WorldWideScience

Sample records for cottonwood populus trichocarpa

  1. Evolutionary Quantitative Genomics of Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Ilga Porth

    Full Text Available Forest trees generally show high levels of local adaptation and efforts focusing on understanding adaptation to climate will be crucial for species survival and management. Here, we address fundamental questions regarding the molecular basis of adaptation in undomesticated forest tree populations to past climatic environments by employing an integrative quantitative genetics and landscape genomics approach. Using this comprehensive approach, we studied the molecular basis of climate adaptation in 433 Populus trichocarpa (black cottonwood genotypes originating across western North America. Variation in 74 field-assessed traits (growth, ecophysiology, phenology, leaf stomata, wood, and disease resistance was investigated for signatures of selection (comparing QST-FST using clustering of individuals by climate of origin (temperature and precipitation. 29,354 SNPs were investigated employing three different outlier detection methods and marker-inferred relatedness was estimated to obtain the narrow-sense estimate of population differentiation in wild populations. In addition, we compared our results with previously assessed selection of candidate SNPs using the 25 topographical units (drainages across the P. trichocarpa sampling range as population groupings. Narrow-sense QST for 53% of distinct field traits was significantly divergent from expectations of neutrality (indicating adaptive trait variation; 2,855 SNPs showed signals of diversifying selection and of these, 118 SNPs (within 81 genes were associated with adaptive traits (based on significant QST. Many SNPs were putatively pleiotropic for functionally uncorrelated adaptive traits, such as autumn phenology, height, and disease resistance. Evolutionary quantitative genomics in P. trichocarpa provides an enhanced understanding regarding the molecular basis of climate-driven selection in forest trees and we highlight that important loci underlying adaptive trait variation also show

  2. Partitioning of Multivariate Phenotypes using Regression Trees Reveals Complex Patterns of Adaptation to Climate across the Range of Black Cottonwood (Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Regis Wendpouire Oubida

    2015-03-01

    Full Text Available Local adaptation to climate in temperate forest trees involves the integration of multiple physiological, morphological, and phenological traits. Latitudinal clines are frequently observed for these traits, but environmental constraints also track longitude and altitude. We combined extensive phenotyping of 12 candidate adaptive traits, multivariate regression trees, quantitative genetics, and a genome-wide panel of SNP markers to better understand the interplay among geography, climate, and adaptation to abiotic factors in Populus trichocarpa. Heritabilities were low to moderate (0.13 to 0.32 and population differentiation for many traits exceeded the 99th percentile of the genome-wide distribution of FST, suggesting local adaptation. When climate variables were taken as predictors and the 12 traits as response variables in a multivariate regression tree analysis, evapotranspiration (Eref explained the most variation, with subsequent splits related to mean temperature of the warmest month, frost-free period (FFP, and mean annual precipitation (MAP. These grouping matched relatively well the splits using geographic variables as predictors: the northernmost groups (short FFP and low Eref had the lowest growth, and lowest cold injury index; the southern British Columbia group (low Eref and intermediate temperatures had average growth and cold injury index; the group from the coast of California and Oregon (high Eref and FFP had the highest growth performance and the highest cold injury index; and the southernmost, high-altitude group (with high Eref and low FFP performed poorly, had high cold injury index, and lower water use efficiency. Taken together, these results suggest variation in both temperature and water availability across the range shape multivariate adaptive traits in poplar.

  3. Characterization of cytokinin signaling and homeostasis gene families in two hardwood tree species: Populus trichocarpa and Prunus persica.

    Science.gov (United States)

    Immanen, Juha; Nieminen, Kaisa; Duchens Silva, Héctor; Rodríguez Rojas, Fernanda; Meisel, Lee A; Silva, Herman; Albert, Victor A; Hvidsten, Torgeir R; Helariutta, Ykä

    2013-12-16

    Through the diversity of cytokinin regulated processes, this phytohormone has a profound impact on plant growth and development. Cytokinin signaling is involved in the control of apical and lateral meristem activity, branching pattern of the shoot, and leaf senescence. These processes influence several traits, including the stem diameter, shoot architecture, and perennial life cycle, which define the development of woody plants. To facilitate research about the role of cytokinin in regulation of woody plant development, we have identified genes associated with cytokinin signaling and homeostasis pathways from two hardwood tree species. Taking advantage of the sequenced black cottonwood (Populus trichocarpa) and peach (Prunus persica) genomes, we have compiled a comprehensive list of genes involved in these pathways. We identified genes belonging to the six families of cytokinin oxidases (CKXs), isopentenyl transferases (IPTs), LONELY GUY genes (LOGs), two-component receptors, histidine containing phosphotransmitters (HPts), and response regulators (RRs). All together 85 Populus and 45 Prunus genes were identified, and compared to their Arabidopsis orthologs through phylogenetic analyses. In general, when compared to Arabidopsis, differences in gene family structure were often seen in only one of the two tree species. However, one class of genes associated with cytokinin signal transduction, the CKI1-like family of two-component histidine kinases, was larger in both Populus and Prunus than in Arabidopsis.

  4. Cryopreservation of Populus trichocarpa and Salix using dormant buds with recovery by grafting or direct rooting

    Science.gov (United States)

    Populus trichocarpa and Salix can be successfully cryopreserved by using dormant scions as the source explants. These scions (either at their original moisture content of 48 to 60% or dried to 30%) were slowly cooled to –35 degree Celsius, transferred to the vapor phase of liquid nitrogen (LNV,-160...

  5. Cryopreservation of Populus trichocarpa and Salix dormant buds with recovery by grafting or direct rooting.

    Science.gov (United States)

    Bonnart, Remi; Waddell, John; Haiby, Kathy; Widrlenchner, Mark P; Volk, Gayle M

    2014-01-01

    Methods are needed for the conservation of clonally maintained trees of Populus and Salix. In this work, Populus trichocarpa and Salix genetic resources were cryopreserved using dormant scions as the source explant. We quantified the recovery of cryopreserved materials that originated from diverse field environments by using either direct sprouting or grafting. Scions (either at their original moisture content of 48 to 60% or dried to 30%) were slowly cooled to -35 degree C, transferred to the vapor phase of liquid nitrