level. All the samples presented to be layered structure and the crystal particle size is about three times larger with sintering time increasing from 36 h to 48 h. Except for the nanometer scale of SmF{sub 3}, the flux effect of SmF{sub 3} is recognized to be another reason for the decrease of the sintering temperature. Further more, a relatively large amount of SmF{sub 3} was also employed in the raw materials to introduce excessive F and this has induced higher T{sub c} (55 K) in SmFeAsO{sub 0.8}F{sub 0.2+{delta}}system.
The glomerular parietal epithelial cell's responses are influenced by SM22 alpha levels.
Naito, Shokichi; Pippin, Jeffrey W; Shankland, Stuart J
2014-11-06
Studies have shown in several diseases initially affecting podocytes, that the neighboring glomerular parietal epithelial cells (PECs) are secondarily involved. The PEC response might be reparative under certain circumstances, yet injurious under others. The factors governing these are not well understood. We have shown that SM22α, an actin-binding protein considered a marker of smooth muscle differentiation, is upregulated in podocytes and PECs in several models of podocyte disease. However, the impact of SM22α levels on PECs is not known. Experimental glomerular disease, characterized by primary podocyte injury, was induced in aged-matched SM22α+/+ and SM22α-/-mice by intraperitoneal injection of sheep anti-rabbit glomeruli antibody. Immunostaining methods were employed on days 7 and 14 of disease. The number of PEC transition cells, defined as cells co-expressing a PEC protein (PAX2) and podocyte protein (Synaptopodin) was higher in diseased SM22α-/-mice compared with SM22α+/+mice. WT1 staining along Bowman's capsule is higher in diseased SM22α-/-mice. This was accompanied by increased PEC proliferation (measured by ki-67 staining), and an increase in immunostaining for the progenitor marker NCAM, in a subpopulation of PECs in diseased SM22α-/-mice. In addition, immunostaining for vimentin and alpha smooth muscle actin, markers of epithelial-to-mesenchymal transition (EMT), was lower in diseased SM22α-/-mice compared to diseased SM22α+/+mice. SM22α levels may impact how PECs respond following a primary podocyte injury in experimental glomerular disease. Absent/lower levels favor an increase in PEC transition cells and PECs expressing a progenitor marker, and a lower EMT rate compared to SM22α+/+mice, where SM22 levels are markedly increased in PECs.
Electronic structure and equation of state of Sm2Co17 from first-principles DFT+ U
Huang, Patrick; Butch, Nicholas P.; Jeffries, Jason R.; McCall, Scott K.
2013-03-01
Rare-earth intermetallics have important applications as permanent magnet materials, and the rational optimization of their properties would benefit greatly from guidance from ab initio modeling. However, these systems are particularly challenging for current electronic structure methods. Here, we present an ab initio study of the prototype material Sm2Co17 and related compounds, using density functional theory with a Hubbard correction for the Sm 4 f-electrons (DFT+ U method) and ultrasoft pseudopotentials. The Hubbard U parameter is derived from first principles [Cococcioni and de Gironcoli, PRB 71, 035105 (2005)], not fit to experiment. Our calculations are in good agreement with recent photoemission measurements at ambient pressure and the equation of state up to 40 GPa, thus supporting the validity of our DFT+ U model. Prepared by LLNL under Contract DE-AC52-07NA27344.
7 CFR 1955.113 - Price (housing).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...
Kelly, Brian; Cichocki, Ronald; Poirier, Gerald; Unruh, Karl
The SmCoO3 to nanostructured Sm2O3 and Co oxidation and reduction reaction has been studied by thermogravimetric analysis (TGA) measurements in forming gas (FG) and inert N2 atmospheres, x-ray diffraction (XRD) and vibrating sample magnetometry (VSM). The TGA measurements showed two clearly resolvable reduction processes when heating in FG, from the initial SmCoO3 phase through an intermediate nanostructured mixture of Sm2O3 and CoO when heated to 330°C for several minutes, and then the conversion of CoO to metallic Co when heated above 500°C. These phases were confirmed by XRD and VSM. Similar measurements in N2 yielded little mass change below 900°C and coupled reduction processes at higher temperatures. Isoconversional measurements of the CoO to Co reduction reaction in FG yielded activation energies above 2eV/atom in the nanostructured system. This value is several times larger than those reported in the literature or obtained by similar measurements of bulk mixtures of Sm2O3 and CoO, suggesting the nanostructuring was the source of the large increase in activation energy.
Investigating the Maya Polity at Lower Barton Creek Cayo, Belize
Kollias, George Van, III
The objectives of this research are to determine the importance of Lower Barton Creek in both time and space, with relation to other settlements along the Belize River Valley. Material evidence recovered from field excavations and spatial information developed from Lidar data were employed in determining the socio-political nature and importance of this settlement, so as to orient its existence within the context of ancient socio-political dynamics in the Belize River Valley. Before the investigations detailed in this thesis no archaeological research had been conducted in the area, the site of Lower Barton Creek itself was only recently identified via the 2013 West-Central Belize LiDAR Survey (WCBLS 2013). Previously, the southern extent of the Barton Creek area represented a major break in our knowledge not only of the Barton Creek area, but the southern extent of the Belize River Valley. Conducting research at Lower Barton Creek has led to the determination of the polity's temporal existence and allowed for a greater and more complex understanding of the Belize River Valley's interaction with regions abutting the Belize River Valley proper.
Synthesis and physicochemical analysis of Sm (II, III) acetylacetone chelate complexes
International Nuclear Information System (INIS)
Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.
2004-01-01
Sm (II, III) acetylacetone chelate complexes were synthesized by electrochemical method. It was shown that anode dissolution of the metal samarium over acetylacetone leads to formation of the Sm (II, III) chelate complexes: xSm(acac)2 · ySm(acac)3 · zH(acac). Factors x, y and z depend on quantity of the electricity, which flew through the electrolysis cell. The compositions of the obtained substances were confirmed by the physicochemical analysis (ultimate analysis, IR-, mass spectroscopy and thermal analysis (thermogravimetric, isothermal warming-up and differential scanning colorimetry). (Authors)
Musser, Jonathan W.
2012-01-01
Digital flood-inundation maps for a 6.9-mile reach of Suwanee Creek, from the confluence of Ivy Creek to the Noblin Ridge Drive bridge, were developed by the U.S. Geological Survey (USGS) in cooperation with Gwinnett County, Georgia. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage at Suwanee Creek at Suwanee, Georgia (02334885). Current stage at this USGS streamgage may be obtained at http://waterdata.usgs.gov/ and can be used in conjunction with these maps to estimate near real-time areas of inundation. The National Weather Service (NWS) is incorporating results from this study into the Advanced Hydrologic Prediction Service (AHPS) flood-warning system (http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that commonly are collocated at USGS streamgages. The forecasted peak-stage information for the USGS streamgage at Suwanee Creek at Suwanee (02334885), available through the AHPS Web site, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. A one-dimensional step-backwater model was developed using the U.S. Army Corps of Engineers HEC-RAS software for Suwanee Creek and was used to compute flood profiles for a 6.9-mile reach of the creek. The model was calibrated using the most current stage-discharge relations at the Suwanee Creek at Suwanee streamgage (02334885). The hydraulic model was then used to determine 19 water-surface profiles for flood stages at the Suwanee Creek streamgage at 0.5-foot intervals referenced to the streamgage. The profiles ranged from just above bankfull stage (7.0 feet) to approximately 1.7 feet above the highest recorded water level at the streamgage (16.0 feet). The simulated water-surface profiles were then combined
Tidal Creek Sentinel Habitat Database
National Oceanic and Atmospheric Administration, Department of Commerce — The Ecological Research, Assessment and Prediction's Tidal Creeks: Sentinel Habitat Database was developed to support the National Oceanic and Atmospheric...
2010-01-20
...; Oregon; Mill Creek; Allotment Management Plans EIS AGENCY: Forest Service, USDA. ACTION: Notice of intent... allotments on the Lookout Mountain Ranger District. These four allotments are: Cox, Craig, Mill Creek, and..., Mill Creek and Old Dry Creek allotments. The responsible official will also decide how to mitigate...
40 CFR 65.113 - Standards: Sampling connection systems.
2010-07-01
... of § 65.115; or (4) Collect, store, and transport the purged process fluid to any of the following... industrial solid waste, if the process fluids are not hazardous waste as defined in 40 CFR part 261; and (5...
Ecological effects of contaminants and remedial actions in Bear Creek
Energy Technology Data Exchange (ETDEWEB)
Southworth, G.R.; Loar, J.M.; Ryon, M.G.; Smith, J.G.; Stewart, A.J. (Oak Ridge National Lab., TN (United States)); Burris, J.A. (C. E. Environmental, Inc., Tallahassee, FL (United States))
1992-01-01
Ecological studies of the Bear Creek watershed, which drains the area surrounding several Oak Ridge Y-12 Plant waste disposal facilities, were initiated in May 1984 and are continuing at present. These studies consisted of an initial, detailed characterization of the benthic invertebrate and fish communities in Bear Creek, and they were followed by a presently ongoing monitoring phase that involves reduced sampling intensities. The characterization phase utilized two approaches: (1) instream sampling of benthic invertebrate and fish communities in Bear Creek to identify spatial and temporal patterns in distribution and abundance and (2) laboratory bioassays on water samples from Bear Creek and selected tributaries to identify potential sources of toxicity to biota. The monitoring phase of the ecological program relates to the long-term goals of identifying and prioritizing contaminant sources and assessing the effectiveness of remedial actions. It continues activities of the characterization phase at less frequent intervals. The Bear Greek Valley is a watershed that drains the area surrounding several closed Oak Ridge Y-12 Plant waste disposal facilities. Past waste disposal practices in Bear Creek Valley resulted in contamination of Bear Creek and consequent ecological damage. Extensive remedial actions have been proposed at waste sites, and some of the have been implemented or are now underway. The proposed study plan consists of an initial, detailed characterization of the benthic invertebrate and fish communities in Bear Creek in the first year followed by a reduction in sampling intensity during the monitoring phase of the plan. The results of sampling conducted from May 1984 through early 1989 are presented in this report.
Ecological effects of contaminants and remedial actions in Bear Creek
International Nuclear Information System (INIS)
Southworth, G.R.; Loar, J.M.; Ryon, M.G.; Smith, J.G.; Stewart, A.J.; Burris, J.A.
1992-01-01
Ecological studies of the Bear Creek watershed, which drains the area surrounding several Oak Ridge Y-12 Plant waste disposal facilities, were initiated in May 1984 and are continuing at present. These studies consisted of an initial, detailed characterization of the benthic invertebrate and fish communities in Bear Creek, and they were followed by a presently ongoing monitoring phase that involves reduced sampling intensities. The characterization phase utilized two approaches: (1) instream sampling of benthic invertebrate and fish communities in Bear Creek to identify spatial and temporal patterns in distribution and abundance and (2) laboratory bioassays on water samples from Bear Creek and selected tributaries to identify potential sources of toxicity to biota. The monitoring phase of the ecological program relates to the long-term goals of identifying and prioritizing contaminant sources and assessing the effectiveness of remedial actions. It continues activities of the characterization phase at less frequent intervals. The Bear Greek Valley is a watershed that drains the area surrounding several closed Oak Ridge Y-12 Plant waste disposal facilities. Past waste disposal practices in Bear Creek Valley resulted in contamination of Bear Creek and consequent ecological damage. Extensive remedial actions have been proposed at waste sites, and some of the have been implemented or are now underway. The proposed study plan consists of an initial, detailed characterization of the benthic invertebrate and fish communities in Bear Creek in the first year followed by a reduction in sampling intensity during the monitoring phase of the plan. The results of sampling conducted from May 1984 through early 1989 are presented in this report
Study on cellular survival adaptive response induced by low dose irradiation of 153Sm
International Nuclear Information System (INIS)
Zhu Shoupeng; Xiao Dong
1999-01-01
The present study engages in determining whether low dose irradiation of 153 Sm could cut down the responsiveness of cellular survival to subsequent high dose exposure of 153 Sm so as to make an inquiry into approach the protective action of adaptive response by second irradiation of 153 Sm. Experimental results indicate that for inductive low dose of radionuclide 153 Sm 3.7 kBq/ml irradiated beforehand to cells has obvious resistant effect in succession after high dose irradiation of 153 Sm 3.7 x 10 2 kBq/ml was observed. Cells exposed to low dose irradiation of 153 Sm become adapted and therefore the subsequent cellular survival rate induced by high dose of 153 Sm is sufficiently higher than high dose of 153 Sm merely. It is evident that cellular survival adaptive response could be induced by pure low dose irradiation of 153 Sm only
Soil Moisture Active Passive Mission L4_SM Data Product Assessment (Version 2 Validated Release)
Reichle, Rolf Helmut; De Lannoy, Gabrielle J. M.; Liu, Qing; Ardizzone, Joseph V.; Chen, Fan; Colliander, Andreas; Conaty, Austin; Crow, Wade; Jackson, Thomas; Kimball, John;
2016-01-01
core validation site comparisons indicate that "Version 2" of the L4_SM data product meets the self-imposed L4_SM accuracy requirement, which is formulated in terms of the ubRMSE: the RMSE (Root Mean Square Error) after removal of the long-term mean difference. The overall ubRMSE of the 3-hourly L4_SM surface soil moisture at the 9 km scale is 0.035 cubic meters per cubic meter requirement. The corresponding ubRMSE for L4_SM root zone soil moisture is 0.024 cubic meters per cubic meter requirement. Both of these metrics are comfortably below the 0.04 cubic meters per cubic meter requirement. The L4_SM estimates are an improvement over estimates from a model-only SMAP Nature Run version 4 (NRv4), which demonstrates the beneficial impact of the SMAP brightness temperature data. L4_SM surface soil moisture estimates are consistently more skillful than NRv4 estimates, although not by a statistically significant margin. The lack of statistical significance is not surprising given the limited data record available to date. Root zone soil moisture estimates from L4_SM and NRv4 have similar skill. Results from comparisons of the L4_SM product to in situ measurements from nearly 400 sparse network sites corroborate the core validation site results. The instantaneous soil moisture and soil temperature analysis increments are within a reasonable range and result in spatially smooth soil moisture analyses. The O-F residuals exhibit only small biases on the order of 1-3 degrees Kelvin between the (re-scaled) SMAP brightness temperature observations and the L4_SM model forecast, which indicates that the assimilation system is largely unbiased. The spatially averaged time series standard deviation of the O-F residuals is 5.9 degrees Kelvin, which reduces to 4.0 degrees Kelvin for the observation-minus-analysis (O-A) residuals, reflecting the impact of the SMAP observations on the L4_SM system. Averaged globally, the time series standard deviation of the normalized O-F residuals is
International Nuclear Information System (INIS)
Guzman Acevedo, C.
1981-08-01
Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable
PVD Ti coatings on Sm-Co magnets
International Nuclear Information System (INIS)
Bovda, O.M.; Bovda, V.O.; Garkusha, I.E.; Leonov, S.O.; Onishchenko, L.V.; Tereshin, V.I.; Totrika, O.S.; Chen, C.H.
2008-01-01
The combination of conventional ion-plasma deposition (PVD) and pulsed plasma technologies (PPT) has been applied for rare-earth Sm-Co based magnets, to provide them with enhanced corrosion resistance. The influence of pulsed plasma treatment on Sm-Co magnets with deposited titanium PVD coatings has been investigated. It was revealed that thickness of modified layer significantly depends on the thickness of initial titanium film and plasma treatment regimes. As a result of plasma treatment with energy density of 30 J/cm 2 and pulse duration of ∼ 5 μs fine-grained layer with the thickness of 70 microns has been formed on the Sm-Co magnet with pure titanium film of 50 micron. According to SEM analyses considerable diffusion of titanium to the bulk of the magnet, on the depth of 20 microns, took place. Such reaction enhances strong bonding between the coating and the magnet
Magnetic anisotropies in SmCo thin films
International Nuclear Information System (INIS)
Chen, K.
1993-01-01
A systemic study of the deposition processes and magnetic properties for the Sm-Co film system has been carried out. Films of Sm-Co system with various magnetic anisotropies have been synthesized through sputter deposition in both crystalline and amorphous phases. The origins of various anisotropies have been studied. Thermalized sputter deposition process control was used to synthesize Fe enriched Sm-Co films with rhombohedral Th 2 Zn 17 type structure. The film exhibited unusually strong textures with the crystallographic c axes of the crystallites aligned in the film plane. A large anisotropy was resulted with easy axis in the film plane. A well defined and large in-the-film-plane anisotropy of exceptionally high value of 3.3 x 10 6 erg/cm 3 has been obtained in the amorphous SmCo films by applying a magnetic field in the film plane during deposition. It was found that the in-the-film-plane anisotropy depended essentially on the applied field and Sm concentration. For films not synthesized through thermallized sputtering, the easy axis of the film could reoriented. A perpendicular anisotropy was also presented in the film synthesized through thermallized sputtering deposition. A large in-plane anisotropy was obtained in films deposited above ambient temperatures. It was concluded that the surface induced short range ordering was the origin of the in-the-film-phase anisotropy observed in amorphous film deposited in the presence of a magnetic field. The formation mechanism was different from that of the short range ordering induced by field annealing. The perpendicular anisotropy was shown to be growth induced. Large in-plane anisotropy in amorphous films was resulted form partial crystallization in the film. Both the formation of growth induced structure and partial crystallization in the film prevented the formation of the pair ordering and decreased in-the-film-plane anisotropy
Siemion, Jason; McHale, Michael R.; Davis, Wae Danyelle
2016-12-05
Suspended-sediment concentrations (SSCs) and turbidity were monitored within the Beaver Kill, Stony Clove Creek, and Warner Creek tributaries to the upper Esopus Creek in New York, the main source of water to the Ashokan Reservoir, from October 1, 2010, through September 30, 2014. The purpose of the monitoring was to determine the effects of suspended-sediment and turbidity reduction projects (STRPs) on SSC and turbidity in two of the three streams; no STRPs were constructed in the Beaver Kill watershed. During the study period, four STRPs were completed in the Stony Clove Creek and Warner Creek watersheds. Daily mean SSCs decreased significantly for a given streamflow after the STRPs were completed. The most substantial decreases in daily mean SSCs were measured at the highest streamflows. Background SSCs, as measured in water samples collected in upstream reference stream reaches, in all three streams in this study were less than 5 milligrams per liter during low and high streamflows. Longitudinal stream sampling identified stream reaches with failing hillslopes in contact with the stream channel as the primary sediment sources in the Beaver Kill and Stony Clove Creek watersheds.
Graczyk, David J.; Robertson, Dale M.; Baumgart, Paul D.; Fermanich, Kevin J.
2011-01-01
A 3-year study was conducted by the U.S. Geological Survey and the University of Wisconsin-Green Bay to characterize water quality in agricultural streams in the Fox/Wolf watershed in northeastern Wisconsin and provide information to assist in the calibration of a watershed model for the area. Streamflow, phosphorus, and suspended solids data were collected between October 1, 2003, and September 30, 2006, in five streams, including Apple Creek, Ashwaubenon Creek, Baird Creek, Duck Creek, and the East River. During this study, total annual precipitation was close to the 30-year normal of 29.12 inches. The 3-year mean streamflow was highest in the East River (113 ft3/s), followed by Duck Creek (58.2 ft3/s), Apple Creek (26.9 ft3/s), Baird Creek (12.8 ft3/s), and Ashwaubenon Creek (9.1 ft3/s). On a yield basis, during these three years, the East River had the highest flow (0.78 ft3/s/mi2), followed by Baird Creek (0.61 ft3/s/mi2), Apple Creek (0.59 ft3/s/mi2), Duck Creek (0.54 ft3/s/mi2), and Ashwaubenon Creek (0.46 ft3/s/mi2). The overall median total suspended solids (TSS) concentration was highest in Baird Creek (73.5 mg/L), followed by Apple and Ashwaubenon Creeks (65 mg/L), East River (40 mg/L), and Duck Creek (30 mg/L). The median total phosphorus (TP) concentration was highest in Ashwaubenon Creek (0.60 mg/L), followed by Baird Creek (0.47 mg/L), Apple Creek (0.37 mg/L), East River (0.26 mg/L), and Duck Creek (0.22 mg/L).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...
27 CFR 21.113 - Isopropyl alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...
9 CFR 113.451 - Tetanus Antitoxin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...
Characterization of surface water contaminants in the Clinch River and Poplar Creek
International Nuclear Information System (INIS)
Ford, C.; Madix, S.; Rash, C.
1995-01-01
Surface waters in the Clinch River and Poplar Creek have been contaminated by activities on the DOE's Oak Ridge Reservation throughout the more than 50 year history of Oak Ridge. Though the Clinch River and Poplar Creek drainage areas are contaminated with heavy metals, organics and radionuclides, public access to these sites is not restricted. The investigation, divided into discrete studies, was tailored to provide a statistically sound picture of contaminants and aqueous toxicity in Poplar Creek, investigate contaminant remobilization from sediments, and determine contaminant levels during a series of ''worst-case'' events. Results for Poplar Creek indicate that average contaminant values were below levels of concern for human health and ecological risk, though contaminant distributions suggest that episodic events contribute sufficiently to system contaminant levels to be of concern. Additionally, water column contaminant levels were significantly higher in particle deposition areas rather than at known contaminant sources. Levels of organic compounds in reference areas to Poplar Creek exceeded those in the Poplar Creek study area. In the Clinch River and Poplar Creek, statistical differences in metal and radionuclide levels from known contaminated areas confirmed previous results, and were used to independently distinguish between sites. Contaminant concentrations were elevated in association with sediments, though no distinction between deposition and remobilization could be made. Due to elevated contaminant levels, and some unexpected contaminant distributions, sites in Poplar Creek and off-channel embayments of the Clinch River were identified that will require additional characterization
Mixed Messages from Garnet Lu-Hf and Sm-Nd Geochronology
Vervoort, J. D.; Wang, D.; Johnson, T. A.
2017-12-01
Garnet geochronology provides important information on the timing and conditions of metamorphism. As a major indicator mineral formed during metamorphism, its direct dating can not only help establish the timing of metamorphism, provide the "t" for P-T-t paths, but also, if the dated garnet can be placed in a textural context, can provide information on the timing of deformational features. With advances in chemistry and mass spectrometry, garnet Lu-Hf and Sm-Nd geochronology has become an important geochronological tool and we can now reliably (if not routinely) date a wide variety of garnet compositions formed under diverse conditions. In the course of dating a variety of lithologies using both Lu-Hf and Sm-Nd isotope systems, however, some intriguing results have emerged. Although there are many examples where the Lu-Hf and Sm-Nd systems give the same date within uncertainty, there are also many cases where these systems yield significantly different dates, and the differences between these dates can be considerable—many 10's of Ma of and even 100's of Ma. For example, in garnet-bearing Mesoproterozoic gneisses from across the Blue Ridge Province in Virginia, both Lu-Hf and Sm-Nd analyses (determined on the same solutions) define narrow time spans, but with the Sm-Nd dates systematically younger (for orthogneisses Lu-Hf dates are 1032 to 1019 Ma whereas Sm-Nd dates are 965 to 949 Ma—a difference of 67 to 80 Ma). There are many other examples of systematically younger Sm-Nd garnet dates in both the literature and with our ongoing research. Potential explanations for these differences include: 1) strong partitioning of Lu into garnet during growth yielding ages weighted toward the beginning of growth; 2) faster Lu diffusion from high Lu regions after garnet formation, potentially leading to isochron rotation and anomalously old Lu-Hf dates; and 3) differences in closure temperatures of the two isotope systems. We will review several examples of divergent Lu
Results of the 2000 Creek Plantation Swamp Survey
International Nuclear Information System (INIS)
Fledderman, P.D.
2000-01-01
This report is a survey of the Creek Plantation located along the Savannah River and borders the southeast portion of the Savannah River Site. The land is primarily undeveloped and agricultural; its purpose is to engage in equestrian-related operations. A portion of Creek Plantation along the Savannah River is a low-lying swamp, known as the Savannah River Swamp, which is uninhabited and not easily accessible
13 CFR 113.410 - Comparable facilities.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...
Crystal growth of Sm0.3Tb0.7FeO3 and spin reorientation transition in Sm1−xTbxFeO3 orthoferrite
International Nuclear Information System (INIS)
Wu, Anhua; Wang, Bo; Zhao, Xiangyang; Xie, Tao; Man, Peiwen; Su, Liangbi; Kalashnikova, A.M.; Pisarev, R.V.
2017-01-01
In this work, Sm 0.3 Tb 0.7 FeO 3 single crystal was successfully grown by optical floating zone method. Sm 0.3 Tb 0.7 FeO 3 samples with a-, b-, and c-orientation were manufactured by means of Laue photograph. Magnetic properties of Sm 0.3 Tb 0.7 FeO 3 single crystals are studied over a wide temperature range from 2 to 400 K. Spin reorientation transition from Γ 2 to Γ 4 are observed by means of the temperature dependence of magnetization It indicated the reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals is lowered with the contents of Tb contents rising based on this work and our previous works, thus the spin reorientation transition temperature can be adjusted through changing the compound in orthoferrites materials, which means that we can get orthoferrites single crystals with high magnetism property in various temperature through material design. - Highlights: • Sm 0.3 Tb 0.7 FeO 3 single crystals with various compounds were successfully grown by optical floating zone method. • The relation between SRT temperature and composition in Sm 1−x Tb x FeO 3 orthoferrite was indicated. • The spin reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals can be adjusted through changing the compound in orthoferrites materials.
The Patroon Creek Contamination Migration Investigation
International Nuclear Information System (INIS)
Dufek, K.; Zafran, A.; Moore, J.T.
2006-01-01
Shaw performed a Site Investigation (SI) for sediment within the Unnamed Tributary of the Patroon Creek, a section of the Patroon Creek, and the Three Mile Reservoir as part of the overall contract with the United States Army Corps of Engineers (USACE) to remediate the Colonie Formerly Utilized Sites Remedial Action Program (FUSRAP) Site. The Unnamed Tributary formerly flowed through the former Patroon Lake, which was located on the main site property and was used as a landfill for radiological and chemical wastes. The objective of the investigation was to determine the absence/presence of radioactive contamination within the three Areas of Concern (AOC). In order to accomplish this objective, Shaw assembled a team to produce a Technical Memorandum that provided an in-depth understanding of the environmental conditions related to the Patroon Creek. Upon completion and analysis of the Technical Memorandum, a Conceptual Site Model (CSM) was constructed and a Technical Planning Program (TPP) was held to develop a Sediment Investigation Work Plan and Sediment Investigation Sampling and Analysis Plan. A total of 32 sample locations were analyzed using on-site direct gamma scans with a Pancake Geiger-Mueller (PGM) instrument for screening purposes and samples were analyzed at on-site and off-site laboratories. The highest interval from each core scan was selected for on-site analysis utilizing a High Purity Germanium (HPGe) detector. Eight of these samples were sent off-site for gamma/alpha spectroscopy confirmation. The data collected during the SI indicated that the U-238 cleanup criterion was exceeded in sediment samples collected from two locations within the Unnamed Tributary but not in downstream sections of Patroon Creek or Three Mile Reservoir. Future actions for impacted sediment in the Unnamed Tributary will be further evaluated. Concentrations of U-238 and Th-232 in all other off-site sediment samples collected from the Unnamed Tributary, Patroon Creek, and
Diel variation in fish assemblages in tidal creeks in southern Brazil
Directory of Open Access Journals (Sweden)
JF. Oliveira-Neto
Full Text Available Tidal creeks are strongly influenced by tides and are therefore exposed to large differences in salinity and depth daily. Here we compare fish assemblages in tidal creeks between day and night in two tidal creeks in southern Brazil. Monthly day and night, simultaneous collections were carried out in both creeks using fyke nets. Clupeiformes tended to be caught more during the day. Cathorops spixii, Genidens genidens and Rypticus randalli tended to be caught at night. Sciaenidae also tended to be caught more during the night. In general, pelagic species were diurnal, while deep water species were nocturnal. These trends are probably due to a variety of causes, such as phylogeny, predation and net avoidance.
Channel stability of Turkey Creek, Nebraska
Rus, David L.; Soenksen, Philip J.
1998-01-01
Channelization on Turkey Creek and its receiving stream, the South Fork Big Nemaha River, has disturbed the equilibrium of Turkey Creek and has led to channel-stability problems, such as degradation and channel widening, which pose a threat to bridges and land adjacent to the stream. As part of a multiagency study, the U.S. Geological Survey assessed channel stability at two bridge sites on upper and middle portions of Turkey Creek by analyzing streambed-elevation data for gradation changes, comparing recent cross-section surveys and historic accounts, identifying bank-failure blocks, and analyzing tree-ring samples. These results were compared to gradation data and trend results for a U.S. Geological Survey streamflow-gaging station near the mouth of Turkey Creek from a previous study. Examination of data on streambed elevations reveals that degradation has occurred. The streambed elevation declined 0.5 m at the upper site from 1967-97. The streambed elevation declined by 3.2 m at the middle site from 1948-97 and exposed 2 m of the pilings of the Nebraska Highway 8 bridge. Channel widening could not be verified at the two sites from 1967-97, but a historic account indicates widening at the middle site to be two to three times that of the 1949 channel width. Small bank failures were evident at the upper site and a 4-m-wide bank failure occurred at the middle site in 1987 according to tree ring analyses. Examination of streambed-elevation data from a previous study at the lower site reveals a statistically significant aggrading trend from 1958-93. Further examination of these data suggests minor degradation occurred until 1975, followed by aggradation.
21 CFR 113.81 - Product preparation.
2010-04-01
...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...
The Wells Creek Meteorite Impact Site and Changing Views on Impact Cratering
Ford, J. R. H.; Orchiston, Wayne; Clendening, Ron
2012-11-01
Wells Creek is a confirmed meteorite impact site in Tennessee, USA. The Wells Creek structure was first noticed by railroad surveyors around 1855 and brought to the attention of J.M. Safford, Tennessee's State Geologist. He included an insert in the 1869 Geologic Map of Tennessee, which is the first known map to include the structure. The origin of the Wells Creek structure was controversial, and was interpreted as being either the result of volcanic steam explosion or meteorite impact. It was only in the 1960s that Wilson and Stearns were able to state that the impact hypothesis was preferred. Evidence for a Wells Creek meteorite impact includes drill core results, extreme brecciation and shatter cones, while a local lack of volcanic material is telling. Just to the north of the Wells Creek Basin are three small basins that Wilson concluded were associated with the Wells Creek impact event, but evidence regarding the origin of the Austin, Indian Mound and Cave Spring Hollow sites is not conclusive.
49 CFR 230.113 - Wheels and tire defects.
2010-10-01
... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...
Ockerman, Darwin J.; Fernandez, Carlos J.
2010-01-01
-year study period averaged 2.62 pounds per acre per year from the West Oso Creek subwatershed and 0.839 pound per acre per year from the Oso Creek tributary subwatershed. Total phosphorus yields from the West Oso Creek and Oso Creek tributary subwatersheds for the 3-year period were 0.644 and 0.419 pound per acre per year, respectively. Runoff yields of nitrogen and phosphorus were relatively small compared to inputs of nitrogen in fertilizer and rainfall deposition. Average annual runoff yield of total nitrogen (subwatersheds combined) represents about 2.5 percent of nitrogen applied as fertilizer to cropland in the watershed and nitrogen entering the subwatersheds through rainfall deposition. Average annual runoff yield of total phosphorus (subwatersheds combined) represents about 4.0 percent of the phosphorus in applied fertilizer and rainfall deposition. Suspended-sediment yields from the West Oso Creek subwatershed were more than twice those from the Oso Creek tributary subwatershed. The average suspended-sediment yield from the West Oso Creek subwatershed was 522 pounds per acre per year and from the Oso Creek tributary subwatershed was 139 pounds per acre per year. Twenty-four herbicides and eight insecticides were detected in runoff samples collected at the two subwatershed outlets. At the West Oso Creek site, 19 herbicides and 4 insecticides were detected; at the Oso Creek tributary site, 18 herbicides and 6 insecticides were detected. Fourteen pesticides were detected in only one sample at low concentrations (near the laboratory reporting level). Atrazine and atrazine degradation byproduct 2-chloro-4-isopropylamino-6-amino-s-triazine (CIAT) were detected in all samples. Glyphosate and glyphosate byproduct aminomethylphosphonic acid (AMPA) were detected in all samples collected and analyzed during water years 2006-07 but were not included in analysis for samples collected in water year 2008. Of all pesticides detected in runoff, the highest runoff yields w
Fulton, John W.; Risser, Dennis W.; Regan, R. Steve; Walker, John F.; Hunt, Randall J.; Niswonger, Richard G.; Hoffman, Scott A.; Markstrom, Steven
2015-08-17
This report describes the results of a study by the U.S. Geological Survey in cooperation with ClearWater Conservancy and the Pennsylvania Department of Environmental Protection to develop a hydrologic model to simulate a water budget and identify areas of greater than average recharge for the Spring Creek Basin in central Pennsylvania. The model was developed to help policy makers, natural resource managers, and the public better understand and manage the water resources in the region. The Groundwater and Surface-water FLOW model (GSFLOW), which is an integration of the Precipitation-Runoff Modeling System (PRMS) and the Modular Groundwater Flow Model (MODFLOW-NWT), was used to simulate surface water and groundwater in the Spring Creek Basin for water years 2000–06. Because the groundwater and surface-water divides for the Spring Creek Basin do not coincide, the study area includes the Nittany Creek Basin and headwaters of the Spruce Creek Basin. The hydrologic model was developed by the use of a stepwise process: (1) develop and calibrate a PRMS model and steady-state MODFLOW-NWT model; (2) re-calibrate the steady-state MODFLOW-NWT model using potential recharge estimates simulated from the PRMS model, and (3) integrate the PRMS and MODFLOW-NWT models into GSFLOW. The individually calibrated PRMS and MODFLOW-NWT models were used as a starting point for the calibration of the fully coupled GSFLOW model. The GSFLOW model calibration was done by comparing observations and corresponding simulated values of streamflow from 11 streamgages and groundwater levels from 16 wells. The cumulative water budget and individual water budgets for water years 2000–06 were simulated by using GSFLOW. The largest source and sink terms are represented by precipitation and evapotranspiration, respectively. For the period simulated, a net surplus in the water budget was computed where inflows exceeded outflows by about 1.7 billion cubic feet (0.47 inches per year over the basin area
Low temperature features of the local structure of Sm1-xYxS
International Nuclear Information System (INIS)
Menushenkov, A. P.; Chernikov, R. V.; Sidorov, V. V.; Klementiev, K. V.; Alekseev, P. A.; Rybina, A. V.
2007-01-01
The particular features of the local electronic and local crystal structures of the mixed-valence compound Sm 1-x Y x S are studied by the XAFS spectroscopy methods in the temperature range 20-300 K for the yttrium concentration x = 0.17, 0.25, 0.33, and 0.45. The temperature behavior of the valence of Sm, as well as of the lengths and the Debye-Waller factors of the bonds Sm-S, Sm-Sm(Y), Y-S, and Y-Sm(Y), has been determined. The violation of the Vegard law has been observed. A model for the estimation of the energy width of the 4f level and of its position with respect to the Fermi level is proposed
Jones, Chance E; Maddox, Anthony; Hurley, Dorset; Barkovskii, Andrei L
2018-05-19
Intertidal creeks form the primary hydrologic link between estuaries and land-based activities on barrier islands. Fecal indicators Enterococcus spp. (Entero1), pathogens Shigella spp. (ipaH), Salmonella spp. (invA), E. coli of EHEC/EPEC groups (eaeA), E. coli of EAEC, EIEC, and UPEC groups (set1B), E. coli of STEC group (stx1); and tetracycline resistance genes (tet(B), tet(C), tet(D), tet(E), tet(K), tet(Q), tet(W), and tet(X); TRG) were detected in the headwater of Oakdale Creek (Sapelo Island, GA) receiving runoffs from Hog Hammock village. Excavation of drainage ditches around the village caused a high increase in the incidence of the above determinants. Water samples were collected from the headwater, transferred to diffusion chambers, submersed in the headwater, saltmarsh, and mouth of the creek; and the determinants were monitored for 3 winter months. With some exceptions, their persistence decreased in order headwater > saltmarsh > mouth. Genes associated with Enterococcus spp. were the most persistent at all the sites, following in the headwater with determinants for Salmonella spp. and E. coli of EAEC, EIEC, and UPEC groups. In the mouth, the most persistent gene was eaeA indicating EHEC, EPEC, and STEC. Tet(B) and tet(C) persisted the longest in headwater and saltmarsh. No TRG persisted after 11 days in the mouth. Most determinants revealed correlations with temperature and pH, and inverse correlations with dissolved oxygen. Decay rates of the above determinants varied in the range of -0.02 to -0.81/day, and were up to 40 folds higher in the saltmarsh and mouth than in the headwater. Our data demonstrated that water parameters could to some extent predict a general trend in the fate of virulence and antibiotic resistance determinants in tidal creek tributaries but strongly suggested that their persistence in these tributaries cannot be predicted from that of enterococci, or extrapolated from one biological contaminant to another. Copyright
Conceptual Design Plan SM-43 Replacement Project
Energy Technology Data Exchange (ETDEWEB)
University of California, Los Alamos National Laboratory, SCC Project Office
2000-11-01
The Los Alamos National Laboratory Conceptual Design Plan for the SM-43 Replacement Project outlines plans for replacing the SM-43 Administration Building. Topics include the reasons that replacement is considered a necessity; the roles of the various project sponsors; and descriptions of the proposed site and facilities. Also covered in this proposal is preliminary information on the project schedule, cost estimates, acquisition strategy, risk assessment, NEPA strategy, safety strategy, and safeguards and security. Spreadsheets provide further detail on space requirements, project schedules, and cost estimates.
Energy Technology Data Exchange (ETDEWEB)
Xiao, P. [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Zhang, J.J., E-mail: zhangjj@dlpu.edu.cn [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Shen, L.F. [Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Wang, Z.Q. [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Pun, E.Y.B. [Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Lin, H., E-mail: lhai8686@yahoo.com [School of Textile and Material Engineering, Dalian Polytechnic University, Dalian 116034 (China); Department of Electronic Engineering and State Key Laboratory of Millimeter Waves, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)
2016-10-15
Sm{sup 3+} doped multicomponent antimony phosphate (MSP) luminescent glasses were prepared and tunable white fluorescence has been investigated. Broad visible emission depending on excitation wavelength is validated to be dominated by discrepant Sb{sup 3+} emitting centers. Group of narrow emissions from Sm{sup 3+} is beneficial to adding yellow and red components in Sm{sup 3+} doped MSP glasses, which is strengthened by effective energy transfer from Sb{sup 3+} to Sm{sup 3+}. Excitation wavelength selection and Sm{sup 3+} concentration adjustment are two feasible routes to optimize luminescence color in Sm{sup 3+} doped MSP glasses and the color tunability of fluorescence indicates that amorphous Sm{sup 3+} doped MSP glass phosphors possess potential for ideal white light devices.
Energy Technology Data Exchange (ETDEWEB)
Ruiz, Mariano M.; Mietta, Jose L.; Soledad Antonel, P. [Instituto de Quimica Fisica de Materiales, Ambiente y Energia (INQUIMAE), Departamento de Quimica Inorganica, Analitica y Quimica Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Perez, Oscar E. [Departamento de Industrias, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Martin Negri, R. [Instituto de Quimica Fisica de Materiales, Ambiente y Energia (INQUIMAE), Departamento de Quimica Inorganica, Analitica y Quimica Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Jorge, Guillermo, E-mail: gjorge@df.uba.ar [Instituto de Fisica de Buenos Aires, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Av. Cantilo s/n (1428), Buenos Aires (Argentina); Instituto de Ciencias, Universidad Nacional de General Sarmiento, J.M. Gutierrez 1150 (1613), Los Polvorines, Buenos Aires (Argentina)
2013-02-15
We have synthesized magnetic Fe{sub 2-x}CoSm{sub x}O{sub 4} nanoparticles (NPs) by means of the coprecipitation method, varying Sm content from x=0 to x=0.5. Energy-dispersive X-ray spectroscopy showed agreement between the metal proportion of the obtained nanoparticles and the stoichiometric mixture of cations used for the synthesis. Part of the particles were heated at 800 Degree-Sign C, and both were characterized by X-ray diffraction, scanning electron microscope imaging and magnetization measurements. Physical and magnetic properties were analyzed as a function of Sm content, before and after the heating treatment. A phase segregation is found for the calcined nanoparticles with large Sm content. The magnetic remanence, saturation and coercive field were investigated as a function of Sm content for both heated and unheated (as-prepared) particles. Polydimethylsiloxane-NPs magnetoelastomers were prepared and cured under an external uniform magnetic field, obtaining structured anisotropic composites, in which inorganic needles (columnar micrometric structures) oriented in the direction of the magnetic field are formed. Young modulus and remanent magnetic moment were measured and magnetization time relaxation experiments were performed in the directions parallel and perpendicular to the needles in order to determine the magnetic and elastic anisotropy of the composites. The elastic modulus measured parallel to the needles resulted almost twice in magnitude with respect to the perpendicular modulus. The measured magnetic anisotropy of the composites is probably due to the enhanced interparticle interaction within a needle and the freezing of an preferred easy axis distribution among the particles at the curing process. - Highlights: Black-Right-Pointing-Pointer We study magnetic and physical properties of Sm-substituted Fe{sub 2}CoO{sub 4} nanoparticles. Black-Right-Pointing-Pointer Magnetic nanoparticles were synthesized by the coprecipitation method. Black
Energy Technology Data Exchange (ETDEWEB)
Chadwick, J.
2005-09-01
The paper examines the development of one of the largest coking coal deposits in the world. Hail Creek is 100 km west of Mackay and 35 km northeast of Nebo, Queensland and has proven opencut reserves of 195.6 as at December 2003. Coal processing stated in July 2003. The award winning project included construction of a coal handling and preparation plant, a railway, a village and offsite infrastructure and mine buildings and site services. Coal is mined by conventional dragline and truck/shovel techniques. 1 photo.
International Nuclear Information System (INIS)
Zheng, Chuanjiang; Yu, Dunbo; Li, Kuoshe; Luo, Yang; Jin, Jinling; Lu, Shuo; Li, Hongwei; Mao, Yongjun; Quan, Ningtao
2016-01-01
Melt spun ribbons of a series of SmFe 12 B x (x=0.0, 0.5, 0.75, 1.0, 1.25, and 1.5) have been prepared by the melt spinning technique. Sm–Fe–B melt spun ribbons with single phase TbCu 7 -type structure were prepared from the SmFe 12 B x (x=0.5, 0.75, and 1.0) alloys at the surface velocity around 40 m/s. The addition of boron not only inhibits the appearance of soft magnetic phase α-Fe, but also enhances the ability of amorphous formation for melt spun Sm–Fe ribbons. The concentration of boron atoms, however, exceeds the limit of the solubility (x>1.0) of Sm–Fe alloys, which does not impede the appearance of α-Fe but accelerates the formation of metastable phase Sm 2 Fe 23 B 3 that is unfavorable to their magnetic properties. Moreover, it is found that the addition of boron whose concentration is 0.0≤x≤0.75 can stabilize the metastable TbCu 7 -type structure because of the increase of the lattice parameter ratio c/a. The magnetic properties of as-annealed SmFe 12 B 1.0 melt spun ribbons with an energy product of 2.19MGOe, a coercivity of 2.36 kOe and a remanence of 4.8 kGs have been achieved. The microstructural characteristics of as-annealed melt spun SmFe 12 and SmFe 12 B 1.0 ribbons have been discussed as well. The following sequence of the hyperfine field H(6l)
The effect of Sm-doping on optical properties of LaB6 nanoparticles
International Nuclear Information System (INIS)
Chao, Luomeng; Bao, Lihong; Shi, Junjie; Wei, Wei; Tegus, O.; Zhang, Zhidong
2015-01-01
Highlights: • Nanoparticles of Sm-doped LaB 6 have been prepared by solid state reaction. • All samples exhibit high absorbance in NIR range and UV range. • The increase of Sm-doping amount shifts the position of minimum absorptance value. • The optical properties of Sm-doped LaB 6 were interpreted by DFT theory. - Abstract: Nanocrystalline particles of LaB 6 , SmB 6 and Sm-doped LaB 6 have been prepared by a solid-state reaction in order to investigate the optical properties of ternary rare-earth hexaborides. The sizes of prepared nanoparticles range from dozens to more than 200 nm, as confirmed by XRD, SEM and TEM examinations. The optical property concerning the absorption spectra was tested with ultraviolet-visible-near infrared (UV-vis-NIR) absorption spectrum. All samples exhibit high absorbance in NIR range and UV range. The increase of Sm-doping amount shifts the position of minimum absorptance value of LaB 6 to the long-wave direction. Density functional theory (DFT) is employed to interpret the optical properties of Sm-doped LaB 6 , and results indicate that Sm 4f states change the DOS at near Fermi surface of LaB 6 after Sm doping and the reduced number of conduction electrons results into the change of absorption spectra
Electrospinning fabrication and luminescent properties of SrMoO4:Sm3+ nanofibers
International Nuclear Information System (INIS)
Du Pingfan; Song Lixin; Xiong Jie; Cao Houbao; Xi Zhenqiang; Guo Shaoyi; Wang Naiyan; Chen Jianjun
2012-01-01
Highlights: ► SrMoO 4 :Sm 3+ fluorescent nanofibers were fabricated by electrospinning. ► The properties of the SrMoO 4 :Sm 3+ nanofibers were investigated. ► The obtained nanofibers exhibit a fine orange-red fluorescent property. ► The PL intensity of the nanofibers is superior to the nanoparticles counterpart. ► The optimum doping concentration of Sm 3+ in the host lattice is 2 at.%. - Abstract: Samarium ions doped strontium molybdate (SrMoO 4 :Sm 3+ ) nanofibers (NFs) were fabricated by a simple electrospinning process. The obtained SrMoO 4 :Sm 3+ NFs are composed of scheelite-type tetragonal SrMoO 4 phase, and the NFs have an average diameter of ca. 90 nm. Under 275 nm ultraviolet (UV) excitation, the NFs show an orange-red fluorescent property symbolized by a characteristic emission (606 nm) resulting from the 4 G 5/2 → 6 H 7/2 energy level transition of Sm 3+ . And the photoluminescence (PL) emissi on intensity of the SrMoO 4 :Sm 3+ NFs is superior to that of the nanoparticles (NPs) counterpart under the same doping concentrations. The effect of Sm 3+ concentrations on the 4 G 5/2 → 6 H 7/2 emission intensity was also investigated. The result reveals that the concentration quenching will occur when the Sm 3+ content exceeds 2 at.%. In other words, the SrMoO 4 :Sm 3+ NFs have an optimal luminescent performance under such a doping concentration.
Pine Creek Ranch, FY 2001 annual report; ANNUAL
International Nuclear Information System (INIS)
Berry, Mark E.
2001-01-01
Pine Creek Ranch was purchased in 1999 by the Confederated Tribes of Warm Springs using Bonneville Power Administration Fish and Wildlife Habitat Mitigation funds. The 25,000 acre property will be managed in perpetuity for the benefit of fish and wildlife habitat. Major issues include: (1) Restoring quality spawning and rearing habitat for stealhead. Streams are incised and fish passage barriers exist from culverts and possibly beaver dams. In addition to stealhead habitat, the Tribes are interested in overall riparian recovery in the John Day River system for wildlife habitat, watershed values and other values such as recreation. (2) Future grazing for specific management purposes. Past grazing practices undoubtedly contributed to current unacceptable conditions. The main stem of Pine Creek has already been enrolled in the CREP program administered by the USDA, Natural Resource Conservation Service in part because of the cost-share for vegetation restoration in a buffer portion of old fields and in part because of rental fees that will help the Tribes to pay the property taxes. Grazing is not allowed in the riparian buffer for the term of the contract. (3) Noxious weeds are a major concern. (4) Encroachment by western juniper throughout the watershed is a potential concern for the hydrology of the creek. Mark Berry, Habitat Manager, for the Pine Creek Ranch requested the Team to address the following objectives: (1) Introduce some of the field staff and others to Proper Functioning Condition (PFC) assessments and concepts. (2) Do a PFC assessment on approximately 10 miles of Pine Creek. (3) Offer management recommendations. (4) Provide guidelines for monitoring
Directory of Open Access Journals (Sweden)
Wenzhi Cao
2018-04-01
Full Text Available Tanshinones, one group of bioactive diterpenes, were widely used in the treatment of cardiovascular diseases. WRKYs play important roles in plant metabolism, but their regulation mechanism in Salvia miltiorrhiza remains elusive. In this study, one WRKY transcription factor SmWRKY1 was isolated and functionally characterized from S. miltiorrhiza. Multiple sequence alignment and phylogenetic tree analysis showed SmWRKY1 shared high homology with other plant WRKYs such as CrWRKY1. SmWRKY1 was found predominantly expressed in leaves and stems, and was responsive to salicylic acid (SA, methyl jasmonate (MeJA, and nitric oxide (NO treatment. Subcellular localization analysis found that SmWRKY1 was localized in the nucleus. Over-expression of SmWRKY1 significantly elevated the transcripts of genes coding for enzymes in the MEP pathway especially 1-deoxy-D-xylulose-5-phosphate synthase (SmDXS and 1-deoxy-D-xylulose-5-phosphate reductoisomerase (SmDXR, resulted in over fivefold increase in tanshinones production in transgenic lines (up to 13.7 mg/g DW compared with the control lines. A dual-luciferase (Dual-LUC assay showed that SmWRKY1 can positively regulate SmDXR expression by binding to its promoter. Our work revealed that SmWRKY1 participated in the regulation of tanshinones biosynthesis and acted as a positive regulator through activating SmDXR in the MEP pathway, thus provided a new insight to further explore the regulation mechanism of tanshinones biosynthesis.
Investigation of the oxidative processes in intermetallic Sm Co5 powder during heat treatment
International Nuclear Information System (INIS)
Talijan, Nadezda M.; Milutinovic-Nikolic, Aleksandra; Stajic-Trosic, Jasna T.; Jovanovic, Zarko D.
1996-01-01
Understanding of the thermal stability of intermetallic Sm Co 5 powder is essential for designing the working atmosphere in all phases of the technological procedure in the production of sintered Sm Co 5 magnets to obtain maximal magnetic properties. The thermal stability of the Sm Co 5 powder with defined chemical composition and particle size was investigated in the interval from 20 to 900 deg C. Commercial Sm Co 5 powder was used in this experiment. The powder was milled in anhydrous toluene in an agate mortar to fine powder of quality used in the production of sintered magnets. All the experiments were carried out with powder of an average particle size of 7.23μm, established by SEM. THe thermal stability of the Sm Co 5 powder in static air atmosphere was investigated by thermogravimetric analysis (TGA) using a DuPont Thermal Analyzer. Investigation of the behaviour of Sm Co 5 powder during heating was carried out using new samples of Sm Co 5 powder for each of the investigated temperature cycles. It was found by TGA that up to 200 deg C, the oxidation of Sm Co 5 was negligible. X-ray diffraction of the thermogravimetric experimental residue of the Sm Co 5 powder, heated at 240 deg C, yielded only the presence of the Sm Co 5 phase. By X-ray diffraction different crystal forms were identified depending on the maximal heating temperature. The following phases were identified: Sm 2 O 3 , Co, Co O, Co 3 O 4 and Sm Co O 3 . According to TG and X-ray results, for each of the investigated temperatures, the corresponding chemical reactions were established. The experimental data from both the thermal and X-ray investigations confirm that the phases of pressing and aligning the Sm Co 5 powder, in the process of producing sintered Sm Co 5 magnets, may be performed without a protective atmosphere. (author)
The biodistribution and kinetics of the 153Sm labelled avidin, streptavidin and biotin
International Nuclear Information System (INIS)
Li Guiping; Zhu Chengmo; Jiang Xufeng; Feng Guowei; Zhang Shengguo
1999-01-01
Due to the high affinity of biotin to Av or SA. The authors labelled a biotin derivative (DTPA-biotin) with 153 Sm and then bound this 153 Sm labelled DTPA-biotin to Av or SA. The in vivo kinetics and biodistribution of 153 Sm labelled Av, SA and DTPA-biotin were studied in the rat and mice. The results demonstrated that 153 Sm-Av cleared from the blood rapidly with high liver and renal uptake; 153 Sm-SA cleared from blood slowly with high retention in liver, spleen and kidney, whereas 153 Sm metabolize more fast, and excreted mainly through the kidney. Thereby, the biodistribution difference of SA and Av mentioned above provided an experimental basis for the selection of different components of A-V system in pre-targeting radio-immuno imaging and radioimmunotherapy
Noble Gases in the Lunar Meteorites Calcalong Creek and QUE 93069
Swindle, T. D.; Burkland, M. K.; Grier, J. A.
1995-09-01
Although the world's collections contain comparable numbers of martian and lunar meteorites (about 10 each), their ejection histories seem to be quite different [1]. We have sampled no more than four martian craters, but almost every one of the lunar meteorites apparently represents a separate cratering event. Furthermore, most lunar meteorites were apparently ejected from the top meter of the surface, unlike any of the martian meteorites. We have measured noble gases in two bulk samples of the lunar meteorite QUE93069 and three of Calcalong Creek, ranging in size from 7 to 15 mg. Averaged results are given in Table 1. Both meteorites contain solar-wind-implanted noble gas. QUE 93069, which is a mature anorthositic regolith breccia [2], contains amounts comparable to the most gas-rich lunar meteorites. The relatively low 40Ar/36Ar ratios of both meteorites suggest surface exposures no more than 2.5 Ga ago [3]. Calcalong Creek has readily observable spallogenic gas. The 131Xe/126Xe ratio of 4.8+/-0.3 corresponds to an average shielding depth of slightly more than 40 gm/cm^2 [4]. In common with many lunar breccias, Calcalong Creek has been exposed to cosmic rays for several hundred Ma (calculations based on [4] and [5]). The 3He apparent exposure age is much shorter, suggesting diffusive loss of He. To determine the detailed exposure history, it is necessary to have measurements of cosmogenic radionuclides. Our samples were too small to measure 81Kr, but [6] have measured 10Be, 26Al and 36Cl. Their data are consistent with either extended exposure at data, requiring several hundred Ma of exposure at an average depth of 40-50 gm/cm^2, are clearly more consistent with the first scenario. The only other lunar meteorite which could have been ejected at the same time is MAC 88104/5 [1], but the chemical differences between the two make it highly unlikely that they come from the same event. It is difficult to determine the amount of spallogenic gas in QUE 93069 because of
47 CFR 25.113 - Station licenses and launch authority.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...
International Nuclear Information System (INIS)
Berenbrock, C.; Kjelstrom, L.C.
1997-01-01
Delineation of areas at the Idaho National Engineering and Environmental Laboratory that would be inundated by a 100-year peak flow in Birch Creek is needed by the US Department of Energy to fulfill flood-plain regulatory requirements. Birch Creek flows southward about 40 miles through an alluvium-filled valley onto the northern part of the Idaho National Engineering and Environmental laboratory site on the eastern Snake River Plain. The lower 10-mile reach of Birch Creek that ends in Birch Creek Playa near several Idaho National Engineering and Environmental Laboratory facilities is of particular concern. Twenty-six channel cross sections were surveyed to develop and apply a hydraulic model to simulate water-surface elevations for a hypothetical 100-year peak flow in Birch Creek. Model simulation of the 100-year peak flow (700 cubic feet per second) in reaches upstream from State Highway 22 indicated that flow was confined within channels even when all flow was routed to one channel. Where the highway crosses Birch Creek, about 315 cubic feet per second of water was estimated to move downstream--115 cubic feet per second through a culvert and 200 cubic feet per second over the highway. Simulated water-surface elevation at this crossing was 0.8 foot higher than the elevation of the highway. The remaining 385 cubic feet per second flowed southwestward in a trench along the north side of the highway. Flow also was simulated with the culvert removed. The exact location of flood boundaries on Birch Creek could not be determined because of the highly braided channel and the many anthropogenic features (such as the trench, highway, and diversion channels) in the study area that affect flood hydraulics and flow. Because flood boundaries could not be located exactly, only a generalized flood-prone map was developed
The microwave absorbing properties of SmCo attached single wall carbon nanotube/epoxy composites
International Nuclear Information System (INIS)
Yu, Liming; Li, Bo; Sheng, Leimei; An, Kang; Zhao, Xinluo
2013-01-01
Highlights: •The SmCo nanoparticles attached SWCNTs were prepared by dc arc discharge method. •The nano-composite prepared by a rare earth permanent magnet Sm 2 Co 17 as catalyst. •The SmCo attached SWCNT/epoxy composites have an excellent electromagnetic matching characteristics. •The reflection loss and bandwidth below −20 dB of the composite can reach −23.7 dB, 6.2 GHz, respectively. -- Abstract: The SmCo nanoparticles attached single wall carbon nanotubes (SmCo attached SWCNTs) were prepared by hydrogen dc arc discharge method using 2:17 type SmCo permanent powder as catalyst. The SmCo attached SWCNT/epoxy composites with different doping ratios were investigated in the frequency region of 2–18 GHz. The complex permittivity and permeability of the SmCo attached SWCNT/epoxy composites were calculated. The reflection loss properties were simulated by transmission line theory and the microwave absorptive mechanisms were discussed. The results indicate that, due to the better interfacial polarization absorption mechanism of SmCo attached SWCNTs and the electromagnetic (EM) matching of magnetic loss and dielectric loss, the microwave absorption properties of SmCo attached SWCNT/epoxy are evidently improved. When the SmCo attached SWCNTs is doped by 1 wt%, the composite display a larger and wider absorption peak, and the bandwidth of the reflection loss below −20 dB is larger than 6 GHz with the thickness of 3.3 mm. It is expected that the new SmCo attached SWCNT/epoxy composites will be a good microwave absorbing material for the applications in X band, Ku band, or even K band
Sm 3+-doped polymer optical waveguide amplifiers
Huang, Lihui; Tsang, Kwokchu; Pun, Edwin Yue-Bun; Xu, Shiqing
2010-04-01
Trivalent samarium ion (Sm 3+) doped SU8 polymer materials were synthesized and characterized. Intense red emission at 645 nm was observed under UV laser light excitation. Spectroscopic investigations show that the doped materials are suitable for realizing planar optical waveguide amplifiers. About 100 μm wide multimode Sm 3+-doped SU8 channel waveguides were fabricated using a simple UV exposure process. At 250 mW, 351 nm UV pump power, a signal enhancement of ˜7.4 dB at 645 nm was obtained for a 15 mm long channel waveguide.
Frey, Stefan; Reschka, Eva J; Pöggeler, Stefanie
2015-01-01
The striatin-interacting phosphatase and kinase (STRIPAK) complex is composed of striatin, protein phosphatase PP2A and protein kinases that regulate development in animals and fungi. In the filamentous ascomycete Sordaria macrospora, it is required for fruiting-body development and cell fusion. Here, we report on the presence and function of STRIPAK-associated kinases in ascomycetes. Using the mammalian germinal center kinases (GCKs) MST4, STK24, STK25 and MINK1 as query, we identified the two putative homologs SmKIN3 and SmKIN24 in S. macrospora. A BLASTP search revealed that both kinases are conserved among filamentous ascomycetes. The physical interaction of the striatin homolog PRO11 with SmKIN3 and SmKIN24 were verified by yeast two-hybrid (Y2H) interaction studies and for SmKIN3 by co-Immunoprecipitation (co-IP). In vivo localization found that both kinases were present at the septa and deletion of both Smkin3 and Smkin24 led to abnormal septum distribution. While deletion of Smkin3 caused larger distances between adjacent septa and increased aerial hyphae, deletion of Smkin24 led to closer spacing of septa and to sterility. Although phenotypically distinct, both kinases appear to function independently because the double-knockout strain ΔSmkin3/ΔSmkin24 displayed the combined phenotypes of each single-deletion strain.
Directory of Open Access Journals (Sweden)
Stefan Frey
Full Text Available The striatin-interacting phosphatase and kinase (STRIPAK complex is composed of striatin, protein phosphatase PP2A and protein kinases that regulate development in animals and fungi. In the filamentous ascomycete Sordaria macrospora, it is required for fruiting-body development and cell fusion. Here, we report on the presence and function of STRIPAK-associated kinases in ascomycetes. Using the mammalian germinal center kinases (GCKs MST4, STK24, STK25 and MINK1 as query, we identified the two putative homologs SmKIN3 and SmKIN24 in S. macrospora. A BLASTP search revealed that both kinases are conserved among filamentous ascomycetes. The physical interaction of the striatin homolog PRO11 with SmKIN3 and SmKIN24 were verified by yeast two-hybrid (Y2H interaction studies and for SmKIN3 by co-Immunoprecipitation (co-IP. In vivo localization found that both kinases were present at the septa and deletion of both Smkin3 and Smkin24 led to abnormal septum distribution. While deletion of Smkin3 caused larger distances between adjacent septa and increased aerial hyphae, deletion of Smkin24 led to closer spacing of septa and to sterility. Although phenotypically distinct, both kinases appear to function independently because the double-knockout strain ΔSmkin3/ΔSmkin24 displayed the combined phenotypes of each single-deletion strain.
McClymonds, N.E.
1984-01-01
The Corral Creek area of the Hanging Woman Creek coal field, 9 miles east of the Decker coal mines near the Tongue River, contains large reserves of Federal coal that have been identified for potential lease sale. A hydrologic study was conducted in the area to describe existing hydrologic systems and to study assess potential impacts of surface coal mining on local water resources. Hydrogeologic data collected indicate that aquifers are coal and sandstone beds within the Tongue River Member of the Fort Union Formation (Paleocene age) and sand and gravel in valley alluvium (Pleistocene and Holocene age). Surface-water resources are limited to a few spring-fed stock ponds in the higher parts of the area and the intermittent flow of Corral Creek near the mouth. Most of the stock ponds in the area become dry by midsummer. Mining of the Anderson coal bed would remove three stock wells and would lower the potentiometric surface within the coal and sandstone aquifers. The alluvial aquifer beneath Corral Creek and South Fork would be removed. Although mining would alter the existing hydrologic systems and remove several shallow wells, alternative ground-water supplies are available that could be developed to replace those lost by mining. (USGS)
NPDES Permit for Soap Creek Associates Wastewater Treatment Facility in Montana
Under National Pollutant Discharge Elimination System permit number MT-0023183, Soap Creek Associates, Inc. is authorized to discharge from its wastewater treatment facility located in West, Bighorn County, Montana, to Soap Creek.
9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.
2010-01-01
..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...
9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.
2010-01-01
... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...
9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.
2010-01-01
... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...
Coilin phosphorylation mediates interaction with SMN and SmB′
Toyota, Cory G.; Davis, Misty D.; Cosman, Angela M.; Hebert, Michael D.
2010-01-01
Cajal bodies (CBs) are subnuclear domains that participate in spliceosomal small nuclear ribonucleoprotein (snRNP) biogenesis and play a part in the assembly of the spliceosomal complex. The CB marker protein, coilin, interacts with survival of motor neuron (SMN) and Sm proteins. Several coilin phosphoresidues have been identified by mass spectrometric analysis. Phosphorylation of coilin affects its self-interaction and localization in the nucleus. We hypothesize that coilin phosphorylation also impacts its binding to SMN and Sm proteins. In vitro binding studies with a C-terminal fragment of coilin and corresponding phosphomimics show that SMN binds preferentially to dephosphorylated analogs and that SmB′ binds preferentially to phosphomimetic constructs. Bacterially expressed full-length coilin binds more SMN and SmB′ than does the C-terminal fragment. Co-immunoprecipitation and phosphatase experiments show that SMN also binds dephosphorylated coilin in vivo. These data show that phosphorylation of coilin influences interaction with its target proteins and, thus, may be significant in managing the flow of snRNPs through the CB. PMID:19997741
Coilin phosphorylation mediates interaction with SMN and SmB'.
Toyota, Cory G; Davis, Misty D; Cosman, Angela M; Hebert, Michael D
2010-04-01
Cajal bodies (CBs) are subnuclear domains that participate in spliceosomal small nuclear ribonucleoprotein (snRNP) biogenesis and play a part in the assembly of the spliceosomal complex. The CB marker protein, coilin, interacts with survival of motor neuron (SMN) and Sm proteins. Several coilin phosphoresidues have been identified by mass spectrometric analysis. Phosphorylation of coilin affects its self-interaction and localization in the nucleus. We hypothesize that coilin phosphorylation also impacts its binding to SMN and Sm proteins. In vitro binding studies with a C-terminal fragment of coilin and corresponding phosphomimics show that SMN binds preferentially to dephosphorylated analogs and that SmB' binds preferentially to phosphomimetic constructs. Bacterially expressed full-length coilin binds more SMN and SmB' than does the C-terminal fragment. Co-immunoprecipitation and phosphatase experiments show that SMN also binds dephosphorylated coilin in vivo. These data show that phosphorylation of coilin influences interaction with its target proteins and, thus, may be significant in managing the flow of snRNPs through the CB.
Dilatometric and dielectric behaviour of Sm modified PCT ceramics
International Nuclear Information System (INIS)
Singh, Sarabjit; Thakur, O.P.; Prakash, Chandra; Raina, K.K.
2005-01-01
Samarium modified PCT ceramics with composition (Pb 0.76-x Sm x Ca 0.24 )(Ti 0.98 Mn 0.02 )O 3 ; x=0-0.08 in steps of 0.02 were prepared by conventional mixed-oxide method. Detailed dilatometric studies were carried out for green specimens in order to study sintering behaviour. Change in the dilatometric behaviour is correlated with the XRD results of powders calcined at different temperatures. Dielectric constant was observed to increase with increasing Sm concentration, which has been attributed to reduced tetragonality and better densification on Sm substitution. SEM micrographs have revealed the grain size of the samples. Ferroelectric hysteresis behaviour was studied for all the compositions
Angle-resolved photoemission investigation of SmB{sub 6}
Energy Technology Data Exchange (ETDEWEB)
Hlawenka, Peter; Rader, Oliver; Siemensmeyer, Konrad; Weschke, Eugen; Varykhalov, Andrei; Rienks, Emile [Helmholtz-Zentrum Berlin (Germany); Shitsevalova, Natalya [Institute for Problems of Material Science, Kiev (Ukraine); Gabani, Slavomir; Flachbart, Karol [IEP, Slovak Academy of Science, Kosice (Slovakia)
2015-07-01
Recently the mixed valence compound SmB{sub 6} has drawn great attention. Theoretically predicted surface states, which should result from a hybridisation of localised f-bands with conduction electrons and a band inversion, would make SmB{sub 6} the first realisation of a so called topological Kondo insulator. Conductivity and transport measurements, as well as spin-resolved photoemission spectroscopy seem to fortify the scenario of a topological nature of the conductive surface. We investigate the surface electronic structure of SmB{sub 6} by means of high resolution angle-resolved photoemission spectroscopy measurements below 1 K. We will present new insights into the surface states that determine the low temperature conductivity of this material.
International Nuclear Information System (INIS)
Sun, Wei; Zhu, Minggang; Guo, Zhaohui; Fang, Yikun; Li, Wei
2015-01-01
Precipitation-hardened 2:17-type SmCo permanent magnet has attracted much attention due to its high Curie temperature and excellent magnetic properties. Sm(Co_b_a_lFe_0_._2_4_5Cu_0_._0_7Zr_0_._0_2)_7_._8 (at%) sintered magnets with high remanence (B_r ~1.15 T) were prepared using a traditional powder metallurgy method. The intrinsic coercivity H_c_j of the magnets was increased from 429 to 994 kA m"−"1 with isothermal annealing time increasing from 10 to 40 h, which is different from the phenomenon that increasing aging time leads to a reduced coercivity mentioned in the Ref. [16]. In consideration of rarely report about the microstructure of the final magnet isothermally annealed for 40 h, we have tried to originally analyze the relationship between the microstructure and the magnetic properties. Besides, the lattice constants of sintered Sm(Co_b_a_lFe_0_._2_4_5Cu_0_._0_7Zr_0_._0_2)_7_._8 permanent magnet isothermally annealed for 40 h have been given by indexing the HRTEM results including the selected area electron diffraction (SAED) and HRTEM images.
75 FR 57766 - Ryckman Creek Resources, LLC; Notice of Petition
2010-09-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP10-498-000] Ryckman Creek Resources, LLC; Notice of Petition September 15, 2010. Take notice that on September 3, 2010, Ryckman Creek..., a petition for an Exemption of Temporary Acts and Operations and Request for Expedited Approval...
78 FR 76750 - Drawbridge Operation Regulation; Chambers Creek, Steilacoom, WA
2013-12-19
... operating schedule that governs the Burlington Northern Santa Fe (BNSF) Chambers Creek Railway Bridge across... performing lift bridge maintenance and upgrades for the BNSF Chambers Creek Railway Bridge across Chambers... maintenance and upgrade items to this vertical lift bridge in support of Positive Train Control requirements...
14 CFR 13.113 - Noncompliance with the investigative process.
2010-01-01
... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...
9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.
2010-01-01
... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...
Labelling of MoAb with 153SmH1ETA: Preliminary results
International Nuclear Information System (INIS)
Ferro-Flores, G.; De, F.; Ramirez, M.; Pedraza-Lopez, M.; Tendilla, J.I.; Melendez-Alafort, L.; Murphy, C.A.
2001-01-01
A method to label MoAb with Sm-153 using 1,5,9,13-tetraazacyclohexadecane N,N',N'',N''' tetraacetic acid (H 4 ETA) as a bifunctional chelator was developed. H 4 ETA and SmH 1 ETA were synthesized in our laboratory and characterized by IR spectroscopy, TGA (thermogravimetric analysis), SEM (Scattering Electronic Microscopy), EDAX (Elemental Dispersion Analysis by X-rays) and EPR (Electron Paramagnetic Resonance) at 6 K. The 153 SmH 1 ETAMoAb was prepared by a simple incubation of the MoAb ior cea1, and the 153 SmH 1 ETA complex at neutral pH and at room temperature for 24 h. The specific activity of the labelled antibody was 111 MBq/mg (3 mCi/mg). Sm-153(III) is commercially available with specific activities up to 318.2 GBq/mg. Therefore, under the conditions described above 153 SmH 1 ETA labelled MoAb could be obtained with specific activity up to 1.14 GBq/mg (30.7 mCi/mg). (author)
Musser, Jonathan W.
2015-08-20
Digital flood-inundation maps for a 12.4-mile reach of Big Creek that extends from 260 feet above the McGinnis Ferry Road bridge to the U.S. Geological Survey (USGS) streamgage at Big Creek below Hog Wallow Creek at Roswell, Georgia (02335757), were developed by the USGS in cooperation with the cities of Alpharetta and Roswell, Georgia. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage at Big Creek near Alpharetta, Georgia (02335700). Real-time stage information from this USGS streamgage may be obtained at http://waterdata.usgs.gov/ and can be used in conjunction with these maps to estimate near real-time areas of inundation. The National Weather Service (NWS) is incorporating results from this study into the Advanced Hydrologic Prediction Service (AHPS) flood-warning system http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs for many streams where the USGS operates streamgages and provides flow data. The forecasted peak-stage information for the USGS streamgage at Big Creek near Alpharetta (02335700), available through the AHPS Web site, may be used in conjunction with the maps developed for this study to show predicted areas of flood inundation.
Geophysical Characterization of the Hilton Creek Fault System
Lacy, A. K.; Macy, K. P.; De Cristofaro, J. L.; Polet, J.
2016-12-01
The Long Valley Caldera straddles the eastern edge of the Sierra Nevada Batholith and the western edge of the Basin and Range Province, and represents one of the largest caldera complexes on Earth. The caldera is intersected by numerous fault systems, including the Hartley Springs Fault System, the Round Valley Fault System, the Long Valley Ring Fault System, and the Hilton Creek Fault System, which is our main region of interest. The Hilton Creek Fault System appears as a single NW-striking fault, dipping to the NE, from Davis Lake in the south to the southern rim of the Long Valley Caldera. Inside the caldera, it splays into numerous parallel faults that extend toward the resurgent dome. Seismicity in the area increased significantly in May 1980, following a series of large earthquakes in the vicinity of the caldera and a subsequent large earthquake swarm which has been suggested to be the result of magma migration. A large portion of the earthquake swarms in the Long Valley Caldera occurs on or around the Hilton Creek Fault splays. We are conducting an interdisciplinary geophysical study of the Hilton Creek Fault System from just south of the onset of splay faulting, to its extension into the dome of the caldera. Our investigation includes ground-based magnetic field measurements, high-resolution total station elevation profiles, Structure-From-Motion derived topography and an analysis of earthquake focal mechanisms and statistics. Preliminary analysis of topographic profiles, of approximately 1 km in length, reveals the presence of at least three distinct fault splays within the caldera with vertical offsets of 0.5 to 1.0 meters. More detailed topographic mapping is expected to highlight smaller structures. We are also generating maps of the variation in b-value along different portions of the Hilton Creek system to determine whether we can detect any transition to more swarm-like behavior towards the North. We will show maps of magnetic anomalies, topography
9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...
CREEK Project's Oyster Biomass Database for Eight Creeks in the North Inlet Estuary, South Carolina
Baruch Institute for Marine and Coastal Sciences, Univ of South Carolina — A group of eight tidal creeks dominated by oysters, Crassostrea virginica, in North Inlet Estuary, South Carolina, USA were studied using a replicated BACI (Before -...
Symmetries for SM Alignment in multi-Higgs Doublet Models
Pilaftsis, Apostolos
2016-01-01
We derive the complete set of maximal symmetries for Standard Model (SM) alignment that may occur in the tree-level scalar potential of multi-Higgs Doublet Models, with $n > 2$ Higgs doublets. Our results generalize the symmetries of SM alignment, without decoupling of large mass scales or fine-tuning, previously obtained in the context of two-Higgs Doublet Models.
The SMAP Level 4 Surface and Root-zone Soil Moisture (L4_SM) Product
Reichle, Rolf; Crow, Wade; Koster, Randal; Kimball, John
2010-01-01
The Soil Moisture Active and Passive (SMAP) mission is being developed by NASA for launch in 2013 as one of four first-tier missions recommended by the U.S. National Research Council Committee on Earth Science and Applications from Space in 2007. The primary science objectives of SMAP are to enhance understanding of land surface controls on the water, energy and carbon cycles, and to determine their linkages. Moreover, the high resolution soil moisture mapping provided by SMAP has practical applications in weather and seasonal climate prediction, agriculture, human health, drought and flood decision support. In this paper we describe the assimilation of SMAP observations for the generation of the planned SMAP Level 4 Surface and Root-zone Soil Moisture (L4_SM) product. The SMAP mission makes simultaneous active (radar) and passive (radiometer) measurements in the 1.26-1.43 GHz range (L-band) from a sun-synchronous low-earth orbit. Measurements will be obtained across a 1000 km wide swath using conical scanning at a constant incidence angle (40 deg). The radar resolution varies from 1-3 km over the outer 70% of the swath to about 30 km near the center of the swath. The radiometer resolution is 40 km across the entire swath. The radiometer measurements will allow high-accuracy but coarse resolution (40 km) measurements. The radar measurements will add significantly higher resolution information. The radar is however very sensitive to surface roughness and vegetation structure. The combination of the two measurements allows optimal blending of the advantages of each instrument. SMAP directly observes only surface soil moisture (in the top 5 cm of the soil column). Several of the key applications targeted by SMAP, however, require knowledge of root zone soil moisture (approximately top 1 m of the soil column), which is not directly measured by SMAP. The foremost objective of the SMAP L4_SM product is to fill this gap and provide estimates of root zone soil moisture
The constitution of alloys in the Al-rich corner of the Al-Si-Sm ternary system
International Nuclear Information System (INIS)
Markoli, B.; Spaic, S.; Zupanic, F.
2001-01-01
The constitution of alloys and the liquidus surface in the Al-rich corner of the Al-Si-Sm ternary system were determined by the examination of controlled heated and cooled specimens, as well as heat-treated specimens by means of optical and scanning electron microscopy, energy-dispersive X-ray spectroscopy, differential thermal analysis and X-ray diffraction. The Al-rich corner of the Al-Si-Sm ternary system comprises five regions of primary crystallisation (α Al , β Si , Al 3 Sm, Al 2 Si 2 Sm and AlSiSm) with following characteristic invariant reaction sequences: ternary eutectic reaction L → α Al + β Si + Al 2 Si 2 Sm, and two liquidus transition reactions, i. e., L + Al 3 Sm → α Al + AlSiSm, and L + AlSiSm → α Al + Al 2 Si 2 Sm. Along with the position of ternary eutectic and both interstitial points in the Al-rich corner of the Al-Si-Sm ternary system, the temperatures for each reaction were determined. (orig.)
2010-04-02
... DEPARTMENT OF AGRICULTURE Forest Service Beaver Creek Landscape Management Project, Ashland Ranger... manner that increases resiliency of the Beaver Creek Landscape Management Project area ecosystem to... requirements to require. The Beaver Creek Landscape Management Project includes treatments previously proposed...
Energy Technology Data Exchange (ETDEWEB)
Hu, Zijun; Chen, Da, E-mail: dchen_80@hotmail.com; Wang, Sen; Zhang, Ning; Qin, Laishun, E-mail: qinlaishun@cjlu.edu.cn; Huang, Yuexiang
2017-06-15
Highlights: • Effective Sm doping into BiFeO{sub 3} nanoparticles was obtained by a facile sol-gel route. • Band gap of Sm-doped BiFeO{sub 3} nanoparticles was regulated by the dopant concentration. • Sm-doped BiFeO{sub 3} nanoparticles exhibited superior photocatalytic activities. • The possible photocatalytic mechanism of Sm-doped BiFeO{sub 3} nanospheres was discussed. - Abstract: In this work, the effect of Sm doping on the structural and photocatalytic properties of BiFeO{sub 3} (BFO) was investigated. A series of Sm doped BFO nanoparticles containing different Sm dopant contents (Bi{sub (1−x)}Sm{sub x}FeO{sub 3}, x = 0.00, 0.01, 0.03, 0.05, 0.07, 0.10) were synthesized via a simple sol-gel route. It was revealed that Sm{sup 3+} ions were successfully doped into BFO nanoparticles, and the band gap value was gradually decreased when increasing Sm dopant concentration. The photocatalytic activity of Sm-doped BFO photocatalyst was significantly affected by the Sm doping content. Compared to pure BFO, the Sm-doped BFO samples exhibited much higher photocatalytic activity. The improved photocatalytic activity of Sm-doped BFO could be attributed to the enhanced visible light absorption and the efficient separation of photogenerated electrons and holes derived from Sm dopant trapping level in the Sm-doped BFO samples. In addition, the possible photocatalytic mechanism of Sm-doped BFO photocatalyst was also proposed.
9 CFR 113.122 - Salmonella Choleraesuis Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...
9 CFR 113.120 - Salmonella Typhimurium Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...
37 CFR 11.3 - Suspension of rules.
2010-07-01
... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...
Lifetime measurements of the excited states in {sup 145} Sm
Energy Technology Data Exchange (ETDEWEB)
El-Badry, A M; Abdel Samie, Sh; Ahmad, A A [Depatment of Physics, Faculty of Science, ElMinia University, ElMinia, (Egypt); Kuroyanagi, T; Odahara, A; Gono, Y; Morinobu, S [Tandem Accelerator Laboratory, Department of Physics, Kyushu University, (Japan)
1997-12-31
Lifetime of the excited levels in {sup 145} Sm has been measured through the {sup 139} La ({sup 10} B, 4 n){sup 145} Sm nuclear reaction. The optimal beam energy of 49 MeV was determined from the measurements of the excitation function and Cascade program. With the possibility of studying lifetime of this nucleus a conventional plunger system have been designed and constructed at kyushu University tandem accelerator laboratory. A La target of 0.22 mg/cm{sup 2} thickness which was evaporated onto a Au foil of 2 mg/cm{sup 2} thickness was used. Since the recoil velocity was estimated to be 1.76 mm/ns (beta 0.00585), the measurable time range resulted in the range from 5 Ps to 5 ns. The single spectra measurements were performed at the 20 plunger positions in the range from 10 {mu} to 10 mm. Analyses of the data were carried using hypermet and/or GF2 program to obtain the lifetimes. A new list of lifetimes for 12 excited states up to 3.922 MeV excitations for {sup 145} Sm were determined for the first time. Decay curves of the these transitions are discussed. The new lifetimes of excited states in {sup 145} Sm enabled us to understand the electromagnetic properties. The deduced transition probabilities were established and compared with that of N = 83 isotones and the closed shell nucleus {sup 144} Sm. In addition, a nuclear structure of {sup 145} Sm have been discussed and proposed in framework of the shell model. 4 figs., 1 tab.
SM*A*S*H (Standard Model*Axion*Seesaw*Higgs portal inflation)
International Nuclear Information System (INIS)
Ringwald, Andreas
2016-10-01
We present a minimal model for particle physics and cosmology. The Standard Model (SM) particle content is extended by three right-handed SM-singlet neutrinos N_i and a vector-like quark Q, all of them being charged under a global lepton number and Peccei-Quinn (PQ) U(1) symmetry which is spontaneously broken by the vacuum expectation value υ_σ∝10"1"1 GeV of a SM-singlet complex scalar field σ. Five fundamental problems - neutrino oscillations, baryogenesis, dark matter, inflation, strong CP problem - are solved at one stroke in this model, dubbed ''SM*A*S*H'' (Standard Model*Axion*Seesaw*Higgs portal inflation). It can be probed decisively by upcoming cosmic microwave background and axion dark matter experiments.
Energy Technology Data Exchange (ETDEWEB)
Zheng, Chuanjiang; Yu, Dunbo, E-mail: yudb2008@126.com; Li, Kuoshe; Luo, Yang; Jin, Jinling; Lu, Shuo; Li, Hongwei; Mao, Yongjun; Quan, Ningtao
2016-08-15
Melt spun ribbons of a series of SmFe{sub 12}B{sub x} (x=0.0, 0.5, 0.75, 1.0, 1.25, and 1.5) have been prepared by the melt spinning technique. Sm–Fe–B melt spun ribbons with single phase TbCu{sub 7}-type structure were prepared from the SmFe{sub 12}B{sub x} (x=0.5, 0.75, and 1.0) alloys at the surface velocity around 40 m/s. The addition of boron not only inhibits the appearance of soft magnetic phase α-Fe, but also enhances the ability of amorphous formation for melt spun Sm–Fe ribbons. The concentration of boron atoms, however, exceeds the limit of the solubility (x>1.0) of Sm–Fe alloys, which does not impede the appearance of α-Fe but accelerates the formation of metastable phase Sm{sub 2}Fe{sub 23}B{sub 3} that is unfavorable to their magnetic properties. Moreover, it is found that the addition of boron whose concentration is 0.0≤x≤0.75 can stabilize the metastable TbCu{sub 7}-type structure because of the increase of the lattice parameter ratio c/a. The magnetic properties of as-annealed SmFe{sub 12}B{sub 1.0} melt spun ribbons with an energy product of 2.19MGOe, a coercivity of 2.36 kOe and a remanence of 4.8 kGs have been achieved. The microstructural characteristics of as-annealed melt spun SmFe{sub 12} and SmFe{sub 12}B{sub 1.0} ribbons have been discussed as well. The following sequence of the hyperfine field H(6l)
2011-03-11
... DEPARTMENT OF AGRICULTURE Forest Service Beaver Creek Landscape Management Project, Ashland Ranger... Impact Statement for the Beaver Creek Landscape Management Project was published in the Federal Register... Responsible Official for the Beaver Creek Landscape Management Project. DATES: The Final Environmental Impact...
Pandey, Tribhuwan; Du, Mao-Hua; Parker, David S.
2018-03-01
Designing a permanent magnet with reduced critical rare-earth content is of paramount importance in the development of cost-effective modern technologies. By performing comprehensive first-principles calculations, we investigate the potential avenues for reducing the critical rare-earth content in Sm2Fe17N3 and Sm2Fe17C3 by making a La or Ce substitution for Sm. The calculated magnetic properties of base compounds are in good agreement with the previous low-temperature (4.2-K) experimental measurements, and they show a large axial anisotropy. Although La or Ce substitution results in a slight reduction of magnetic anisotropy, the magnetic moments of Fe atoms mostly remain unchanged. Specifically, large axial anisotropies of 7.2 and 4.1 MJ /m3 are obtained for SmCeFe17 N3 and SmLaFe17 N3 , respectively. These values of anisotropies are comparable to the state-of-the-art permanent magnet Nd2 Fe14 B . The foremost limitation of Sm2 Fe17X3 magnets for practical application is the formation nitrogen or carbon vacancies at high temperatures. By calculating the N- (C)- vacancy formation energy, we show that La or Ce substitution enhances the vacancy formation energy. This enhanced vacancy formation energy will likely improve the thermodynamic stability of these alloys at high temperatures. Therefore, La- or Ce-substituted Sm2Fe17C3 and Sm2Fe17N3 compounds are promising candidates for high-performance permanent magnets with substantially reduced rare-earth content.
Ship Creek bioassessment investigations
Energy Technology Data Exchange (ETDEWEB)
Cushing, C.E.; Mueller, R.P.; Murphy, M.T.
1995-06-01
Pacific Northwest Laboratory (PNL) was asked by Elmendorf Air Force Base (EAFB) personnel to conduct a series of collections of macroinvertebrates and sediments from Ship Creek to (1) establish baseline data on these populations for reference in evaluating possible impacts from Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) activities at two operable units, (2) compare current population indices with those found by previous investigations in Ship Creek, and (3) determine baseline levels of concentrations of any contaminants in the sediments associated with the macroinvertebrates. A specific suite of indices established by the US Environmental Protection Agency (EPA) was requested for the macroinvertebrate analyses; these follow the Rapid Bioassessment Protocol developed by Plafkin et al. (1989) and will be described. Sediment sample analyses included a Microtox bioassay and chemical analysis for contaminants of concern. These analyses included, volatile organic compounds, total gasoline and diesel hydrocarbons (EPA method 8015, CA modified), total organic carbon, and an inductive-coupled plasma/mass spectrometry (ICP/MS) metals scan. Appendix A reports on the sediment analyses. The Work Plan is attached as Appendix B.
Adcock, Karina E.; Reeves, Claire E.; Gooch, Lauren J.; Leedham Elvidge, Emma C.; Ashfold, Matthew J.; Brenninkmeijer, Carl A. M.; Chou, Charles; Fraser, Paul J.; Langenfelds, Ray L.; Hanif, Norfazrin Mohd; O'Doherty, Simon; Oram, David E.; Ou-Yang, Chang-Feng; Moi Phang, Siew; Abu Samah, Azizan; Röckmann, Thomas; Sturges, William T.; Laube, Johannes C.
2018-04-01
Atmospheric measurements of the ozone-depleting substance CFC-113a (CCl3CF3) are reported from ground-based stations in Australia, Taiwan, Malaysia and the United Kingdom, together with aircraft-based data for the upper troposphere and lower stratosphere. Building on previous work, we find that, since the gas first appeared in the atmosphere in the 1960s, global CFC-113a mixing ratios have been increasing monotonically to the present day. Mixing ratios of CFC-113a have increased by 40 % from 0.50 to 0.70 ppt in the Southern Hemisphere between the end of the previously published record in December 2012 and February 2017. We derive updated global emissions of 1.7 Gg yr-1 on average between 2012 and 2016 using a two-dimensional model. We compare the long-term trends and emissions of CFC-113a to those of its structural isomer, CFC-113 (CClF2CCl2F), which still has much higher mixing ratios than CFC-113a, despite its mixing ratios and emissions decreasing since the 1990s. The continued presence of northern hemispheric emissions of CFC-113a is confirmed by our measurements of a persistent interhemispheric gradient in its mixing ratios, with higher mixing ratios in the Northern Hemisphere. The sources of CFC-113a are still unclear, but we present evidence that indicates large emissions in East Asia, most likely due to its use as a chemical involved in the production of hydrofluorocarbons. Our aircraft data confirm the interhemispheric gradient as well as showing mixing ratios consistent with ground-based observations and the relatively long atmospheric lifetime of CFC-113a. CFC-113a is the only known CFC for which abundances are still increasing substantially in the atmosphere.
National Research Council Canada - National Science Library
Copeland, Ronald
2000-01-01
.... An existing concrete-lined flood control channel on Corte Madera Creek in Marin County, California lacks a debris basin at its upstream terminus and carries significant bed load through a supercritical flow reach...
Anticipated transport of Cs-137 from Steel Creek following L-Area restart
International Nuclear Information System (INIS)
Hayes, D.W.
1982-01-01
Heat exchanger cooling water, spent fuel storage basin effluents, and process water from P and L-Reactor Areas were discharged to Steel Creek beginning in 1954. Cs-137 was the most significant radionuclide discharged to the environs. Once the Cs-137 was discharged from P and L-Area reactors to Steel Creek, it became associated with silt and clay in the Steel Creek system. After its association with the silt and clay, the Cs-137 becomes part of the sediment transport process and undergoes continual deposition-resuspension in the stream system. This report discusses the expected fate and transport of Cs-137 currently present in the Steel Creek system after L-Reactor restart
Energy Technology Data Exchange (ETDEWEB)
Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)
1969-03-15
In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.
9 CFR 113.317 - Parvovirus Vaccine (Canine).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...
Impact of urbanization on flood of Shigu creek in Dongguan city
Pan, Luying; Chen, Yangbo; Zhang, Tao
2018-06-01
Shigu creek is a highly urbanized small watershed in Dongguan City. Due to rapid urbanization, quick flood response has been observed, which posted great threat to the flood security of Dongguan City. To evaluate the impact of urbanization on the flood changes of Shigu creek is very important for the flood mitigation of Shigu creek, which will provide insight for flood planners and managers for if to build a larger flood mitigation system. In this paper, the Land cover/use changes of Shigu creek from 1987-2015 induced by urbanization was first extracted from a local database, then, the Liuxihe model, a physically based distributed hydrological model, is employed to simulate the flood processes impacted by urbanization. Precipitation of 3 storms was used for flood processes simulation. The results show that the runoff coefficient and peak flow have increased sharply.
Propagation of Nd magnetic phases in Nd/Sm(001) superlattices
International Nuclear Information System (INIS)
Soriano, S; Dufour, C; Dumesnil, K; Stunault, A
2006-01-01
The propagation of Nd long range magnetic order in the hexagonal and cubic sublattices has been investigated in double hexagonal compact Nd/Sm(001) superlattices by resonant x-ray magnetic scattering at the Nd L 2 absorption edge. For a superlattice with 3.7 nm thick Sm layers, the magnetic structure of the hexagonal sublattice propagates coherently through several bilayers, whereas the order in the cubic sublattice remains confined to single Nd blocks. For a superlattice with 1.4 nm thick Sm layers, the magnetic structures of both sublattices appear to propagate coherently through the superlattice. This is the first observation (i) of the long range coherent propagation of Nd order on the cubic sites between Nd blocks and (ii) of a different thickness dependence of the propagation of the Nd magnetic phases associated with the hexagonal and cubic sublattices. The propagation of the Nd magnetic order through Sm is interpreted in terms of generalized susceptibility of the Nd conduction electrons
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
Energy Technology Data Exchange (ETDEWEB)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-09-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available.
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
International Nuclear Information System (INIS)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-01-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Vahedi, Shahrzad; Okada, Go; Morrell, Brian; Muzar, Edward; Koughia, Cyril; Kasap, Safa [Department of Electrical and Computer Engineering, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5A9 (Canada); Edgar, Andy; Varoy, Chris [School of Chemical and Physical Sciences and MacDiarmid Institute, Victoria University of Wellington, Kelburn Parade (New Zealand); Belev, George; Wysokinski, Tomasz [Canadian Light Source, Inc., University of Saskatchewan, Saskatoon, Saskatchewan S7N 0X4 (Canada); Chapman, Dean [Department of Anatomy and Cell Biology, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5E5 (Canada)
2012-10-01
Fluorophosphate and fluoroaluminate glasses doped with trivalent samarium were evaluated as sensors of x-ray radiation for microbeam radiation therapy at the Canadian Light Source using the conversion of trivalent Sm{sup 3+} to the divalent form Sm{sup 2+}. Both types of glasses show similar conversion rates and may be used as a linear sensor up to {approx}150 Gy and as a nonlinear sensor up to {approx}2400 Gy, where saturation is reached. Experiments with a multi-slit collimator show high spatial resolution of the conversion pattern; the pattern was acquired by a confocal fluorescence microscopy technique. The effects of previous x-ray exposure may be erased by annealing at temperatures exceeding the glass transition temperature T{sub g} while annealing at T{sub A} < T{sub g} enhances the Sm conversion. This enhancement is explained by a thermally stimulated relaxation of host glass ionic matrix surrounding x-ray induced Sm{sup 2+} ions. In addition, some of the Sm{sup 3+}-doped glasses were codoped with Eu{sup 2+}-ions but the results show that there is no marked improvement in the conversion efficiency by the introduction of Eu{sup 2+}.
The constitution of alloys in the Al-rich corner of the Al-Si-Sm ternary system
Energy Technology Data Exchange (ETDEWEB)
Markoli, B.; Spaic, S. [Ljubljana Univ. (Slovenia). Faculty of Natural Science and Engineering; Zupanic, F. [Maribor Univ. (Slovenia). Faculty of Mechanical Engineering
2001-09-01
The constitution of alloys and the liquidus surface in the Al-rich corner of the Al-Si-Sm ternary system were determined by the examination of controlled heated and cooled specimens, as well as heat-treated specimens by means of optical and scanning electron microscopy, energy-dispersive X-ray spectroscopy, differential thermal analysis and X-ray diffraction. The Al-rich corner of the Al-Si-Sm ternary system comprises five regions of primary crystallisation ({alpha}{sub Al}, {beta}{sub Si}, Al{sub 3}Sm, Al{sub 2}Si{sub 2}Sm and AlSiSm) with following characteristic invariant reaction sequences: ternary eutectic reaction L {yields} {alpha}{sub Al} + {beta}{sub Si} + Al{sub 2}Si{sub 2}Sm, and two liquidus transition reactions, i. e., L + Al{sub 3}Sm {yields} {alpha}{sub Al} + AlSiSm, and L + AlSiSm {yields} {alpha}{sub Al} + Al{sub 2}Si{sub 2}Sm. Along with the position of ternary eutectic and both interstitial points in the Al-rich corner of the Al-Si-Sm ternary system, the temperatures for each reaction were determined. (orig.)
Langenheim, Victoria; Jachens, Robert C.; Clynne, Michael A.; Muffler, L. J. Patrick
2016-01-01
Interpretation of magnetic and new gravity data provides constraints on the geometry of the Hat Creek Fault, the amount of right-lateral offset in the area between Mt. Shasta and Lassen Peak, and confirmation of the influence of pre-existing structure on Quaternary faulting. Neogene volcanic rocks coincide with short-wavelength magnetic anomalies of both normal and reversed polarity, whereas a markedly smoother magnetic field occurs over the Klamath Mountains and its Paleogene cover. Although the magnetic field over the Neogene volcanic rocks is complex, the Hat Creek Fault, which is one of the most prominent normal faults in the region and forms the eastern margin of the Hat Creek Valley, is marked by the eastern edge of a north-trending magnetic and gravity high 20-30 km long. Modeling of these anomalies indicates that the fault is a steeply dipping (~75-85°) structure. The spatial relationship of the fault as modeled by the potential-field data, the youngest strand of the fault, and relocated seismicity suggests that deformation continues to step westward across the valley, consistent with a component of right-lateral slip in an extensional environment. Filtered aeromagnetic data highlight a concealed magnetic body of Mesozoic or older age north of Hat Creek Valley. The body’s northwest margin strikes northeast and is linear over a distance of ~40 km. Within the resolution of the aeromagnetic data (1-2 km), we discern no right-lateral offset of this body. Furthermore, Quaternary faults change strike or appear to end, as if to avoid this concealed magnetic body and to pass along its southeast edge, suggesting that pre-existing crustal structure influenced younger faulting, as previously proposed based on gravity data.
In vivo efficacy of SM-8668 (Sch 39304), a new oral triazole antifungal agent.
Tanio, T; Ichise, K; Nakajima, T; Okuda, T
1990-06-01
SM-8668 (Sch 39304) is a new oral antifungal agent which we evaluated in comparison with fluconazole in various fungal infection models. The prophylactic effect of SM-8668 was excellent against systemic candidiasis, aspergillosis, and cryptococcosis in mice. The 50% effective dose for SM-8668 was assessed at 10 days after infection and was 0.18, 3.7, and 5.9 mg/kg (body weight), respectively, for the above-mentioned fungal diseases. Fluconazole was about four times less effective than SM-8668 against systemic candidiasis and was only slightly effective at doses of 80 and 25 mg/kg against systemic aspergilosis and cryptococcosis, respectively. SM-8668 was also about four to eight times more active than fluconazole against vaginal candidiasis in rats and against dermatophytic infection in guinea pigs. In addition, topical SM-8668 was as effective as topical miconazole or tioconazole against skin mycosis in guinea pigs. After oral administration, SM-8668 showed a maximum concentration in serum similar to that of fluconazole in both mice and rats, but the elimination half-life and area under the serum concentration-time curve for SM-8668 were twice those for fluconazole.
Combustion synthesis of micron-sized Sm2Co17 particles via mechanochemical processing
International Nuclear Information System (INIS)
Liu, W.; McCormick, P.G.
1998-01-01
Full text: The spontaneous formation of Sm 2 Co 17 micron-sized particles via a mechanically induced combustion reaction has been investigated. Sm 2 Co 17 alloy particles of 0.1--2 μm in size embedded in a CaO matrix formed directly via a combustion reaction induced by milling the powder mixture of Sm 2 O 3 , CoO, CaO and Ca over a critical time. The micron-sized Sm 2 Co 17 particles were found to have the TbCu 7 -type structure and characterized by a coercivity value of 7.8 kOe while embedded in the CaO matrix. The effect of subsequent heat treatment on the structure and magnetic properties of as-milled samples was also investigated. Removal of the CaO by a carefully controlled washing process yielded micron-sized Sm 2 Co 17 particles without significant oxidation of the particles. These fine Sm 2 Co 17 particles can be used to produce anisotropic bulk or bonded magnets
9 CFR 113.315 - Feline Rhinotracheitis Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...
9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...
19 CFR 113.33 - Corporations as principals.
2010-04-01
... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
9 CFR 113.101 - Leptospira Pomona Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.103 - Leptospira Canicola Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.105 - Leptospira Hardjo Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.65 - Brucella Abortus Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
49 CFR 199.113 - Employee assistance program.
2010-10-01
... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...
Evaluation of the consequences of thermal isolation on biota of upper Steel Creek
International Nuclear Information System (INIS)
Gladden, J.B.
1984-04-01
The objective of this report is to summarize and evaluate existing data concerning the upper reaches of Steel Creek on the Savannah River Plant (SRP) near Aiken, South Carolina. This report addresses the current ecological status of this stream section and the need and/or desirability of maintaining an ambient water temperature zone of passage with lower Steel Creek or the nearby Meyers Branch, an undisturbed watershed that is a major tributary to Steel Creek. The specific case evaluated involves the construction of an 800 to 1000 acre cooling reservoir on Steel Creek upstream of the confluence of Steel Creek and Meyers Branch. Water temperatures exiting this reservoir are assumed to never exceed 90 0 F. Studies were conducted in connection with the proposed restart of the L-Reactor at SRP. 8 references, 3 figures, 2 tables
78 FR 2990 - Bear Creek Storage Company, L.L.C.; Notice of Request Under Blanket Authorization
2013-01-15
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP13-34-000] Bear Creek..., 2012, Bear Creek Storage Company, L.L.C. (Bear Creek), 569 Brookwood Village, Suite 749, Birmingham....208, 157.213 and 157.216 of the Commission's Regulations under the Natural Gas Act, and Bear Creek's...
A Study on Liver Scan using 113mIn Colloid
International Nuclear Information System (INIS)
Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi
1969-01-01
There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.
Concentrations of /sup 113m/Cd in the marine environment
Energy Technology Data Exchange (ETDEWEB)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-09-18
Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.
Tritium at the Steel Creek Landing
International Nuclear Information System (INIS)
Arnett, M.; Heffner, J.D.; Fledderman, P.D.; Littrell, J.W.; Hayes, D.W.; Dodgen, M.S.
1998-01-01
In December 1997 and January 1998, the South Carolina Department of Health and Environmental Control (SCDHEC) collected routine weekly grab samples from the Savannah River near the Steel Creek Boat Landing
9 CFR 113.329 - Newcastle Disease Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...
9 CFR 113.106 - Clostridium Chauvoei Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...
9 CFR 113.107 - Clostridium Haemolyticum Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...
9 CFR 113.306 - Canine Distemper Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...
9 CFR 113.302 - Distemper Vaccine-Mink.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...
Phytoplankton characteristics in a polluted Bombay Harbour-Thana-Bassein creek estuarine complex
Digital Repository Service at National Institute of Oceanography (India)
Ramaiah, Neelam; Ramaiah, N.; Nair, V.R.
Annual variations in phytoplankton characteristics were studied from Bombay Harbour-Thana creek-Bassein creek (BHTCBC) estuarine confluence to assess the levels of pigment concentration, productivity and, qualitative and qunatitative nature...
Structural and magnetic properties of SmCo-based magnetic films grown by electron-beam evaporation
Energy Technology Data Exchange (ETDEWEB)
Saravanan, P., E-mail: psdrdo@gmail.com [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Vinod, V.T.P.; Černík, Miroslav [Institute for Nanomaterials, Advanced Technologies and Innovation, Department of Natural Sciences, Technical University of Liberec, Studentská 1402/2, Liberec 1, 461 17 (Czech Republic); Vishnuraj, R.; Arout Chelvane, J.; Kamat, S.V. [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Hsu, Jen-Hwa, E-mail: jhhsu@phys.ntu.edu.tw [Department of Physics, National Taiwan University, Taipei 106, Taiwan (China)
2015-07-01
Sub-micron thick Sm–Co films (200 and 300 nm) with selective phase composition are grown on Si (100) substrates by electron-beam evaporation using Sm-lean alloy targets such as Sm{sub 4}Co{sub 96} and Sm{sub 8}Co{sub 92}. The structural and magnetic properties of Sm–Co films are characterized by x-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM) and super-conducting quantum interference device (SQUID) magnetometer. The Sm–Co films obtained with the Sm{sub 4}Co{sub 96} target exhibit Sm{sub 2}Co{sub 17} as a prominent phase; while the films produced with the Sm{sub 8}Co{sub 92} target show Sm{sub 2}Co{sub 7} as a major phase. Both the Sm–Co films reveal granular morphology; however, the estimated grain size values are slightly lower in the case of Sm{sub 2}Co{sub 7} films, irrespective of their thicknesses. Coercivity (H{sub c}) values of 1.48 and 0.9 kOe are achieved for the as-grown 200-nm thick Sm{sub 2}Co{sub 17} and Sm{sub 2}Co{sub 7}-films. Temperature-dependent magnetization studies confirm that the demagnetization behaviors of these films are consistent with respect to the identified phase composition. Upon rapid thermal annealing, maximum H{sub c} value of 8.4 kOe is achieved for the 200 nm thick Sm{sub 2}Co{sub 17}-films. As far as e-beam evaporated Sm–Co films are concerned, this H{sub c} value is one of the best values reported so far. - Highlights: • Electron-beam evaporation was exploited to grow sub-μm thick Sm–Co films. • Sm{sub 2}Co{sub 7} and Sm{sub 2}Co{sub 17} magnetic phases were crystallized using Sm-lean alloy targets. • Both 200 and 300-nm thick Sm–Co films revealed distinct granular morphology. • Sm–Co films of lower thickness exhibited high H{sub c} and low M{sub s} and vice-versa. • Coercivity value of 8.4 kOe achieved for the 200-nm thick Sm{sub 2}Co{sub 17}-films after RTA.
Blue-green and red photoluminescence in CaTiO3:Sm
International Nuclear Information System (INIS)
Figueiredo, Alberthmeiry T. de; Longo, Valeria M.; Lazaro, Sergio de; Mastelaro, Valmor R.; De Vicente, Fabio S.; Hernandes, Antonio C.; Siu Li, Maximo; Varela, Jose A.; Longo, Elson
2007-01-01
Blue-green and red photoluminescence (PL) emission in structurally disordered CaTiO 3 :Sm (CT:Sm) powders was observed at room temperature with laser excitation at 350.7 nm. The perovskite-like titanate CT:Sm powders prepared by a soft chemical processing at different temperatures of annealing were structurally characterized by X-ray diffraction (XRD) and X-ray absorption near-edge structure (XANES). The results indicate that the generation of the broad PL band is related to order-disorder degree in the perovskite-like structure
Scholl, D. W.; Sainsbury, C.L.
1960-01-01
During July and August 1958 the U.S. Geological Survey conducted a study in behalf of the Atomic Energy Commission of the oceanography, bathymetry, and marine geology of the nearshore shelf of the Chukchi Sea off the Ogotoruk Creek area, northwest Alaska. Ogotoruk Creek enters the Chukchi Sea about 32 miles southeast of the large cuapate spit of Point Hope at long 165 degrees 4446 W. and lat 68 degrees 0551 N. The Ogotoruk Creek area extends approximately 10 miles west and 7 miles east of the creek mouth. Knowledge of the marine geology and oceanography is confined primarily to the nearshore shelf, which includes about 70 square miles of the shelf and is defined as the sea floor lying shoreward of the 50-foot submarine contour. The 50-foot contour generally lies from 2 to 4 miles from shore. Submarine topography was studied to a distance of 15 miles from shore over an area of approximately 340 square miles. A northwest coastal current flows past the Ogotoruk Creek area and during July and August averaged 0.5 mile per hour. Persistent northerly winds cause general upwelling near shore and at times of pronounced upwelling the coastal current was reversed or appreciably reduced in speed. Longshore currents shoreward of the breaker zone averaged 0.3 mile per hour and moved to the east for the greater part of the time of the study. The overall seaward slope of the inner 15 miles of the Chukchi shelf from a depth of 40 to 135 feet is approximately 0 degrees 04, or about 6 feet per mile. Slopes near shore to depths of 15-20 feet are steep and average 2 degrees 30. Beyond these depths they increase gradually out to a depth of 40-45 feet. Seaward of this point the shelf is flattest and slopes are as low as 0 degree 01. This terrace or flat part of the nearshore shelf is about 2 miles wide and descends to a depth of 50-55 feet beyond which the gradient increases to about 0 degree 06. At depths greater than 85 feet the submarine declivity gradually decreases to 0 degree 03 at
Baruch Institute for Marine and Coastal Sciences, Univ of South Carolina — A group of eight intertidal creeks with high densities of oysters, Crassostrea virginica, in North Inlet Estuary, South Carolina, USA were studied using a replicated...
Analysis of urine samples from metastatic bone cancer patients administered 153Sm-EDTMP
International Nuclear Information System (INIS)
Goeckeler, W.F.; Stoneburner, L.K.; Price, D.R.; Fordyce, W.A.
1993-01-01
153 Sm-EDTMP is currently undergoing clinical evaluation as a radiotherapeutic agent for the relief of pain associated with cancer metastatic to bone. These clinical studies have demonstrated biodistributions similar to those seen earlier in animals, namely, rapid clearance from blood, selective uptake in bone and in particular metastatic bone lesions. The radioactivity not deposited in bone is cleared through the kidneys into the urine. In this study, urine samples collected from 9 patients injected with 153 Sm-EDTMP underwent complexation analysis via Pharmacia SP-Sephadex C25 cation exchange chromatography. The results showed 96.9 ± 1.7% of the radioactivity in the urine to be present as a complex of 153 Sm. An HPLC method was developed and it was demonstrated that different complexes of 153 Sm could be separated. A non-radioactive analytical standard of the Sm-EDTMP chelate was synthesized, characterized and shown to have the same HPLC retention profile as the 153 -EDTMP drug product. HPLC analysis was performed on six urine samples and in each case a single radioactivity peak with an elution profile the same as that of a 153 Sm-EDTMP standard was observed. These results indicate that the 153 Sm-EDTMP chelate is excreted intact in the urine of patients. (Author)
Energy Technology Data Exchange (ETDEWEB)
Li, Minhong; Wang, LiLi; Ran, Weiguang; Ren, Chunyan; Song, Zeling; Shi, Jinsheng, E-mail: jsshiqn@aliyun.com
2017-04-15
Currently, the key change for white-LED is to improve the luminescence efficiency of red phosphor. Sm{sup 3+} activated phosphor was considered due to suitable emission position of red light. However, the luminescence intensity in the red region is weak. For enhancing red-emitting of Sm{sup 3+}, Bi{sup 3+} and Tb{sup 3+} ions were introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Sm{sup 3+} phosphors based on the concept of energy transfer. For Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples, it can be observed that the energy transfer process was blocked. Hence, Tb{sup 3+} was introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples to increase Sm{sup 3+} luminescence intensity based on Bi{sup 3+}→Tb{sup 3+}→Sm{sup 3+} energy transfer process. Compared with Sm{sup 3+} single-doped Ca{sub 2}Al{sub 2}SiO{sub 7} phosphor, the luminescence intensity of Sm{sup 3+} was enhanced by 2.6 times. It can be found that Tb{sup 3+} ions play a role of storing the energy or transfer bridge from Bi{sup 3+}→ Sm{sup 3+} by investigating the Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Tb{sup 3+} and Ca{sub 2}Al{sub 2}SiO{sub 7}:Tb{sup 3+}, Sm{sup 3+} energy transfer mechanism. All these results suggest that terbium branch mechanism plays an important role on enhancing activators luminescence intensity.
Structure of smAKAP and its regulation by PKA-mediated phosphorylation
Burgers, Pepijn P.; Bruystens, Jessica; Burnley, Rebecca J.; Nikolaev, Viacheslav O.; Keshwani, Malik; Wu, Jian; Janssen, Bert J. C.; Taylor, Susan S.; Heck, Albert J. R.; Scholten, Arjen
2016-01-01
The A-kinase anchoring protein (AKAP) smAKAP has three extraordinary features; it is very small, it is anchored directly to membranes by acyl motifs, and it interacts almost exclusively with the type I regulatory subunits (RI) of cAMP-dependent kinase (PKA). Here, we determined the crystal structure of smAKAP’s A-kinase binding domain (smAKAP-AKB) in complex with the dimerization/docking (D/D) domain of RIα which reveals an extended hydrophobic interface with unique interaction pockets that drive smAKAP’s high specificity for RI subunits. We also identify a conserved PKA phosphorylation site at Ser66 in the AKB domain which we predict would cause steric clashes and disrupt binding. This correlates with in vivo colocalization and fluorescence polarization studies, where Ser66 AKB phosphorylation ablates RI binding. Hydrogen/deuterium exchange studies confirm that the AKB helix is accessible and dynamic. Furthermore, full-length smAKAP as well as the unbound AKB is predicted to contain a break at the phosphorylation site, and circular dichroism measurements confirm that the AKB domain loses its helicity following phosphorylation. As the active site of PKA’s catalytic subunit does not accommodate α-helices, we predict that the inherent flexibility of the AKB domain enables its phosphorylation by PKA. This represents a novel mechanism, whereby activation of anchored PKA can terminate its binding to smAKAP affecting the regulation of localized cAMP signaling events. PMID:27028580
Hydrogen stability of SmCo5 permanent magnet
International Nuclear Information System (INIS)
Lukin, A.; Rabinovich, Y.; Bala, H.
2001-01-01
The present work has been performed with purpose to determine the level of hydrogen stability of sintered SmCo 5 permanent magnets by means of accelerated tests, to study the effect of hydrogen on the magnetic and mechanical properties of the permanent magnets and to establish the criteria of hydrogenation level and the activation energy of this process. In addition, the effect of hydrogen on the properties of sintered SmCo 5 permanent magnets in specific conditions of exploitation and storage durability of instruments was studied
Brood Year 2004: Johnson Creek Chinook Salmon Supplementation Report, June 2004 through March 2006.
Energy Technology Data Exchange (ETDEWEB)
Gebhards, John S.; Hill, Robert; Daniel, Mitch [Nez Perce Tribe
2009-02-19
The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River spring/summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek to spawn through artificial propagation. This was the sixth season of adult chinook broodstock collection in Johnson Creek following collections in 1998, 2000, 2001, 2002, and 2003. Weir installation was completed on June 21, 2004 with the first chinook captured on June 22, 2004 and the last fish captured on September 6, 2004. The weir was removed on September 18, 2004. A total of 338 adult chinook, including jacks, were captured during the season. Of these, 211 were of natural origin, 111 were hatchery origin Johnson Creek supplementation fish, and 16 were adipose fin clipped fish from other hatchery operations and therefore strays into Johnson Creek. Over the course of the run, 57 natural origin Johnson Creek adult chinook were retained for broodstock, transported to the South Fork Salmon River adult holding and spawning facility and held until spawned. The remaining natural origin Johnson Creek fish along with all the Johnson Creek supplementation fish were released upstream of the weir to spawn naturally. Twenty-seven Johnson Creek females were artificially spawned with 25 Johnson Creek males. Four females were diagnosed with high bacterial kidney disease levels resulting in their eggs being culled. The 27 females produced 116,598 green eggs, 16,531 green eggs were culled, with an average eye-up rate of 90.6% resulting in 90,647 eyed eggs. Juvenile fish were reared indoors at the McCall Fish Hatchery until November 2005 and then transferred to the outdoor rearing facilities during the Visual Implant Elastomer tagging operation
Structural and electrical properties of Sm{sup 3+} substituted PZT ceramics
Energy Technology Data Exchange (ETDEWEB)
Pandey, S.K. [Solid State Physics Laboratory, Timarpur, Delhi 110 054 (India)], E-mail: 628@ssplnet.org; Thakur, O.P.; Bhattacharya, D.K. [Solid State Physics Laboratory, Timarpur, Delhi 110 054 (India); Prakash, Chandra [DRDO Bhawan, DHQ, New Delhi 110 011 (India); Chatterjee, Ratnamala [Department of Physics, Indian Institute of Technology, New Delhi 110 016 (India)
2009-01-22
Samarium modified lead zirconate titanate (PSZT: Pb{sub 1-x}Sm{sub x}(Zr{sub 0.65}Ti{sub 0.35})O{sub 3}: x = 0, 0.02, 0.04, 0.06) ceramics were synthesized by solid state ceramic route. XRD shows single-phase formation with rhombohedral structure up to x = 0.04. With Sm-substitution, the grain size first increases up to x = 0.02 and then decreases. A metal/ferroelectric/metal (MFM) structure was made by depositing gold electrode on the flat surfaces for electrical measurements. All samples show normal ferroelectric behaviour, however, a squareness of P-E loop (polarization vs. electric field) was observed to increase with Sm content. Higher electromechanical coupling coefficients (K{sub p} and K{sub t}) have been achieved for the PZT with 6 mol% Sm substitution and having fine grain size.
Simplified syntheses of the water-soluble chiral shift reagents Sm-(R)-pdta and Sm-(S)-pdta
Czech Academy of Sciences Publication Activity Database
Hrubá, L.; Buděšínský, Miloš; Pícha, Jan; Jiráček, Jiří; Vaněk, Václav
2013-01-01
Roč. 54, č. 47 (2013), s. 6296-6297 ISSN 0040-4039 Institutional support: RVO:61388963 Keywords : NMR * chiral shift reagents * Sm-pdta * PDTA * samarium * 1,2-diaminopropane Subject RIV: CC - Organic Chemistry Impact factor: 2.391, year: 2013
Standard enthalpy of formation of Sm6UO12 acid dissolution calorimetry
International Nuclear Information System (INIS)
Venkata Krishnan, R.; Jogeswararao, G.; Ananthasivan, K.
2016-01-01
The standard molar enthalpies of formation of Δ f (298 K) of Sm 6 UO 12 have been determined by using an indigenously developed isoperibol acid solution calorimeter. The water equivalent of this calorimeter was determined by electrical calibration. The accuracy of measurement were determined by using standard materials KCl and tris(hydroxyl methyl) amino-methane (TRIS) and was found to be within ±2%. The enthalpies of solution at 298 K of Sm 2 O 3 , UO 3 and Sm 6 UO 12 were measured by using this calorimeter. From these experimental results the enthalpies of formation of Sm 6 UO 12 at 298 K were computed by using Hess's law of summation. (author)
Enhanced protective efficacy of a chimeric form of the schistosomiasis vaccine antigen Sm-TSP-2.
Directory of Open Access Journals (Sweden)
Mark S Pearson
Full Text Available The large extracellular loop of the Schistosoma mansoni tetraspanin, Sm-TSP-2, when fused to a thioredoxin partner and formulated with Freund's adjuvants, has been shown to be an efficacious vaccine against murine schistosomiasis. Moreover, Sm-TSP-2 is uniquely recognised by IgG(1 and IgG(3 from putatively resistant individuals resident in S. mansoni endemic areas in Brazil. In the present study, we expressed Sm-TSP-2 at high yield and in soluble form in E. coli without the need for a solubility enhancing fusion partner. We also expressed in E. coli a chimera called Sm-TSP-2/5B, which consisted of Sm-TSP-2 fused to the immunogenic 5B region of the hookworm aspartic protease and vaccine antigen, Na-APR-1. Sm-TSP-2 formulated with alum/CpG showed significant reductions in adult worm and liver egg burdens in two separate murine schistosomiasis challenge studies. Sm-TSP-2/5B afforded significantly greater protection than Sm-TSP-2 alone when both antigens were formulated with alum/CpG. The enhanced protection obtained with the chimeric fusion protein was associated with increased production of anti-Sm-TSP-2 antibodies and IL-4, IL-10 and IFN-γ from spleen cells of vaccinated animals. Sera from 666 individuals from Brazil who were infected with S. mansoni were screened for potentially deleterious IgE responses to Sm-TSP-2. Anti-Sm-TSP-2 IgE to this protein was not detected (also shown previously for Na-APR-1, suggesting that the chimeric antigen Sm-TSP-2/5B could be used to safely and effectively vaccinate people in areas where schistosomes and hookworms are endemic.
Stability of a sand spit due to dredging in an adjacent creek
Digital Repository Service at National Institute of Oceanography (India)
Patgaonkar, R.S.; Ilangovan, D.; Vethamony, P.; Babu, M.T.; Jayakumar, S.; Rajagopal, M.D.
, safety factor 1. Introduction The Jatadharmohan creek (hereinafter referred to as JMC) is a tidal creek oriented in the NE-SW direction (Fig. 1) and lies to the south of Paradip, along the east coast of India. This creek runs almost parallel... cor = 15 + (Nobs -15)/2, for Nobs > 15 b) Overburden correction: Ncor = Nobs x 350/ (? + 70) where, ? = overburden pressure The critical circular failure surface is the one for which factor of safety is the least. This is arrived...
Brillouin spectroscopy with surface acoustic waves on intermediate valent, doped SmS
International Nuclear Information System (INIS)
Schaerer, U.; Jung, A.; Wachter, P.
1998-01-01
Brillouin scattering on surface acoustic waves is a very powerful tool to determine the elastic constants of intermediate valent crystals, since the method is non-destructive and no mechanical contact is needed. A strong evidence for intermediate valence is a negative value of Poisson's ratio, which describes the behavior of the volume under uniaxial pressure. SmS by itself makes a semiconductor-metal transition at a pressure of more than 6.5 kbar. When substituting the divalent Sm by a trivalent cation, like Y, La or Tm, SmS can become - depending on the doping concentration - intermediate valent without any applied, external pressure. In this work, we will present measurements of the velocities of the surface acoustic waves and the calculation of the elastic constants of La- and Tm-doped SmS compounds. We found a clear dependence of Poisson's ratio on the doping concentration and on the valence of the materials. Furthermore, we will discuss the mechanism leading to intermediate valence when substituting Sm. Besides the internal, chemical pressure, which is produced by the built in trivalent cations with their smaller ionic radii, we have clear evidence, that the free electrons in the 5d band, induced by the substituting atoms, also play an important role in making doped SmS intermediate valent. (orig.)
Isolated centres versus defect associates in Sm3+-doped CeO2: a spectroscopic investigation
International Nuclear Information System (INIS)
Tiseanu, Carmen; Avram, Daniel; Cojocaru, Bogdan; Parvulescu, Vasile I; Vela-Gonzalez, Andrea V; Sanchez-Dominguez, Margarita
2013-01-01
The interactions between Sm 3+ and oxygen vacancies in CeO 2 are probed by the use of tuneable laser excited time-resolved photoluminescence and Raman spectroscopies. It is found that Sm 3+ (with doping concentrations of 0.1, 0.3, 1 and 5 wt%) substitutes largely for Ce 4+ in sites with cubic symmetry and the corresponding emission is sensitized via the Ce 4+ –O 2− charge-transfer band of CeO 2 . It is established from the photoluminescence spectra measured at long delay after the laser pulse that the local environment around cubic Sm 3+ centres is not changed with concentration and ceria size. In addition to cubic symmetry Sm 3+ centres, low-symmetry Sm 3+ centres tentatively assigned to the Sm 3+ –oxygen vacancy associates of nearest-neighbour type are also observed. Their emission is preferentially excited via the weak f–f absorption transitions of Sm 3+ . A relatively strong concentration-induced quenching of Sm 3+ emission was inferred from the decrease in the average emission lifetimes from 2.1 ms (0.1 wt%) to 0.87 ms (5 wt%). The local environments of Sm 3+ and Eu 3+ in CeO 2 are also compared on the basis of their emission spectra and decays. (paper)
Water quality in the upper Shoal Creek basin, southwestern Missouri, 1999-2000
Schumacher, John G.
2001-01-01
Results of a water-quality investigation of the upper Shoal Creek Basin in southwestern Missouri indicate that concentrations of total nitrite plus nitrate as nitrogen (NO2t+NO3t) in water samples from Shoal Creek were unusually large [mean of 2.90 mg/L (milligrams per liter), n (sample size)=60] compared to other Missouri streams (mean of 1.02 mg/L, n=1,340). A comparison of instantaneous base-flow loads of NO2t+NO3t indicates that at base-flow conditions, most NO2t+NO3t discharged by Shoal Creek is from nonpoint sources. Nearly all the base-flow instantaneous load of total phosphorus as P (Pt) discharged by Shoal Creek can be attributed to effluent from a municipal wastewater treatment plant. Samples collected from a single runoff event indicate that substantial quantities of Pt can be transported during runoff events compared to base-flow transport. Only minor quantities of NO2t+NO3t are transported during runoff events compared to base-flow transport. Fecal coliform bacteria densities at several locations exceed the Missouri Department of Natural Resources (MDNR) standard of 200 col/100 mL (colonies per 100 milliliters) for whole-body contact recreation. During 13 months of monitoring at 13 stream sites, fecal coliform densities (median of 277 and 400 col/100 mL) at two sites (sites 2 and 3) on Shoal Creek exceeded the MDNR standard at base-flow conditions. The maximum fecal coliform density of 120,000 col/100 mL was detected at site 3 (MDNR monitoring site) during a runoff event in April 1999 at a peak discharge of 1,150 ft3/s (cubic feet per second). Fecal coliform densities also exceeded the MDNR standard in three tributaries with the largest densities (median of 580 col/100 mL) detected in Pogue Creek. Results of ribopattern analyses indicate that most Escherichia coli (E. coli) bacteria in water samples from the study area probably are from nonhuman sources. The study area contains about 25,000 cattle, and has an estimated annual production of 33 million
Czech Academy of Sciences Publication Activity Database
Sun, J.L.; Huang, Y.B.; Cheng, L.; Yao, X.; Lai, Y.J.; Jirsa, Miloš
2009-01-01
Roč. 9, č. 2 (2009), 898-902 ISSN 1528-7483 R&D Projects: GA ČR GA202/08/0722 Institutional research plan: CEZ:AV0Z10100520 Keywords : high-temperature optical microscopy * growth and orientation of Sm-Ba-Cu-O phases * Sm-211 whisker substrate Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.162, year: 2009
Miller, Todd S.
2009-01-01
In 2002, the U.S. Geological Survey, in cooperation with the Town of Caroline and Tompkins County Planning Department, began a study of the valley-fill aquifer system in upper Sixmile Creek and headwaters of West Branch Owego Creek valleys in the Town of Caroline, NY. The purpose of the study is to provide geohydrologic data to county and town planners as they develop a strategy to manage and protect their water resources. The first aquifer reach investigated in this series is in the Town of Caroline and includes the upper Sixmile Creek valley and part of West Branch Owego Creek valley. The portions of the valley-fill aquifer system that are comprised of saturated coarse-grained sediments including medium to coarse sand and sandy gravel form the major aquifers. Confined sand and gravel units form the major aquifers in the western and central portions of the upper Sixmile Creek valley, and an unconfined sand and gravel unit forms the major aquifer in the eastern portion of the upper Sixmile Creek valley and in the headwaters of the West Branch Owego Creek valley. The valley-fill deposits are thinnest near the edges of the valley where they pinch out along the till-mantled bedrock valley walls. The thickness of the valley fill in the deepest part of the valley, at the western end of the study area, is about 100 feet (ft); the thickness is greater than 165 ft on top of the Valley Heads Moraine in the central part of the valley. An estimated 750 people live over and rely on groundwater from the valley-fill aquifers in upper Sixmile Creek and West Branch Owego Creek valleys. Most groundwater withdrawn from the valley-fill aquifers is pumped from wells with open-ended 6-inch diameter casings; the remaining withdrawals are from shallow dug wells or cisterns that collect groundwater that discharges to springs (especially in the Brooktondale area). The valley-fill aquifers are the sources of water for about 200 households, several apartment complexes, two mobile home parks
Evaluation of protected, threatened, and endangered fish species in Upper Bear Creek watershed
International Nuclear Information System (INIS)
Ryon, M.G.
1998-07-01
The East Bear Creek Site for the proposed centralized waste facility on the US Department of Energy's Oak Ridge Reservation was evaluated for potential rare, threatened or endangered (T and E) fish species in the six primary tributaries and the main stem of Bear Creek that are within or adjacent to the facility footprint. These tributaries and portion of Bear Creek comprise the upper Bear Creek watershed. One T and E fish species, the Tennessee dace (Phoxinus tennesseensis), was located in these streams. The Tennessee dace is listed by the State of Tennessee as being in need of management, and as such its habitat is afforded some protection. Surveys indicated that Tennessee dace occupy the northern tributaries NT-1, NT-4, and NT-5, as well as Bear Creek. Several specimens of the dace were gravid females, indicating that the streams may function as reproductive habitat for the species. The implications of impacts on the species are discussed and mitigation objectives are included
Investigations on the indium-113m isotope generators
International Nuclear Information System (INIS)
Oniciu, L.; Veglia, A.
1975-01-01
Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)
Coercive force changes in Sm(CoFeCuZr)z during step-like heat treatments
International Nuclear Information System (INIS)
Puzanova, T.Z.; Shchegoleva, N.N.; Sakhnova, L.V.; Majkov, V.G.; Shur, Ya.S.; Nikolaeva, N.V.
1987-01-01
Sm(Co 0.67 Fe 0.22 Cu 0.08 Zr 0.03 ) 8.35 alloy, contaning two homogeneous solid solutions SmM 6.85 and SmM 7.75 (M=Co, Fe, Cu, Zr) after high-temperature treatment, is investigated. It is shown, that after isothermal tempering at 800 deg C, SmM 6.85 and SmM 7.75 are close by microstructure and their coercive forces change in a different way during step-like cooling within 700-400 deg C interval. Possibility of producing material, single-phase in magnetic relation, is discussed
13 CFR 113.3-3 - Structural accommodations for handicapped clients.
2010-01-01
... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...
Energy Technology Data Exchange (ETDEWEB)
Clausen, T.
2006-11-15
about 25 nm in the [33 anti 2] direction and about 40nm in the [1 anti 10] direction. The islands are strongly relaxed and they contain no appreciable Si concentration. The Antimony surfactant-mediated epitaxy allows to grow smooth Ge films on Si(113) substrates. These Ge films exhibit surface roughnesses of only some Aangstroem at a thickness of about 5 nm. The films are strongly relaxed with a residual Ge strain of about 31% (500 C) to 37% (600 C) and contain only a low Si concentration of about 4% Si (500 C) to 10% Si (600 C). The relaxation results from the formation of misfit dislocations at the Ge/Si(113) interface with a bimodal distance distribution of about 7 nm and 12.5 nm. Most likely, the misfit dislocations are 60 dislocations with a Burgers vector of (vector)b=a{sub 0}/. left angle 10 anti 1 right angle /2. (orig.)
Stream sediment detailed geochemical survey for Date Creek Basin, Arizona
International Nuclear Information System (INIS)
Butz, T.R.; Tieman, D.J.; Grimes, J.G.; Bard, C.S.; Helgerson, R.N.; Pritz, P.M.; Wolf, D.A.
1981-01-01
The purpose of the Date Creek Supplement is to characterize the chemistry of sediment samples representing stream basins in which the Anderson Mine (and related prospects) occur. Once characterized, the chemistry is then used to delineate other areas within the Date Creek Basin where stream sediment chemistry resembles that of the Anderson Mine area. This supplementary report examines more closely the data from sediment samples taken in 239 stream basins collected over a total area of approximately 900 km 2 (350 mi 2 ). Cluster and discriminant analyses are used to characterize the geochemistry of the stream sediment samples collected in the Date Creek Basin. Cluster and discriminant analysis plots are used to delineate areas having a potential for uranium mineralization similar to that of the Anderson Mine
2010-06-03
... Ranger District; Idaho; Mill Creek--Council Mountain Landscape Restoration Project AGENCY: Forest Service... the Mill Creek--Council Mountain Landscape Restoration Project. The approximate 51,900 acre project area is located about two miles east of Council, Idaho. The Mill Creek--Council Mountain Landscape...
Musser, Jonathan W.
2012-01-01
Digital flood-inundation maps for a 10.5-mile reach of Sweetwater Creek, from about 1,800 feet above the confluence of Powder Springs Creek to about 160 feet below the Interstate 20 bridge, were developed by the U.S. Geological Survey (USGS) in cooperation with Cobb County, Georgia. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage at Sweetwater Creek near Austell, Georgia (02337000). Current stage at this USGS streamgage may be obtained at http://waterdata.usgs.gov/ and can be used in conjunction with these maps to estimate near real-time areas of inundation. The National Weather Service (NWS) is incorporating results from this study into the Advanced Hydrologic Prediction Service (AHPS) flood-warning system (http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that commonly are collocated at USGS streamgages. The forecasted peak-stage information for the USGS streamgage at Sweetwater Creek near Austell (02337000), which is available through the AHPS Web site, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. A one-dimensional step-backwater model was developed using the U.S. Army Corps of Engineers Hydrologic Engineering Centers River Analysis System (HEC–RAS) software for Sweetwater Creek and was used to compute flood profiles for a 10.5-mile reach of the creek. The model was calibrated using the most current stage-discharge relations at the Sweetwater Creek near Austell streamgage (02337000), as well as high-water marks collected during annual peak-flow events in 1982 and 2009. The hydraulic model was then used to determine 21 water-surface profiles for flood stages at the Sweetwater Creek streamgage at 1-foot intervals referenced to the
Mercury in Thana creek, Bombay harbour
Digital Repository Service at National Institute of Oceanography (India)
Zingde, M.D.; Desai, B.N.
weight) with marked increased from harbour to the creek region suggests substantial mercury input in the head region. Chemical extraction by hydrogen peroxide indicated that more than 70% of mercury was leachable and probably organically bound...
Energy Technology Data Exchange (ETDEWEB)
Silva, Marcia Augusta da
2001-07-01
The {sup 153}Sm-EDTMP is a radiopharmaceutical used in nuclear medicine with promising results for the relief of metastatic pain. Therefore, there are few knowledge about the effects of {sup 153}Sm-EDTMP at cellular level. The present study was conduced with the aim of evaluating the cytogenetic effects of {sup 153}Sm-EDTMP in peripheral lymphocytes from patients with bone metastasis (with and without previous radio and/or chemotherapy) by the chromosome aberration technique, either in vivo or in vitro. For that, the blood samples were collected before and one hour after the endovenous administration of {sup 153}Sm-EDTMP (mean activity of 42.53+/-5.31 MBq/kg body weight), taking into account the rapid blood clearance. The principal types of structural chromosome aberrations found gaps and breaks, acentric fragments centric rings, double minutes and dicentrics. The statistical analysis showed that the group submitted to previous radio and chemotherapy before {sup 153}Sm-EDTMP administration showed significant difference in chromosome aberrations frequency one hour after the treatment. The analysis of the chromosome modal number and the kinetics of cellular cycle showed no statistical difference among the groups, suggesting that the treatment with {sup 153}Sm-EDTMP, did not influence these parameters. The carrier molecule, EDTMP, did not influence the induction of chromosome aberration. In relation to the in vitro assays, the obtained data of peripheral lymphocytes of healthy donors and patients with no previous treatment exposed to different radioactive concentration of {sup 153}Sm-EDTMP (0.046 - 1.110 MBq/mL) were better adjusted by linear regression model (Y=A+BX). The chromosome damage induced by {sup 153}Sm-EDTMP observed in vitro was about 2 fold higher than that found in vivo for the group of patients with no previous treatment. The obtained data showed that the therapy with {sup 153}Sm-EDTMP induced a few quantity of cytogenetic damages in peripheral
Directory of Open Access Journals (Sweden)
Marion Morel
Full Text Available Venus kinase receptors (VKRs are invertebrate receptor tyrosine kinases (RTKs formed by an extracellular Venus Fly Trap (VFT ligand binding domain associated via a transmembrane domain with an intracellular tyrosine kinase (TK domain. Schistosoma mansoni VKRs, SmVKR1 and SmVKR2, are both implicated in reproductive activities of the parasite. In this work, we show that the SH2 domain-containing protein SmShb is a partner of the phosphorylated form of SmVKR1. Expression of these proteins in Xenopus oocytes allowed us to demonstrate that the SH2 domain of SmShb interacts with the phosphotyrosine residue (pY979 located in the juxtamembrane region of SmVKR1. This interaction leads to phosphorylation of SmShb on tyrosines and promotes SmVKR1 signaling towards the JNK pathway. SmShb transcripts are expressed in all parasite stages and they were found in ovary and testes of adult worms, suggesting a possible colocalization of SmShb and SmVKR1 proteins. Silencing of SmShb in adult S. mansoni resulted in an accumulation of mature sperm in testes, indicating a possible role of SmShb in gametogenesis.
Morel, Marion; Vanderstraete, Mathieu; Cailliau, Katia; Hahnel, Steffen; Grevelding, Christoph G; Dissous, Colette
2016-01-01
Venus kinase receptors (VKRs) are invertebrate receptor tyrosine kinases (RTKs) formed by an extracellular Venus Fly Trap (VFT) ligand binding domain associated via a transmembrane domain with an intracellular tyrosine kinase (TK) domain. Schistosoma mansoni VKRs, SmVKR1 and SmVKR2, are both implicated in reproductive activities of the parasite. In this work, we show that the SH2 domain-containing protein SmShb is a partner of the phosphorylated form of SmVKR1. Expression of these proteins in Xenopus oocytes allowed us to demonstrate that the SH2 domain of SmShb interacts with the phosphotyrosine residue (pY979) located in the juxtamembrane region of SmVKR1. This interaction leads to phosphorylation of SmShb on tyrosines and promotes SmVKR1 signaling towards the JNK pathway. SmShb transcripts are expressed in all parasite stages and they were found in ovary and testes of adult worms, suggesting a possible colocalization of SmShb and SmVKR1 proteins. Silencing of SmShb in adult S. mansoni resulted in an accumulation of mature sperm in testes, indicating a possible role of SmShb in gametogenesis.
Directory of Open Access Journals (Sweden)
Mohsen S. Asker
2011-04-01
Full Text Available Four new complexes [V(NTA(H2O 2]H2O (1, H[Sn(NTA] (2, H[Sm(NTA]H2O (3, and [Sm(NTA(H2O 2]H2O (4 were obtained during the reactions of metal salts (VCl3, SnCl22H2O, SnCl4, Sm(NO326H2O and SmCl36H2O with nitrilotriacetic acid, H3NTA. The infrared and 1H-NMR spectra of the solid complexes have been obtained and assigned. Thermogravimetric analyses were also carried out. The data obtained agree with the proposed structures and show that the complexes decomposed to the corresponding metal oxide. The ligand and their metal complexes were screened for their antimicrobial activities by the agar-well diffusion technique using DMSO as a solvent against the following bacterial species: Bacillus subtilis, Staphylococcus aureus, Escherichia coli and Pseudomonas aeruginosa and antifungal activity against Aspergillus niger, Aspergillus flavus, Saccharomyces cerevisiae and Candida albicans. The obtained results were compared with some types of known antibiotics. The minimum inhibitory concentration (MIC values were calculated at 30 °C for 24−48 h. The activity data show that the complexes are more potent antimicrobials than the parent ligand.
Summary of the Skookumchuck Creek bull trout enumeration project 2001.; TOPICAL
International Nuclear Information System (INIS)
Baxter, James S.; Baxter, Jeremy
2002-01-01
This report summarizes the second year of a bull trout (Salvelinus confluentus) enumeration project on Skookumchuck Creek in southeastern British Columbia. An enumeration fence and traps were installed on the creek from September 6th to October 12th 2001 to enable the capture of post-spawning bull trout emigrating out of the watershed. During the study period, a total of 273 bull trout were sampled through the enumeration fence. Length and weight were determined for all bull trout captured. In total, 39 fish of undetermined sex, 61 males and 173 females were processed through the fence. An additional 19 bull trout were observed on a snorkel survey prior to the fence being removed on October 12th. Coupled with the fence count, the total bull trout enumerated during this project was 292 fish. Several other species of fish were captured at the enumeration fence including westslope cutthroat trout (Oncorhynchus clarki lewisi), Rocky Mountain whitefish (Prosopium williamsoni), and kokanee (O. nerka). A total of 143 bull trout redds were enumerated on the ground in two different locations (river km 27.5-30.5, and km 24.0-25.5) on October 3rd. The majority of redds (n=132) were observed in the 3.0 km index section (river km 27.5-30.5) that has been surveyed over the past five years. The additional 11 redds were observed in a 1.5 km section (river km 24.0-25.5). Summary plots of water temperature for Bradford Creek, Sandown Creek, Buhl Creek, and Skookumchuck Creek at three locations suggested that water temperatures were within the temperature range preferred by bull trout for spawning, egg incubation, and rearing
International Nuclear Information System (INIS)
Bower, M.B.; Needham, R.S.; Page, R.W.; Stuart-Smith, P.G.; Wyborn, L.A.I.
1985-01-01
The objective of this project is to help establish a sound geological framework of the Pine Creek region through regional geological, geochemical and geophysical studies. Uranium ore at the Coronation Hill U-Au mine is confined to a wedge of conglomerate in faulted contact with altered volcanics. The uranium, which is classified as epigenetic sandstone type, is derived from a uranium-enriched felsic volcanic source
48 CFR 18.113 - Interagency acquisitions under the Economy Act.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...
9 CFR 113.64 - General requirements for live bacterial vaccines.
2010-01-01
... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...
Evaluation of the Steel Creek ecosystem in relation to the proposed restart of L reactor
International Nuclear Information System (INIS)
Smith, M.H.; Sharitz, R.R.; Gladden, J.B.
1981-10-01
Information is presented on the following subjects: habitat and vegetation, the avifauna, semi-aquatic and terrestrial vertebrates, and aquatic communities of Steel Creek, species of special concern, and radiocesium in Steel Creek. Two main goals of the study were the compilation of a current inventory of the flora and fauna of the Steel Creek ecosystem and an assessment of the probable impacts of radionuclides, primarily 137 Cs, that were released into Steel Creek during earlier reactor operations. Although a thorough evaluation of the impacts of the L reactor restart is impossible at this time, it is concluded that the effects on the Steel Creek ecosystem will be substantial if no mitigative measures are taken
Luminescence and energy transfer of Sm3+ and Eu3+ in Ca2PO4Cl
International Nuclear Information System (INIS)
Wang, Zhijun; Li, Panlai; Yang, Zhiping; Guo, Qinglin
2014-01-01
Sm 3+ , Eu 3+ , and Sm 3+ –Eu 3+ doped Ca 2 PO 4 Cl phosphors are synthesized by a solid-state method. Ca 2 PO 4 Cl:Sm 3+ can produce red emission under the 400 nm radiation excitation, and the emission peak is located at 601 nm, which is assigned to the 4 G 5/2 → 6 H 7/2 transition of Sm 3+ . Ca 2 PO 4 Cl:Eu 3+ can create red emission under the 392 nm radiation excitation, and the strongest peak is located at 620 nm, which is attributed to the 5 D 0 → 7 F 2 transition of Eu 3+ . The energy transfer from Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl has been validated and the critical distance (R c ) of Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl is calculated to be 1.14 nm. With increasing Eu 3+ doping concentration, the energy transfer efficiency (Sm 3+ →Eu 3+ ) gradually increases to 53.7%. The luminescence property of Ca 2 PO 4 Cl:Sm 3+ , Eu 3+ can be tuned by properly tuning the relative ratio of Sm 3+ –Eu 3+ , and the emission intensity of Ca 2 PO 4 Cl:Eu 3+ can be greatly enhanced by codoped Sm 3+ . - Highlights: • Ca 2 PO 4 Cl:Sm 3+ , Eu 3+ can produce red emission under the 400 nm radiation excitation. • The energy transfer from Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl has been validated. • The critical distance of Sm 3+ to Eu 3+ in Ca 2 PO 4 Cl is calculated to be 1.14 nm
2013-05-01
... Petroleum Corporation, Bear Creek Facility, Converse County, Wyoming AGENCY: Nuclear Regulatory Commission.... 47 for its Bear Creek Uranium Mill facility in Converse County, Wyoming. The NRC has prepared an... INFORMATION: I. Background The Bear Creek Uranium Mill operated from September 1977 until January 1986, and...
International Nuclear Information System (INIS)
Cambier, Linda; Pomies, Pascal
2011-01-01
Highlights: → The cytoskeleton-associated protein, smALP, is expressed in differentiated skeletal muscle. → smALP is translocated from the cytoplasm to the nucleus of C2C12 myoblasts upon induction of myogenesis. → The differentiation-dependent nuclear translocation of smALP occurs in parallel with the nuclear accumulation of myogenin. → The LIM domain of smALP is essential for the nuclear accumulation of the protein. → smALP might act in the nucleus to control some critical aspect of the muscle differentiation process. -- Abstract: The skALP isoform has been shown to play a critical role in actin organization and anchorage within the Z-discs of skeletal muscles, but no data is available on the function of the smALP isoform in skeletal muscle cells. Here, we show that upon induction of differentiation a nuclear translocation of smALP from the cytoplasm to the nucleus of C2C12 myoblasts, concomitant to an up-regulation of the protein expression, occurs in parallel with the nuclear accumulation of myogenin. Moreover, we demonstrate that the LIM domain of smALP is essential for the nuclear translocation of the protein.
2016-12-01
attack or Anti-Ship Cruise Missiles in flight. The SM-6 ERAM program is an evolutionary, capabilities based acquisition program that will use spiral ...Prior SAR Total O&S Estimates - Dec 2014 SAR 460.3 Programmatic/Planning Factors 0.0 Cost Estimating Methodology 0.0 Cost Data Update 0.0 Labor Rate
Mathematical modelling of flooding at Magela Creek
International Nuclear Information System (INIS)
Vardavas, I.
1989-01-01
The extent and frequency of the flooding at Magela Creek can be predicted from a mathematical/computer model describing the hydrological phases of surface runoff. Surface runoff involves complex water transfer processes over very inhomogeneous terrain. A simple mathematical model of these has been developed which includes the interception of rainfall by the plant canopy, evapotranspiration, infiltration of surface water into the soil, the storage of water in surface depressions, and overland and subsurface water flow. The rainfall-runoff model has then been incorporated into a more complex computer model to predict the amount of water that enters and leaves the Magela Creek flood plain, downstream of the mine. 2 figs., ills
Portner, R.A.; Hendrix, M.S.; Stalker, J.C.; Miggins, D.P.; Sheriff, S.D.
2011-01-01
Middle Eocene through Upper Miocene sedimentary and volcanic rocks of the Flint Creek basin in western Montana accumulated during a period of significant paleoclimatic change and extension across the northern Rocky Mountain Basin and Range province. Gravity modelling, borehole data, and geologic mapping from the Flint Creek basin indicate that subsidence was focused along an extensionally reactivated Sevier thrust fault, which accommodated up to 800 m of basin fill while relaying stress between the dextral transtensional Lewis and Clark lineament to the north and the Anaconda core complex to the south. Northwesterly paleocurrent indicators, foliated metamorphic lithics, 64 Ma (40Ar/39Ar) muscovite grains, and 76 Ma (U-Pb) zircons in a ca. 27 Ma arkosic sandstone are consistent with Oligocene exhumation and erosion of the Anaconda core complex. The core complex and volcanic and magmatic rocks in its hangingwall created an important drainage divide during the Paleogene shedding detritus to the NNW and ESE. Following a major period of Early Miocene tectonism and erosion, regional drainage networks were reorganized such that paleoflow in the Flint Creek basin flowed east into an internally drained saline lake system. Renewed tectonism during Middle to Late Miocene time reestablished a west-directed drainage that is recorded by fluvial strata within a Late Miocene paleovalley. These tectonic reorganizations and associated drainage divide explain observed discrepancies in provenance studies across the province. Regional correlation of unconformities and lithofacies mapping in the Flint Creek basin suggest that localized tectonism and relative base level fluctuations controlled lithostratigraphic architecture.
Influences of the amount of ligand on the biochemical properties of 153Sm-HEDTMP
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Pu Manfei; Bing Wenzeng
2002-01-01
The Effect of the amount of ligand HEDTMP on biochemical properties of 153 Sm-HEDTMP is studied. The biochemical properties include partition coefficient of 153 Sm-HEDTMP in n-octanol-water which is measured by shake-flask method, combination characteristic with BSA (bovine serum albumin) which is measured through precipitation by TCA (trichloroacetic acid) and adsorption characteristic on HA (hydroxyapatite) which is measured with the same method used in 153 Sm-EDTMP. It is found that, with the increasing in the amount of ligand, partition coefficient of 153 Sm-HEDTMP. It is found that, with the increase in the amount of ligand, partition coefficient of 153 Sm-HEDTMP in n-octanol-water decreases, so does combination percentage with BSA, but the adsorption percentage on HA shows a little and unremarkable decrease. Considering the relationships between these three biochemical properties and in vivo metabolism of 153 Sm-HEDTMP this study supports the view that an appropriate high amount of ligand should be applied in practical use
1979-02-01
classified as Porno , Lake Miwok, and Patwin. Recent surveys within the Clear Lake-Cache Creek Basin have located 28 archeological sites, some of which...additional 8,400 acre-feet annually to the Lakeport area. Porno Reservoir on Kelsey Creek, being studied by Lake County, also would supplement M&l water...project on Scotts Creek could provide 9,100 acre- feet annually of irrigation water. Also, as previously discussed, Porno Reservoir would furnish
32 CFR Appendix A to Part 113 - Certificate of Compliance
2010-07-01
... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...
46 CFR 113.35-9 - Mechanical engine order telegraph systems.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...
External exposure in radionuclide therapy with 153 Sm
Energy Technology Data Exchange (ETDEWEB)
Rezio, M.T.; Vieira, M.R. [Instituto Portugues Oncologia de Francisco Gentil, CROL, Lisboa (Portugal)
2006-07-01
Full text of publication follows: Aim: The radiopharmaceutical 153 Sm is an beta emitter used in metastatic bone pain palliation. The prescribed activity is 37 MBq/kg body weight.. The aim of this study is to measure the dose rate of the patients during 4 to 6 hours after 153 Sm - E.D.T.M.P. administration in order to prevent external exposure of nursing staff, family members and general public. Material and Methods: Twelve patients were treated with 153 Sm in our department. External exposure rates( {mu}Sv/h) at different times and at one meter were measured, with a Geiger-Muller detector. Results: The mean dose rate at one meter was 12 {mu}Sv/h, one hour after injection and 3{mu} Sv/h, 6 hours after injection. Conclusion: The policy in our department is to keep the patient in the hospital 4-6 h, due to the risk of contamination. Based on our results, the external exposure of the nursing staff, family members and the general public is very low, in agreement with other studies. (authors)
External exposure in radionuclide therapy with 153 Sm
International Nuclear Information System (INIS)
Rezio, M.T.; Vieira, M.R.
2006-01-01
Full text of publication follows: Aim: The radiopharmaceutical 153 Sm is an beta emitter used in metastatic bone pain palliation. The prescribed activity is 37 MBq/kg body weight.. The aim of this study is to measure the dose rate of the patients during 4 to 6 hours after 153 Sm - E.D.T.M.P. administration in order to prevent external exposure of nursing staff, family members and general public. Material and Methods: Twelve patients were treated with 153 Sm in our department. External exposure rates( μSv/h) at different times and at one meter were measured, with a Geiger-Muller detector. Results: The mean dose rate at one meter was 12 μSv/h, one hour after injection and 3μ Sv/h, 6 hours after injection. Conclusion: The policy in our department is to keep the patient in the hospital 4-6 h, due to the risk of contamination. Based on our results, the external exposure of the nursing staff, family members and the general public is very low, in agreement with other studies. (authors)
Featured Partner: Saddle Creek Logistics Services
This EPA fact sheet spotlights Saddle Creek Logistics as a SmartWay partner committed to sustainability in reducing greenhouse gas emissions and air pollution caused by freight transportation, partly by growing its compressed natural gas (CNG) vehicles for
Lv, Yuguang; Shi, Qi; Jin, Yuling; Ren, Hengxin; Qin, Yushan; Wang, Bo; Song, Shanshan
2018-03-01
In this paper, the La3+-doped Sm3+ hydroxyapatite (La/Sm/HAP) complexes were prepared by a precipitation method. The sample was defined by IR spectra, fluorescence spectra and X ray diffraction analysis et al. The structure of complexes were discussed. The emission wavelength of heat treatment of Sm3+ do not change, but will affect the intensity of the peak Sm3+ luminescence properties and the occupy hydroxyapatite in the lattice Ca( II )and Ca( I ) loci with Sm3+ doped concentration and the proportion of the sintering temperature change and change: The nano hydroxyapatite complex of the La3+ doped samarium obtain the good fluorescence intensity, by La3+ doping content of Sm3+ were hydroxyapatite 6% (La3+, Sm3+ mole ratio) device. The complex of La3+ doped samarium HAP have Stable chemical property, fluorescence property and excellent biological activity. The ligand HAP absorbs energy or captures an electron-hole pair and then transfers it to the lanthanide ions. The catalytic activity influence of the La3+-doped Sm3+hydroxyapatite was discussed, the La/Sm/HAP had excellent antibacterial property, which used as potential biological antibacterial material.
Two-neutrino double-β decay of 150Nd to excited final states in 150Sm
Kidd, M. F.; Esterline, J. H.; Finch, S. W.; Tornow, W.
2014-11-01
Background: Double-β decay is a rare nuclear process in which two neutrons in the nucleus are converted to two protons with the emission of two electrons and two electron antineutrinos. Purpose: We measured the half-life of the two-neutrino double-β decay of 150Nd to excited final states of 150Sm by detecting the deexcitation γ rays of the daughter nucleus. Method: This study yields the first detection of the coincidence γ rays from the 0 1+ excited state of 150Sm. These γ rays have energies of 333.97 and 406.52 keV and are emitted in coincidence through a 01+→21+→0gs+ transition. Results: The enriched Nd2O3 sample consisted of 40.13 g 150Nd and was observed for 642.8 days at the Kimballton Underground Research Facility, producing 21.6 net events in the region of interest. This count rate gives a half-life of T1 /2=[1 .07-0.25+0.45(stat ) ±0.07 (syst ) ] ×1020 yr. The effective nuclear matrix element was found to be 0.0465 -0.0054+0.0098. Finally, lower limits were obtained for decays to higher excited final states. Conclusions: Our half-life measurement agrees within uncertainties with another recent measurement in which no coincidence was employed. Our nuclear matrix element calculation may have an impact on a recent neutrinoless double-β decay nuclear matrix element calculation which implies that the decay to the first excited state in 150Sm is favored over that to the ground state.
Meynecke, Jan-Olaf; Poole, Geoffrey C.; Werry, Jonathan; Lee, Shing Yip
2008-08-01
We assessed movement patterns in relation to habitat availability (reflected by the extent of tidal flooding) for several commercially and recreationally important species in and out of a small mangrove creek within the subtropical Burrum River estuary (25°10'S 152°37'E) in Queensland, Australia. Movement patterns of Acanthopagrus australis, Pomadasys kaakan, Lutjanus russelli and Mugil cephalus were examined between December 2006 and April 2007 using a stationary passive integrated transponder (PIT) system adapted for saline environments (30-38 ppt) and underwater digital video cameras (DVCs). This is the second known application of a stationary PIT tag system to studying fish movement in estuarine environments. The transponder system was set in place for 104 days and recorded >5000 detections. Overall 'recapture' rate of tagged fish by the transponder system was >40%. We used PIT tags implanted in a total of 75 fish from a tidal creek connected to the main channel of the estuary. We also developed a high-resolution digital elevation (2.5 m cell size) model of the estuary derived from airborne light detection and ranging (LIDAR) and aerial imagery to estimate inundation dynamics within the tidal creek, and related the timing of inundation in various habitats to the timing of fish immigration to and emigration from the creek. Over 50% of all tagged fish were moving in and out of the creek at a threshold level when 50% of the mangrove forest became flooded. Individuals of all four species moved into and out of the tidal creek repeatedly at different times depending on species and size, indicating strong residential behaviour within the estuary. The main activity of fishes was at night time. Manual interpretation of video from >700 fish sightings at three different mangrove sites confirmed the findings of the stationary PIT system, that the function of shelter vs food in mangrove habitat may be size dependent. Our established techniques assess the spatial ecology
9 CFR 113.300 - General requirements for live virus vaccines.
2010-01-01
... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...
13 CFR 113.520 - Job classification and structure.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...
Three-loop SM beta-functions for matrix Yukawa couplings
Directory of Open Access Journals (Sweden)
A.V. Bednyakov
2014-10-01
Full Text Available We present the extension of our previous results for three-loop Yukawa coupling beta-functions to the case of complex Yukawa matrices describing the flavour structure of the SM. The calculation is carried out in the context of unbroken phase of the SM with the help of the MINCER program in a general linear gauge and cross-checked by means of MATAD/BAMBA codes. In addition, ambiguities in Yukawa matrix beta-functions are studied.
Optical imaging of the transport properties of S-Sm-S junctions
International Nuclear Information System (INIS)
Tsumura, K; Nomura, S; Akazaki, T; Takayanagi, H
2009-01-01
We study the optical effects on superconductor-normal metal superconductor (S-Sm-S) junctions composed of two-dimensional electron gas (2DEG) in a GaAs/AlGaAs heterostructure and NbN superconducting electrodes. When the whole junction area was illuminated at λ = 800 nm, we observe a reduction in the normal resistance due to an increase in the sheet carrier density of the 2DEG, and the enhancement of the Andreev reflection probability. To reveal its origin, we performed scanning photo-voltage measurement by employing an optical microscope. The obtained image plots show maxima and minima of the photo-voltage change along the S-Sm interfaces. Those structures are considered to reflect the modulation of the barrier height at S-Sm interface and the increase in the scattering by photo-generated carriers. It is demonstrated that the scanning photo-voltage measurement is one of the most powerful tools as a local probe of the transport properties of S-Sm-S junctions.
The direct limit on the Higgs Mass and the SM Fit
International Nuclear Information System (INIS)
Chanowitz, Michael S.
2003-01-01
Because of two 3σ anomalies, the Standard Model (SM) fit of the precision electroweak data has a poor confidence level, CL = 0.02. Since both anomalies involve challenging systematic issues, it might appear that the SM could still be valid if the anomalies resulted from underestimated systematic error. Indeed the CL of the global fit could then increase to 0.71, but that fit predicts a small Higgs boson mass, m H = 45 GeV, that is inconsistent at 95% CL with the lower limit, m H > 114 GeV, established by direct searches. The data then favor new physics whether the anomalous measurements are excluded from the fit or not, and the Higgs boson mass cannot be predicted until the new physics is understood. Some measure of statistical fluctuation would be needed to maintain the validity of the SM. New physics is favored, but the SM is not definitively excluded
Subcoulomb fusion of 16O in odd Sm isotopes
International Nuclear Information System (INIS)
Pacheco, A.J.
1989-01-01
Cross sections for the formation of evaporation residues were measured for the reaction of 16 O with the odd 147 Sm and 149 Sm nuclei at near barrier energies. The results are well described by statistical model calculations. Fusion cross sections as a function of energy do not show any unusual behaviour that could be attributed to the presence of unpaired nucleons. An analysis based on a one-dimensional penetration model that includes the effect of permanent quadrupolar deformations shows that the extracted values of the parameter β 2 follow the systematics established by the rest of the even samarium isotopes. The dependence of β 2 on the mass of the target nucleus indicates that the influence exerted by collective aspects upon the subbarrier fusion process increases rapidly as a function of the number of neutrons added to the spherical semimagic 144 Sm nucleus. (Author) [es
Final review of the Campbell Creek demonstrations showcased by Tennessee Valley Authority
Energy Technology Data Exchange (ETDEWEB)
Gehl, Anthony C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Munk, Jeffrey D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jackson, Roderick K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boudreaux, Philip R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Miller, William A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); New, Joshua Ryan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Khowailed, Giannate [SRA International, Fairfax, VA (United States)
2015-06-01
The Tennessee Valley Authority (TVA) Technology Innovation, Energy Efficiency, Power Delivery and Utilization Office funded and managed a showcase demonstration located in the suburbs of west Knox county, Tennessee. Work started March 2008 with the goal of documenting best practices for retrofitting existing homes and for building new high-efficiency homes. The Oak Ridge National Laboratory and the Electric Power Research Institute (EPRI) provided technical support. An analytical base was developed for helping homeowners, homebuyers, builders, practitioners and the TVA make informed economic decisions for the materials and incentives necessary to build a new high-efficiency home or retrofit an existing home. New approaches to more efficiently control active energy subsystems and information for selecting or upgrading to Energy Star appliances, changing all lights to 100% CFL s and upgrading windows to low-E gas filled glazing yields a 40% energy savings with neutral cash flow for the homeowner. Passive designs were reviewed and recommendations made for envelope construction that is durable and energy efficient. The Campbell Creek project complements the DOE Building Technologies Program strategic goal. Results of the project created technologies and design approaches that will yield affordable energy efficient homes. The 2010 DOE retrofit goals are to find retrofit packages that attain 30% whole house energy savings as documented by pre and post Home Energy rating scores (HERS). Campbell Creek met these goals.
Modified chemical synthesis of porous α-Sm{sub 2}S{sub 3} thin films
Energy Technology Data Exchange (ETDEWEB)
Kumbhar, V.S.; Jagadale, A.D. [Thin Film Physics Laboratory, Department of Physics, Shivaji University, Kolhapur, (M.S.) 416004 (India); Gaikwad, N.S. [Rayat Shikshan Sanstha, Satara, (M.S.) 415 001 (India); Lokhande, C.D., E-mail: l_chandrakant@yahoo.com [Thin Film Physics Laboratory, Department of Physics, Shivaji University, Kolhapur, (M.S.) 416004 (India)
2014-08-15
Highlights: • A novel chemical route to prepare α-Sm{sub 2}S{sub 3} thin films. • A porous honeycomb like morphology of the α-Sm{sub 2}S{sub 3} thin film. • An application of α-Sm{sub 2}S{sub 3} thin film toward its supercapacitive behaviour. - Abstract: The paper reports synthesis of porous α-Sm{sub 2}S{sub 3} thin films using modified chemical synthesis, also known as successive ionic layer adsorption and reaction (SILAR) method. The X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), scanning electron microscopy (SEM), atomic force microscopy (AFM), wettability and ultraviolet–visible spectroscopy (UV–vis) techniques are used for the study of structural, elemental, morphological and optical properties of α-Sm{sub 2}S{sub 3} films. An orthorhombic crystal structure of α-Sm{sub 2}S{sub 3} is resulted from XRD study. The SEM and AFM observations showed highly porous α-Sm{sub 2}S{sub 3} film surface. An optical band gap of 2.50 eV is estimated from optical absorption spectrum. The porous α-Sm{sub 2}S{sub 3} thin film tuned for supercapacitive behaviour using cyclic voltammetry and galvanostatic charge discharge showed a specific capacitance and energy density of 294 Fg{sup –1} and 48.9 kW kg{sup –1}, respectively in 1 M LiClO{sub 4}–propylene carbonate electrolyte.
Formation of SmFe5(0001) ordered alloy thin films on Cu(111) single-crystal underlayers
International Nuclear Information System (INIS)
Yabuhara, Osamu; Ohtake, Mitsuru; Nukaga, Yuri; Futamoto, Masaaki; Kirino, Fumiyoshi
2010-01-01
SmFe 5 (0001) single-crystal thin films are prepared by molecular beam epitaxy employing Cu(111) single-crystal underlayers on MgO(111) substrates. The Cu atoms diffuse into the Sm-Fe layer and substitute the Fe sites in SmFe 5 structure forming an alloy compound of Sm(Fe,Cu) 5 . The Sm(Fe,Cu) 5 film is more Cu enriched with increasing the substrate temperature. The Cu underlayer plays an important role in assisting the formation of the ordered phase.
9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...
21 CFR 211.113 - Control of microbiological contamination.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...
Pataha Creek Model Watershed : January 2000-December 2002 Habitat Conservation Projects.
Energy Technology Data Exchange (ETDEWEB)
Bartels, Duane G.
2003-04-01
The projects outlined in detail on the attached project reports were implemented from calendar year 2000 through 2002 in the Pataha Creek Watershed. The Pataha Creek Watershed was selected in 1993, along with the Tucannon and Asotin Creeks, as model watersheds by NPPC. In previous years, demonstration sites using riparian fencing, off site watering facilities, tree and shrub plantings and upland conservation practices were used for information and education and were the main focus of the implementation phase of the watershed plan. These practices were the main focus of the watershed plan to reduce the majority of the sediment entering the stream. Prior to 2000, several bank stabilization projects were installed but the installation costs became prohibitive and these types of projects were reduced in numbers over the following years. The years 2000 through 2002 were years where a focused effort was made to work on the upland conservation practices to reduce the sedimentation into Pataha Creek. Over 95% of the sediment entering the stream can be tied directly to the upland and riparian areas of the watershed. The Pataha Creek has steelhead in the upper reaches and native and planted rainbow trout in the mid to upper portion. Suckers, pikeminow and shiners inhabit the lower portion because of the higher water temperatures and lack of vegetation. The improvement of riparian habitat will improve habitat for the desired fish species. The lower portion of the Pataha Creek could eventually develop into spawning and rearing habitat for chinook salmon if some migration barriers are removed and habitat is restored. The upland projects completed during 2000 through 2002 were practices that reduce erosion from the cropland. Three-year continuous no-till projects were finishing up and the monitoring of this particular practice is ongoing. Its direct impact on soil erosion along with the economical aspects is being studied. Other practices such as terrace, waterway, sediment
First measurement of 153Sm in the SIR
International Nuclear Information System (INIS)
Michotte, C.; Ratel, G.; Lucas, L.
1999-01-01
In June 1998, the NIST sent to the International Reference System (SIR) a solution of 153 Sm standardized in a 4π ionization chamber. As this radionuclide had not previously been measured in the SIR, the resulting equivalent activity A e,NIST is compared with the value calculated from the efficiency curve of the SIR. However, problems occurred owing to the presence of 154 Eu and 156 Eu impurities in the solution. The manner in which the final equivalent activity value for this solution of 153 Sm has been deduced is described in this report. (authors)
The neutron EDM in the SM: a review
International Nuclear Information System (INIS)
Dar, Shahida
2000-08-01
We review the status of the electric dipole moment (EDM) of neutron in the Standard Model (SM). The contributions of the strong and electroweak interactions are discussed separately. In each case the structure of Lagrangian and the sources of CP violation are specified, and subsequently calculational details are given. These two contributions to the neutron EDM exist in any extension of the SM including supersymmetry, two-doublet models as well as models with more than three generations of fermions. We briefly discuss the status of the neutron EDM in such extensions and give the relevant literature. (author)
International Nuclear Information System (INIS)
Saraswathy, P.; Mehra, K.S.; Ranganatha, D.K.; Das, M.K.; Balasubramanian, P.S.; Ananthakrishnan, M.; Ramamoorthy, N.; Gunasekaran, S.; Shanthly, N.; Retna Ponmalar, J.; Narasimhan, S.
2001-01-01
The combination of ease of formulation and superior biological features of 153 Sm-EDTMP in terms of safety and efficacy for metastatic bone pain palliation, together with the prospect of better logistics of production, has prompted extensive efforts by many groups world over for its preparation and evaluation. Our efforts have been directed towards exploring the feasibility for formulation of 153 Sm-EDTMP suitable for human use by neutron activation in medium flux reactors of the freely available and inexpensive natural samarium oxide target. The emphasis in biological studies was placed on tests in larger animals (monkeys) as a prelude to clinical evaluation. Feasibility to achieve reasonably high specific activity of 300-700 mCi/mg Sm at EOB with natural samarium has been adequately demonstrated. The radioeuropium contamination, estimated by γ-spectrometry to be 153 Sm-EDTMP from natural samarium at high radioactive concentrations of 40-50 mCi 153 Sm/mL, acceptable biolocalization, as revealed by both biodistribution studies in rats (femur uptake of 2-3% injected dose at 1h p.i. and retention up to 120 h p.i.) and gamma camera images in monkeys and adequate stability have been feasible. Excellent quality bone images of monkeys were recorded showing rapid clearance from blood, visualization of skeleton, clearance from kidneys within 2 hours and retention in skeleton up to 116 hours p.i. No significant activity in other soft tissues was noted. Comparative evaluation of the product prepared from enriched samarium as well as using in-house synthesized EDTMP has, likewise, revealed identical biolocalization features. EDTMP dose tolerance test in mice showed a safety factor of about 100 for a product made from natural samarium at an adult human dose of 50 mCi 153 Sm. Feasibility for production, reasonable safety and satisfactory biolocalisation of the indigenous product has been adequately established so as to warrant clinical trials in patients. (author)
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.
1978-05-01
The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es
Tidal mixing in Dahej creek waters
Digital Repository Service at National Institute of Oceanography (India)
Swamy, G.N.; Sarma, R.V.
Mixing characteristics of a tidal inlet near Dahej at the mouth of Narmada River, Gujarat, India are examined in terms of tides, currents and bathymetry. The dilution potential of the Dahej Creek waters during a tidal march for a given rate...
Geochemical survey of stream sediments of the Piceance Creek Basin, Colorado
Energy Technology Data Exchange (ETDEWEB)
Ringrose, C.D.
1977-01-01
A stream sediment survey was conducted in the Piceance Creek Basin to study the spatial distribution of Zn, Mo, Hg, Cd and As for future baseline considerations. The pH and organic matter were also measured. From samples taken at the mouths (junctions) of most of the named creeks in the basin, it is concluded that none of the streams contained sediments with anomalous trace element concentrations with respect to the basin. But it is thought that Mo and possibly As could be potentially toxic because of their abundance and their mobility under the stream sediments' alkaline condition. From a different sampling plan, designed to describe the background variance of five streams (Roan, Black Sulfur, Parachute, Yellow and Piceance Creeks), it was found that most of the variance occurred at distances from 0-10 m within 2 km stream segments 10 km apart for Mo, Hg, Az, and organic matter. When the variance between the five streams was considered, it was found to dominate the variances of the other factors for Mo, Hg, and Zn. This variance between streams is actually thought to represent the variance between the major drainage system in the basin. When comparison is made between the two sampling design results, it is thought that the trace element concentrations of stream junction samples represented the best range of expected values for the entire basin. The expected ranges of the trace elements from the nested design are thought to be reasonable estimates of preliminary baselines for Parachute Creek, Roan Creek and Black Sulfur Creek within the restricted limits of the streams defined in the text. From the experience gained in pursuing this study, it is thought that composite sampling should be considered, where feasible, to reduce the analytical load and to reduce the small scale variance.
2011-10-11
... environmental analyses for proposed mining Plans in the portions of the Granite Creek Watershed under their... Granite Creek Watershed Mining Plans analysis area that meets the Purpose of and Need for Action. It is... Granite Creek Watershed Mining Plans AGENCY: Forest Service, USDA. ACTION: Notice of intent to prepare an...
Energy Technology Data Exchange (ETDEWEB)
Xu, M.L.; Wu, Q.; Li, Y.Q.; Liu, W.Q.; Lu, Q.M.; Yue, M., E-mail: yueming@bjut.edu.cn
2015-08-01
The microstructure, crystal structure and magnetic properties were studied for Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes prepared by surfactant-assisted high-energy ball milling (SAHEBM). Effect of ball-milling time on the c-axis crystallographic alignment, morphology and magnetic properties of Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes was systematically investigated. With increasing milling time from 1 h to 7 h, the intensity ratio between (002) and (111) reflection peaks indicating degree of c-axis crystal texture of the (Sm, Pr)Co{sub 5} phase increases first, peaks at 3 h, then drops again, revealing that the strongest c-axis crystal texture was obtained in the nanoflakes milled for 3 h. On the other hand, the coercivity (H{sub ci}) of the flakes increases gradually from 1.71 to 14.65 kOe with the increase of ball milling time. As a result, an optimal magnetic properties of M{sub r} of 10.23 kGs, H{sub ci} of 11.45 kOe and (BH){sub max} of 24.40 MGOe was obtained in Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes milled for 3 h, which also displayed a high aspect ratio, small in-plane size, pronounced (001) out-of-plane texture. - Highlights: • Anisotropic Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes with strong c-axis texture were prepared. • Effects of ball-milling time on structure and magnetic properties were studied. • (BH){sub max} value of Sm{sub 0.6}Pr{sub 0.4}Co{sub 5} nanoflakes is larger than that of SmCo{sub 5} nanoflakes.
9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...
9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...
9 CFR 113.206 - Wart Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...
Sm-Nd isotope system of oldest granulites of Anabar Shield
International Nuclear Information System (INIS)
Spiridonov, V.G.; Sukhanov, M.K.; Karpenko, S.F.; Lyalikov, A.V.; AN SSSR, Moscow
1991-01-01
The first results of applying Sm-Nd method for dating the oldest basic and ultrabasic rocks of the Anabar Shield are presented. The content and isotopic composition of Sm and Nd were determined by the methods of mass-spectroscopy with isotopic dilution. The obtained values of metamorphic ages (3063 ± 80 million years) are in good agreement with U-Pb method data for zircon
International Nuclear Information System (INIS)
Hess, N.J.; Schiferl, D.
1990-01-01
The inability to measure pressure with accuracy at high temperature has been a hindrance to the development of simultaneous high-temperature, high-pressure experimental techniques. The results of recent laser-induced fluorescence studies at high temperature and high pressure indicate that Sm:YAG is a promising pressure calibrant with very low-temperature sensitivity. The most intense feature in the fluorescence spectrum is a doublet at 16186.5 cm -1 . The Sm:YAG doublet exhibits a pressure-induced peak shift comparable to the R 1 shift of ruby. However, the temperature-induced shift of the doublet is almost two orders of magnitude less than that observed for the R 1 peak. Simultaneous high-pressure-temperature experiments indicate that the pressure and temperature effects on the frequency and line shape can be added linearly. An empirical model based on the linear combination of pressure dependent frequency shift and temperature dependent linewidth and intensity ratio successfully predicts the doublet line shape at simultaneous pressure and temperature. Use of the model facilitates measurement of peak position at high temperature resulting in improved accuracy and repeatability of the pressure determination. Pressure measurements at 400 degree C and 40 kbar based on the Sm:YAG doublet peak position agree with the temperature-corrected ruby R 1 pressure measurement to within 3 kbar. At 15 kbar and 900 degree C the uncertainty in the Sm:YAG fluorescence peak wavelength is 5 cm -1 due to temperature-induced line broadening; this corresponds to an uncertainty in the pressure determination of ±2.5 kbar. The high thermal and chemical stability of YAG materials make Sm:YAG an ideal pressure calibrant for high-temperature applications
Koster, Randal D.; Reichle, Rolf H.; De Lannoy, Gabrielle J. M.; Liu, Qing; Colliander, Andreas; Conaty, Austin; Jackson, Thomas; Kimball, John
2015-01-01
During the post-launch SMAP calibration and validation (Cal/Val) phase there are two objectives for each science data product team: 1) calibrate, verify, and improve the performance of the science algorithm, and 2) validate the accuracy of the science data product as specified in the science requirements and according to the Cal/Val schedule. This report provides an assessment of the SMAP Level 4 Surface and Root Zone Soil Moisture Passive (L4_SM) product specifically for the product's public beta release scheduled for 30 October 2015. The primary objective of the beta release is to allow users to familiarize themselves with the data product before the validated product becomes available. The beta release also allows users to conduct their own assessment of the data and to provide feedback to the L4_SM science data product team. The assessment of the L4_SM data product includes comparisons of SMAP L4_SM soil moisture estimates with in situ soil moisture observations from core validation sites and sparse networks. The assessment further includes a global evaluation of the internal diagnostics from the ensemble-based data assimilation system that is used to generate the L4_SM product. This evaluation focuses on the statistics of the observation-minus-forecast (O-F) residuals and the analysis increments. Together, the core validation site comparisons and the statistics of the assimilation diagnostics are considered primary validation methodologies for the L4_SM product. Comparisons against in situ measurements from regional-scale sparse networks are considered a secondary validation methodology because such in situ measurements are subject to upscaling errors from the point-scale to the grid cell scale of the data product. Based on the limited set of core validation sites, the assessment presented here meets the criteria established by the Committee on Earth Observing Satellites for Stage 1 validation and supports the beta release of the data. The validation against
Miller, Todd S.; Bugliosi, Edward F.; Reddy, James E.
2008-01-01
The Meads Creek valley encompasses 70 square miles of predominantly forested uplands in the upper Susquehanna River drainage basin. The valley, which was listed as a Priority Waterbody by the New York State Department of Environmental Conservation in 2004, is prone to periodic flooding, mostly in its downstream end, where development is occurring most rapidly. Hydraulic characteristics of the unconsolidated valley-fill aquifer were evaluated, and seepage rates in losing and gaining tributaries were calculated or estimated, in an effort to delineate the aquifer geometry and identify the factors that contribute to flooding. Results indicated that (1) Meads Creek gained about 61 cubic feet of flow per second (about 6.0 cubic feet per second per mile of stream channel) from ground-water discharge and inflow from tributaries in its 10.2-mile reach between the northernmost and southernmost measurement sites; (2) major tributaries in the northern part of the valley are not significant sources of recharge to the aquifer; and (3) major tributaries in the central and southern part of the valley provide recharge to the aquifer. The ground-water portion of streamflow in Meads Creek (excluding tributary inflow) was 11.3 cubic feet per second (ft3/s) in the central part of the valley and 17.2 ft3/s in the southern part - a total of 28.5 ft3/s. Ground-water levels were measured in 29 wells finished in unconfined deposits for construction of a potentiometric-surface map to depict directions of ground-water flow within the valley. In general, ground water flows from the edges of the valley toward Meads Creek and ultimately discharges to it. The horizontal hydraulic gradient for the entire 12-mile-long aquifer averages about 30 feet per mile, whereas the gradient in the southern fourth of the valley averages about half that - about 17 feet per mile. A water budget for the aquifer indicated that 28 percent of recharge was derived from precipitation that falls on the aquifer, 32
Microstructure and corrosion resistance of Sm-containing Al-Mn-Si-Fe-Cu alloy
Directory of Open Access Journals (Sweden)
Han Yuyin
2017-12-01
Full Text Available Optimizing alloy composition is an effective way to improve physical and chemical properties of automobile heat exchanger materials.A Sm-containing Al-Mn-Si-Fe-Cu alloy was investigated through transmission electron microscopy,scanning electron microscopy,and electrochemical measurement.Experimental results indicated that main phases distributed in the alloy wereα-Al(Mn,FeSi,Al2Sm and Al10Cu7Sm2.Alloying with Sm element could refine the precipitated α-Al(Mn,FeSi phase.Polarization testing results indicated that the corrosion surfacewas mainly composed of pitting pits and corrosion products.Sea water acetic acid test(SWAAT showed that corrosion loss increased first and then slowed downwith increase of the corrosion time.
Foraminiferal study from Kharo Creek, Kachchh (Gujarat), north west coast of India
Digital Repository Service at National Institute of Oceanography (India)
Nigam, R.; Chaturvedi, S.K.
any creek of Kachchh area will also serve as a baseline data to assess the future impact of industrial pollution (if any) as a jetty for offoading cement is being constructed in Kharo creek for proposed cement plant which is coming up in this area....
Buck Creek River Flow Analysis
Dhanapala, Yasas; George, Elizabeth; Ritter, John
2009-04-01
Buck Creek flowing through Springfield Ohio has a number of low-head dams currently in place that cause safety issues and sometimes make it impossible for recreational boaters to pass through. The safety issues include the back eddies created by the dams that are known as drowning machines and the hydraulic jumps. In this study we are modeling the flow of Buck Creek using topographical and flow data provided by the Geology Department of Wittenberg University. The flow is analyzed using Hydraulic Engineering Center - River Analysis System software (HEC-RAS). As the first step a model of the river near Snyder Park has been created with the current structure in place for validation purposes. Afterwards the low-head dam is replaced with four drop structures with V-notch overflow gates. The river bed is altered to reflect plunge pools after each drop structure. This analysis will provide insight to how the flow is going to behave after the changes are made. In addition a sediment transport analysis is also being conducted to provide information about the stability of these structures.
Discharge, sediment, and water chemistry in Clear Creek, western Nevada, water years 2013–16
Huntington, Jena M.; Riddle, Daniel J.; Paul, Angela P.
2018-05-01
Clear Creek is a small stream that drains the eastern Carson Range near Lake Tahoe, flows roughly parallel to the Highway 50 corridor, and discharges to the Carson River near Carson City, Nevada. Historical and ongoing development in the drainage basin is thought to be affecting Clear Creek and its sediment-transport characteristics. Previous studies from water years (WYs) 2004 to 2007 and from 2010 to 2012 evaluated discharge, selected water-quality parameters, and suspended-sediment concentrations, loads, and yields at three Clear Creek sampling sites. This report serves as a continuation of the data collection and analyses of the Clear Creek discharge regime and associated water-chemistry and sediment concentrations and loads during WYs 2013–16.Total annual sediment loads ranged from 870 to 5,300 tons during WYs 2004–07, from 320 to 1,770 tons during WYs 2010–12, and from 50 to 200 tons during WYs 2013–16. Ranges in annual loads during the three study periods were not significantly different; however, total loads were greater during 2004–07 than they were during 2013–16. Annual suspended-sediment loads in WYs 2013–16 showed no significant change since WYs 2010–12 at sites 1 (U.S. Geological Survey reference site 10310485; Clear Creek above Highway 50, near Spooner Summit, Nevada) or 2 (U.S. Geological Survey streamgage 10310500; Clear Creek above Highway 50, near Spooner Summit, Nevada), but significantly lower loads at site 3 (U.S. Geological Survey site 10310518; Clear Creek at Fuji Park, at Carson City, Nevada), supporting the theory of sediment deposition between sites 2 and 3 where the stream gradient becomes more gradual. Currently, a threshold discharge of about 3.3 cubic feet per second is required to mobilize streambed sediment (bedload) from site 2 in Clear Creek. Mean daily discharge was significantly lower in 2010–12 than in 2004–07 and also significantly lower in 2013–16 than in 2010–12. During this study, lower bedload, and
Road construction on Caspar Creek watersheds --- 10-year report on impact
J. S. Krammes; David M. Burns
1973-01-01
In 1960, Federal and State agencies jointly started a long-term study of the effects of logging and road building on streamflow, sedimentation, aquatic habitat, and fish populations on two watersheds of Caspar Creek, in northern California. The experimental watersheds are the North and South Forks of the Creek. The data being collected consist of continuous streamflow...
Preparation of Sm3H7 nanoparticles and their application in ammonia synthesis
International Nuclear Information System (INIS)
Liu Tong; Zhang Yaohua; Li Xingguo
2006-01-01
Sm 3 H 7 nanoparticles have been successfully produced by hydrogen plasma-metal reaction (HPMR) method, and then used to synthesize ammonia at 298 K and 1 atm. The morphologies of the Sm 3 H 7 nanoparticles before and after reaction were investigated by transmission electron microscopy, and the crystal structures at different steps by X-ray diffraction. Nessler's test was adopted to detect ammonia. It was found that the passivated Sm 3 H 7 nanoparticles possess polyhedron shape and smooth surface, with the average size of about 50 nm and the specific surface area 11.2 m 2 g -1 . It was proposed that Sm 3 H 7 nanoparticles react with oxygen and nitrogen to form ammonia, but ammonia production is not observable in the case of coarse particles. After ammonia synthesis, the morphology of Sm 3 H 7 nanoparticles changes into spongy surface and the mean particle size and specific surface area increase to 100 nm and 28.6 m 2 g -1 , respectively, due to the release of hydrogen. The hydrogen conversion percentage from samarium hydride is estimated to be 1.5%. Without O 2 , Sm 3 H 7 nanoparticles cannot react with N 2 or N 2 + H 2 at 298 K and 1 atm
9 CFR 113.209 - Rabies Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...
9 CFR 202.113 - Rule 13: Written hearing.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...
13 CFR 113.455 - Textbooks and curricular material.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...
International Nuclear Information System (INIS)
Adeniyi, A.A.; Okedeyi, O.O.
2004-01-01
A two stage sequential extraction procedure for the speciation of zinc and lead has been applied to surface water randomly collected from three sites in Abegede Creek, Ijora and Lagos. The determination of the labile and non-labile metals species was carried out by flame atomic absorption spectrophotometry (FAAS). The mean values of non-labile zinc and lead concentrations from the three sites, A, B and Care 0.54 minus plus 0.25 mg/l; 0.55 plus minus 0.26 mg/l;1.13 plus 0.76 mg/l; respectively for zinc and 0.13 plus minus 0.09 mg/l; 0.17 plus minus 0.07 mg/l;0.42 plus minus 0.23 mg/l respectively for lead. These are higher than for the labile species in the three sites;0.14 plus minus 0.07 mg/l; 0.21 plus minus 0.22 mg/l; 0.73 plus minus 0.82 mg/l, respectively for zinc and ND; 0.02 plus minus 0.04 mg/l; 0.16 plus minus 0.22 mg/l, respectively for lead. The statistical analysis of variance of the distribution of zinc and lead in the three sites were estimated at 95% confidence level. The values of metal and obtained were compared with Nigeria's background values for some rivers and the World Health Organization limits for drinking water respectively and found to be generally higher especially for lead levels. The probable sources of zinc and lead in the Creek are from natural and point sources, although there could be non-point source contributions from urban run-offs and vehicular exhaust. (author)
Results of the radiological survey at Two Mile Creek, Tonawanda, New York (TNY002)
International Nuclear Information System (INIS)
Murray, M.E.; Rodriguez, R.E.; Uziel, M.S.
1997-08-01
At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at Two Mile Creek, Tonawanda, New York. The survey was performed in November 1991 and May 1996. The purpose of the survey was to determine if radioactive materials from work performed under government contract at the Linde Air Products Division of Union Carbide Corporation, Tonawanda, New York, had been transported into the creek. The survey included a surface gamma scan in accessible areas near the creek and the collection of soil, sediment, and core samples for radionuclide analyses. Survey results indicate that no significant material originating at the Linde plant is presently in the creek. Three of the 1991 soil sample locations on the creek bank and one near the lake contained slightly elevated concentrations of 238 U with radionuclide distributions similar to that found in materials resulting from former processing activities at the Linde site
77 FR 29918 - Proposed Amendment of Class E Airspace; Battle Creek, MI
2012-05-21
... airspace is necessary to accommodate new Standard Instrument Approach Procedures (SIAP) at W. K. Kellogg.... Kellogg Airport, Battle Creek, MI. Controlled airspace is needed for the safety and management of IFR... controlled airspace at W.K. Kellogg Airport, Battle Creek, MI. Environmental Review This proposal will be...
Rapid evolution of a marsh tidal creek network in response to sea level rise.
Hughes, Z. J.; Fitzgerald, D. M.; Mahadevan, A.; Wilson, C. A.; Pennings, S. C.
2008-12-01
In the Santee River Delta (SRD), South Carolina, tidal creeks are extending rapidly onto the marsh platform. A time-series of aerial photographs establishes that these channels were initiated in the 1950's and are headward eroding at a rate of 1.9 m /yr. Short-term trends in sea level show an average relative sea level rise (RSLR) of 4.6 mm/yr over a 20-year tide gauge record from nearby Winyah Bay and Charleston Harbor (1975-1995). Longer-term (85-year) records in Charleston suggest a rate of 3.2 mm/yr. RSLR in the SRD is likely even higher as sediment cores reveal that the marsh is predominantly composed of fine-grained sediment, making it highly susceptible to compaction and subsidence. Furthermore, loss in elevation will have been exacerbated by the decrease in sediment supply due to the damming of the Santee River in 1939. The rapid rate of headward erosion indicates that the marsh platform is in disequilibrium; unable to keep pace with RSLR through accretionary processes and responding to an increased volume and frequency of inundation through the extension of the drainage network. The observed tidal creeks show no sinuosity and a distinctive morphology associated with their young age and biological mediation during their evolution. Feedbacks between tidal flow, vegetation and infauna play a strong role in the morphological development of the creeks. The creek heads are characterized by a region denuded of vegetation, the edges of which are densely populated and burrowed by Uca Pugnax (fiddler crab). Crab burrowing destabilizes sediment, destroys rooting and impacts drainage. Measured infiltration rates are three orders of magnitude higher in the burrowed regions than in a control area (1000 ml/min and 0.6 ml/min respectively). Infiltration of oxygenated water enhances decomposition of organic matter and root biomass is reduced within the creek head (marsh=4.3 kg/m3, head=0.6 kg/m3). These processes lead to the removal and collapse of the soils, producing
Site-wide remedial alternative development in Bear Creek Valley, Oak Ridge Reservation
International Nuclear Information System (INIS)
Anderson, M.
1995-07-01
This paper presents a case study of an environmental restoration project at a major mixed waste site that poses unique challenges to remediation efforts. Bear Creek Valley is located immediately west of the Y-12 Plant on the Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The Y-12 Plant was built in 1943 as part of the Manhattan Project, with its original mission being electromagnetic separation of uranium. Since being completed, the Y-12 Plant has also been used for chemical processing of uranium and lithium compounds as well as precision fabrication of components containing these and other materials. Wastes containing radionuclides, metals, chlorinated solvents, oils, coolants, polychlorinated biphenyis (PCBs), and others were disposed of in large quantities at Bear Creek Valley as a result of manufacturing operations at the Y-12 Plant. The Bear Creek Valley feasibility study is using innovative strategies to efficiently and thoroughly consider the information available regarding Bear Creek Valley and process options that could be combined into its remedial alternatives
2010-04-01
... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...
Exopolysaccharides play a role in the swarming of the benthic bacterium Pseudoalteromonas sp. SM9913
Directory of Open Access Journals (Sweden)
Ang eLiu
2016-04-01
Full Text Available Most marine bacteria secrete exopolysaccharide (EPS, which is important for bacterial survival in the marine environment. However, it is still unclear whether the self-secreted EPS is involved in marine bacterial motility. Here we studied the role of EPS in the lateral flagella-driven swarming motility of benthic bacterium Pseudoalteromonas sp. SM9913 (SM9913 by a comparison of wild SM9913 and ΔepsT, an EPS synthesis defective mutant. Reduction of EPS production in ΔepsT did not affect the growth rate or the swimming motility, but significantly decreased the swarming motility on a swarming plate, suggesting that the EPS may play a role in SM9913 swarming. However, the expression and assembly of lateral flagella in ΔepsT were not affected. Instead, ΔepsT had a different swarming behavior from wild SM9913. The swarming of ΔepsT did not have an obvious rapid swarming period, and its rate became much lower than that of wild SM9913 after 35 h incubation. An addition of surfactin or SM9913 EPS on the surface of the swarming plate could rescue the swarming level. These results indicate that the self-secreted EPS is required for the swarming of SM9913. This study widens our understanding of the function of the EPS of benthic bacteria.
9 CFR 113.312 - Rabies Vaccine, Live Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...
9 CFR 113.38 - Guinea pig safety test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...
Jachens, Robert C.; Wentworth, Carl M.; Graymer, Russell W.; Williams, Robert; Ponce, David A.; Mankinen, Edward A.; Stephenson, William J.; Langenheim, Victoria
2017-01-01
The Evergreen basin is a 40-km-long, 8-km-wide Cenozoic sedimentary basin that lies mostly concealed beneath the northeastern margin of the Santa Clara Valley near the south end of San Francisco Bay (California, USA). The basin is bounded on the northeast by the strike-slip Hayward fault and an approximately parallel subsurface fault that is structurally overlain by a set of west-verging reverse-oblique faults which form the present-day southeastward extension of the Hayward fault. It is bounded on the southwest by the Silver Creek fault, a largely dormant or abandoned fault that splays from the active southern Calaveras fault. We propose that the Evergreen basin formed as a strike-slip pull-apart basin in the right step from the Silver Creek fault to the Hayward fault during a time when the Silver Creek fault served as a segment of the main route by which slip was transferred from the central California San Andreas fault to the Hayward and other East Bay faults. The dimensions and shape of the Evergreen basin, together with palinspastic reconstructions of geologic and geophysical features surrounding it, suggest that during its lifetime, the Silver Creek fault transferred a significant portion of the ∼100 km of total offset accommodated by the Hayward fault, and of the 175 km of total San Andreas system offset thought to have been accommodated by the entire East Bay fault system. As shown previously, at ca. 1.5–2.5 Ma the Hayward-Calaveras connection changed from a right-step, releasing regime to a left-step, restraining regime, with the consequent effective abandonment of the Silver Creek fault. This reorganization was, perhaps, preceded by development of the previously proposed basin-bisecting Mount Misery fault, a fault that directly linked the southern end of the Hayward fault with the southern Calaveras fault during extinction of pull-apart activity. Historic seismicity indicates that slip below a depth of 5 km is mostly transferred from the Calaveras
Boateng, S.
2006-05-01
The purpose of this study was to monitor the water quality in two creeks in Northern Kentucky. These are the Banklick Creek in Kenton County and the Woolper Creek in Boone County, Kentucky. The objective was to evaluate the effect of landuse and other external factors on surface water quality. Landuse within the Banklick watershed is industrial, forest and residential (urban) whereas that of Woolper Creek is agricultural and residential (rural). Two testing sites were selected along the Banklick Creek; one site was upstream the confluence with an overflow stream from an adjacent lake; the second site was downstream the confluence. Most of the drainage into the lake is over a near-by industrial park and the urban residential areas of the cities of Elsmere and Erlanger, Kentucky. Four sampling locations were selected within the Woolper Creek watershed to evaluate the effect of channelization and subsequent sedimentation on the health of the creek. Water quality parameters tested for include dissolved oxygen, phosphates, chlorophyll, total suspended sediments (TSS), pH, oxidation reduction potential (ORP), nitrates, and electrical conductivity. Sampling and testing were conducted weekly and also immediately after storm events that occurred before the regular sampling dates. Sampling and testing proceeded over a period of 29 weeks. Biological impact was determined, only in Woolper Creek watershed, by sampling benthic macroinvertebrates once every four weeks. The results showed significant differences in the water quality between the two sites within the Banklick Creek. The water quality may be affected by the stream overflow from the dammed lake. Also, channelization in the Woolper Creek seemed to have adverse effects on the water quality. A retention pond, constructed to prevent sediments from flowing into the Woolper Creek, did not seem to be effective. This is because the water quality downstream of the retention pond was significantly worse than that of the
Functional organization of the Sm core in the crystal structure of human U1 snRNP.
Weber, Gert; Trowitzsch, Simon; Kastner, Berthold; Lührmann, Reinhard; Wahl, Markus C
2010-12-15
U1 small nuclear ribonucleoprotein (snRNP) recognizes the 5'-splice site early during spliceosome assembly. It represents a prototype spliceosomal subunit containing a paradigmatic Sm core RNP. The crystal structure of human U1 snRNP obtained from natively purified material by in situ limited proteolysis at 4.4 Å resolution reveals how the seven Sm proteins, each recognize one nucleotide of the Sm site RNA using their Sm1 and Sm2 motifs. Proteins D1 and D2 guide the snRNA into and out of the Sm ring, and proteins F and E mediate a direct interaction between the Sm site termini. Terminal extensions of proteins D1, D2 and B/B', and extended internal loops in D2 and B/B' support a four-way RNA junction and a 3'-terminal stem-loop on opposite sides of the Sm core RNP, respectively. On a higher organizational level, the core RNP presents multiple attachment sites for the U1-specific 70K protein. The intricate, multi-layered interplay of proteins and RNA rationalizes the hierarchical assembly of U snRNPs in vitro and in vivo.
UTILIZING CREEKS FOR INTEGRATED RURAL COASTAL ...
African Journals Online (AJOL)
Osondu
2013-02-09
Feb 9, 2013 ... This study examines the Utilization of Creeks for Integrated Coastal Development of Ilaje ... utilization, poor fishing techniques, poor sources of water and navigation routes, and manual ... Ethiopian Journal of Environmental Studies and Management Vol. 6 No.3 .... together, implement, monitor and evaluate.
Energy Technology Data Exchange (ETDEWEB)
Babu, P. Ramesh [Centre for Crystal Growth, VIT University, Vellore, Tamil Nadu (India); Bhaumik, Indranil [Crystal Growth Laboratory, Laser Materials Development and Devices Division, RRCAT, Indore (India); Ganesamoorthy, S. [Material Science Group, IGCAR, Kalpakkam, Tamil Nadu (India); Kalainathan, S., E-mail: kalainathan@yahoo.com [Centre for Crystal Growth, VIT University, Vellore, Tamil Nadu (India); Bhatt, R.; Karnal, A.K.; Gupta, P.K. [Crystal Growth Laboratory, Laser Materials Development and Devices Division, RRCAT, Indore (India)
2016-08-15
Single crystals of Samarium orthoferrite (SmFeO{sub 3}) have been grown by the optical floating zone technique. The growth parameters to yield good quality crystals are 5 mm/h for pulling and 30–40 rpm for rotation. The mechanical behavior of the grown crystal has been investigated. Rosette pattern has been observed around the indentation and the microhardness has been found to decreases non-linearly with the applied load. For load higher than 1.96 N there is a transition from palmqvist to median crack due to plastic deformation of the crystal. The hardness parameters like fracture toughness, brittleness index, and yield strength have also been calculated for palmqvist and median cracks occurring on the crystal surface. The magnetic investigations revealed that a magnetic transition in the range of 300–180 K. Above 180 K, the magnetization decreases as Sm and Fe sublattices have opposite spins. At high temperature, two anomalies are observed, one due to near spin reorientation (T{sub SR} = 480 K) and the other is AFM to paramagnetic transitions (T{sub N} = 670 K). The M–H curves exhibit a shape change with temperature due to the emergence and enlargement of multi-domain state of the SmFeO{sub 3} crystals. Bloch parameter (3.28 × 10{sup −5} K{sup −3/2}) has also been evaluated. - Highlights: • SmFeO{sub 3} single crystals have been grown by OFZ technique in air. • The microhardness has been found to decreases non-linearly with the applied load. • At 472 K, spin reorientation occurs in Fe sublattice. • The M–H curves exhibit a shape change with temperature due to the emergence and enlargement of multi-domain state. • Bloch 3/2-law holds good for SmFeO{sub 3} (B-parameter as 3.28 × 10{sup −5} K{sup −3/2}).
Negative pressure driven phase transformation in Sr doped SmCoO₃.
Arshad Farhan, M; Javed Akhtar, M
2010-02-24
Atomistic computer simulation techniques based on energy minimization procedures are utilized for the structural investigation of perovskite-type SmCoO(3). A reliable potential model is derived which reproduces both cubic as well as orthorhombic phases of SmCoO(3). We observe a negative chemical pressure induced structural phase transformation from distorted perovskite (orthorhombic) to perfect perovskite (cubic) due to the substitution of Sr(2 + ) at the Sm(3 + ) sites. However, external hydrostatic pressure shows isotropic compression and no pressure-induced structural transformation is observed up to 100 GPa. To maintain the electroneutrality of the system, charge compensation is through oxygen vacancies which results in the brownmillerite-type structure. A defect model is proposed, which is consistent with experimental results. The solution energies for divalent and trivalent cations are also calculated. These results show that the cations having ionic radii less than 0.75 Å will occupy the Co sites and those with ionic radii larger than 0.75 Å will substitute at the Sm sites.
Regulatory compliance issues related to the White Oak Creek Embayment time-critical removal action
International Nuclear Information System (INIS)
Leslie, M.; Kimmel, B.L.
1991-01-01
In September 1990, Martin Marietta Energy Systems (Energy Systems) discovered high levels of Cesium-137 ( 137 Cs) in surface sedimenus near the mouth of White Oak Creek Embayment (WOCE). White Oak Creek (WOC) receives surface water drainage from Oak Ridge National Laboratory. Since this discovery, the Department of Energy (DOE) and Energy Systems have pursued actions designed to stabilize the contaminated WOCE sediments under provisions of the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA), and the implementing regulations in the National Contingency Plan (NCP) (40 CFR Part 300), as a time-critical removal action. By definition, a time-critical removal is an action where onsite activities are initiated within six months of the determination that a removal action is appropriate. Time-critical removal actions allow comparatively rapid mobilization to protect human health and the environment without going through the lengthy and extensive CERCLA Remedial Investigation/Feasibility Study/Record of Decision process. Many aspects of the project, in terms of compliance with the substantive requirements of the NCP and ARARs, have exceeded the regulatory requirements, despite the fact that there is no apparent authority on conducting removal actions at Federal facilities. Much of the interpretation of the NCP was groundbreaking in nature for both EPA and DOE. 4 refs., 2 figs
Multiple magnetic transitions in SmCoAsO
Directory of Open Access Journals (Sweden)
Yongliang Chen
2011-12-01
Full Text Available The magnetic properties of SmCoAsO have been investigated. Our results differ from early observations. Complicated magnetism consists of antiferromagnetic, ferromagnetic, ferrimagnetic and paramagnetic, even diamagnetism at low field has been observed. A metamagnetic transition was observed, resulting from a canting of the spins. The interaction between two Co sublattices with canted-structure might take responsibility for the multiple magnetic transitions. Electrical resistivity data indicate that SmCoAsO is metallic conductor with room temperature resistivity of 0.51669 mΩ-cm. Negative magnetoresistance effect suggests a significant suppression of spin-flip scattering by the applied magnetic field. The magnetic phase diagram has been established.
Baruch Institute for Marine and Coastal Sciences, Univ of South Carolina — A group of eight intertidal creeks with high densities of oysters, Crassostrea virginica, in North Inlet Estuary, South Carolina, USA were studied using a replicated...
Energy Technology Data Exchange (ETDEWEB)
Silva, M.A. da; Suzuki, M.F.; Rogero, J.R.; Okazaki, K. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil); Guimaraes, M.I.C.C.; Buchpiguel, C.A. [Sao Paulo Univ., SP (Brazil). Faculdade de Medicina. Centro de Medicina Nuclear
2002-07-01
The {sup 153} Sm-EDTMP is a radiopharmaceutical used in nuclear medicine with promising results for the relief of metastatic pain. Therefore, there are few knowledge about the effects of {sup 153} Sm-EDTMP at cellular level. The present study was conducted with the aim of evaluating the cytogenetic effects of {sup 153} Sm-EDTMP in peripheral lymphocytes from patients with bone metastasis (with and without previous radio and/or chemotherapy) by the chromosome aberration technique. For that, the blood samples were collected before and one hour after the endovenous administrations of {sup 153} Sm-EDTMP (mean activity of 42.53 {+-} 5.31 MBq/kg body weight), taking into account the rapid blood clearance. The principal types of structural chromosome aberrations found gaps and breaks, acentric fragments centric rings, double minutes and dicentrics. The statistical analysis showed that the group submitted to previous radio and chemotherapy before{sup 153} Sm-EDTMP administration showed significant difference in chromosome aberrations frequency one hour after the treatment. The analysis of the chromosome modal number and the kinetics of cellular cycle showed no statistical difference among the groups, suggesting that the treatment with {sup 153} Sm-EDTMP, did not influence these parameters. The obtained data showed that the therapy with {sup 153} Sm-EDTMP induced a few quantity of cytogenetic damages in peripheral lymphocytes one hour after its administration in patients, although, theoretically, a long term stochastic effect cannot be disregarded. (author)
Vazquez, Jorge A.; Lidzbarski, Marsha I.
2012-12-01
Sediments of the Wilson Creek Formation surrounding Mono Lake preserve a high-resolution archive of glacial and pluvial responses along the eastern Sierra Nevada due to late Pleistocene climate change. An absolute chronology for the Wilson Creek stratigraphy is critical for correlating the paleoclimate record to other archives in the western U.S. and the North Atlantic region. However, multiple attempts to date the Wilson Creek stratigraphy using carbonates and tephras yield discordant results due to open-system effects and radiocarbon reservoir uncertainties as well as abundant xenocrysts. New ion microprobe 238U-230Th dating of the final increments of crystallization recorded by allanite and zircon autocrysts from juvenile pyroclasts yield ages that effectively date eruption of key tephra beds and delimit the timing of basal Wilson Creek sedimentation to the interval between 26.8±2.1 and 61.7±1.9 ka. Tephra (Ash 15) erupted during the geomagnetic excursion originally designated the Mono Lake excursion yields an age of 40.8±1.9 ka, indicating that the event is instead the Laschamp excursion. The new ages support a depositional chronology from magnetostratigraphy that indicates quasi-synchronous glacial and hydrologic responses in the Sierra Nevada and Mono Basin to regional climate change, with intervals of lake filling and glacial-snowpack melting that are in phase with peaks in spring insolation.
Vazquez, Jorge A.; Lidzbarski, Marsha I.
2012-01-01
Sediments of the Wilson Creek Formation surrounding Mono Lake preserve a high-resolution archive of glacial and pluvial responses along the eastern Sierra Nevada due to late Pleistocene climate change. An absolute chronology for the Wilson Creek stratigraphy is critical for correlating the paleoclimate record to other archives in the western U.S. and the North Atlantic region. However, multiple attempts to date the Wilson Creek stratigraphy using carbonates and tephras yield discordant results due to open-system effects and radiocarbon reservoir uncertainties as well as abundant xenocrysts. New ion microprobe 238U-230Th dating of the final increments of crystallization recorded by allanite and zircon autocrysts from juvenile pyroclasts yield ages that effectively date eruption of key tephra beds and delimit the timing of basal Wilson Creek sedimentation to the interval between 26.8±2.1 and 61.7±1.9 ka. Tephra (Ash 15) erupted during the geomagnetic excursion originally designated the Mono Lake excursion yields an age of 40.8±1.9 ka, indicating that the event is instead the Laschamp excursion. The new ages support a depositional chronology from magnetostratigraphy that indicates quasi-synchronous glacial and hydrologic responses in the Sierra Nevada and Mono Basin to regional climate change, with intervals of lake filling and glacial-snowpack melting that are in phase with peaks in spring insolation.
Multifunctional Sm2-xDyxZr2O7 pyrochlore system: potential ionic conductors and photocatalysts
International Nuclear Information System (INIS)
Grover, V.; Sayed, Farheen N.; Bhattacharyya, K.; Jain, D.; Pillai, C.G.S.; Tyagi, A.K.; Arya, A.
2010-01-01
Full text: Pyrochlores have garnered considerable interest over the years because of a range of potentially useful properties such as fast-ion (mainly anion) conductivity, electrical conductivity, catalysis, luminescence etc. In present work a series of Sm 2-x Dy x Zr 2 O 7 compounds (0.0 ≤ x ≤ 2.0) were synthesized by gel combustion and characterized by Powder XRD and Raman spectroscopic studies. XRD studies revealed the system to be single-phasic throughout with the retention of pyrochlore phase till 40 mol% of Dy 3+ beyond which, an order-disorder phase transition occurred resulting in a defect fluorite structure. Surprisingly, Raman studies showed the retention of pyrochlore type ordering till the other end member, i.e. Dy 2 Zr 2 O 7 . This is the first study, which reports the retention of a weak pyrochlore type superstructure in Dy 2 Zr 2 O 7 system. Ionic conductivity measurements were performed on these samples, which showed that the activation Energy (E a ) increases with increase in Dy 3+ mol% owing to the decreased mobility with increasing degree of disorder. The representative nquist Plots are given for Sm 2 Zr 2 O 7 . These materials have a definite band gap absorbing mainly in the UV region which makes them good candidates for photocatalysed dye degradation studies. Potential of some of these compositions as photocatalysts was also explored and they were found to efficiently catalyse the degradation of Xylenol Orange with t 1/2 decreasing from pure Sm 2 Zr 2 O 7 to pure Dy 2 Zr 2 O 7
Voigt, Oliver; Herzog, Britta; Jakobshagen, Antonia; Pöggeler, Stefanie
2014-01-01
Autophagy is a tightly controlled degradation process of all eukaryotes. It includes the sequestration of cytoplasmic contents and organelles within a double-membraned autophagosome. Autophagy involves core autophagy related (atg) genes as well as genes regulating vesicle trafficking. Previously, we analyzed the impact of proteins of the core autophagic machinery SmATG7, SmATG8 and SmATG4 on the sexual and vegetative development of the filamentous ascomycete Sordaria macrospora. While deletion of Smatg8 and Smatg4 abolished fruiting-body formation and impaired vegetative growth, Smatg7 is required for viability. In yeast, the phosphatidylinositol 3-kinase vacuolar protein sorting 34 (Vps34) and its myristoylated membrane targeting unit, the protein kinase Vps15 have been shown to be important regulators of autophagy and vacuolar protein sorting. However, their exact role in filamentous ascomycetes remains elusive. To determine the function of Smvps34 and Smvps15 we isolated genes with high sequence similarity to Saccharomyces cerevisiae VPS34 and VPS15. For both genes we were not able to generate a homokaryotic knockout mutant in S. macrospora, suggesting that Smvps34 and Smvps15 are required for viability. Furthermore, we analyzed the repertoire of vps genes encoded by S. macrospora and could identify putative homologs of nearly all of the 61 VPS genes of S. cerevisiae. Copyright © 2013 Elsevier GmbH. All rights reserved.
Some Physicochemical Charateristics of Badagry Creek, Nigeria ...
African Journals Online (AJOL)
West African Journal of Applied Ecology ... Badagry Creek runs through Nigeria and Republic of Benin with access to the Atlantic Ocean. ... Colour, surface temperature, pH, salinity, turbidity, phenol, dissolved oxygen, biological oxygen ...
2010-03-01
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 606-027-CA] Kilarc-Cow... of license for the Kilarc-Cow Creek Hydroelectric Project, FERC No. 606. The project contains two developments and is located on Old Cow Creek and South Cow Creek in Shasta County, northern California. In the...
Complexes of Sm(III) and Dy(III) with piperazines
Energy Technology Data Exchange (ETDEWEB)
Manhas, B S; Trikha, A K [Punjabi Univ., Patiala (India). Dept. of Chemistry; Singh, M [Guru Nanak Dev Univ., Amritsar (India). Dept. of Chemistry
1981-09-01
Complexes of SmCl/sub 3/, DyCl/sub 3/, Sm(NO/sub 3/)/sub 3/ and Dy(NO/sub 3/) with piperazine, N-methylpiperazine, 2-methylpiperazine, N-phenyl-piperazine and N, N'-dimethyl-piperazine have been prepared and characterized on the basis of elemental analyses, IR and electronic reflectance spectra and magnetic susceptibility measurements. IR data indicate that the ligands are coordinated in the chair conformation giving polymeric bridged complexes and that the nitrate group is bidentate. Coordination numbers from 6 to 12 are proposed for the lanthanide ions.
49 CFR 215.113 - Defective plain bearing wedge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...
19 CFR 113.55 - Cancellation of export bonds.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...
Continuous fission-product monitor system at Oyster Creek. Final report
International Nuclear Information System (INIS)
Collins, L.L.; Chulick, E.T.
1980-10-01
A continuous on-line fission product monitor has been installed at the Oyster Creek Nuclear Generating Station, Forked River, New Jersey. The on-line monitor is a minicomputer-controlled high-resolution gamma-ray spectrometer system. An intrinsic Ge detector scans a collimated sample line of coolant from one of the plant's recirculation loops. The minicomputer is a Nuclear Data 6620 system. Data were accumulated for the period from April 1979 through January 1980, the end of cycle 8 for the Oyster Creek plant. Accumulated spectra, an average of three a day, were stored on magnetic disk and subsequently analyzed for fisson products, Because of difficulties in measuring absolute detector efficiency, quantitative fission product concentrations in the coolant could not be determined. Data for iodine fission products are reported as a function of time. The data indicate the existence of fuel defects in the Oyster Creek core during cycle 8
International Nuclear Information System (INIS)
Lu Pingping; Meng Zhiyun; Dou Guifang; Wu Yingliang; Wang Minwei
2008-01-01
To investigate the bioactivity and application of 125 I labeled human mouse chimeric monoclonal SM03, SM03 was labeled with 125 I using Indogen method. The labeled mixture was purified by Sephacryl S-300 HR separation chromospectry. The purity and concentration of separated fractions were determined by HPLC and Protein Assay Kit, respectively. Competitive binding method and ELISA method were used for bioactivity assays. 125 I-SM03 was applied to screen cell lines which express the most abundant CD22 antigen. The purity and recovery of 125 I-SM03 were >99% and >47%, respectively. The bioactivity of 125 I- SM03 and SM03 hasn't significant difference in statistics. Ramos cell line had the strongest special radioactivity when 125 I-SM03 bound with in Raji, Daudi and Ramos cell lines. Indogen method is a good way to label Human mouse chimeric anti-CD22 monoclonal antibody SM03 and the label will not affect the activity of SM03. The 125 I-SM03 not only can be used for detect agent, but also may be put into market for NHL therapy. (authors)
Phase evolution and its effects on the magnetic performance of nanocrystalline SmCo7 alloy
International Nuclear Information System (INIS)
Zhang Zhexu; Song Xiaoyan; Xu Wenwu
2011-01-01
The evolution of the phase constitution and the microstructure, as well as their effects on magnetic performance, were investigated systematically using a prepared nanocrystalline single-phase SmCo 7 alloy as the starting material for a series of annealing processes. The SmCo 7 (1:7 H) phase was discovered to have a good single-phase stability from room temperature up to 600 deg. C. The destabilization of the SmCo 7 phase results in the formation of the Sm 2 Co 17 (2:17 R) and SmCo 5 (1:5 H) phases, which exist as phase-transformation twins and particulate precipitates, respectively, with a completely coherent relationship with the 1:7 H parent phase. For the first time the formation mechanism of the 2:17 R phase-transformation twins has been proposed, in which the ordered substitution of 1/3 of the Sm atoms by Co-Co dumbbell pairs along two particular crystal directions was demonstrated. The characteristic width values of the 2:17 R phase-transformation twins, as deduced from this model of the mechanism, were unambiguously verified by the experimental results. Among the SmCo 7 alloys with various phase constitutions and microstructures, the best magnetic properties were obtained in the nanocrystalline 1:7 H single-phase alloys. The present work may promote a new understanding of nanoscale-stabilized single-phase SmCo 7 and its potential applications as unique high-temperature permanent magnets.
Study on irradiation conditions of producing 153Sm with natural abundance samarium target
International Nuclear Information System (INIS)
Du Jin; Jin Xiaohai; Bai Hongsheng; Liu Yuemin; Chen Daming; Wang Fan
1998-01-01
Irradiation conditions of natural abundance 152 Sm targets in different forms are studied in the heavy water reactor and the light water swimming pool reactor at the China Institute of Atomic Energy. The result shows that the specific activity of 153 Sm in liquid form target irradiated in the light water swimming pool reactor is two times greater than that in solid form target. The radionuclide purity of 153 Sm is more than 99%, which can meet the needs of clinical application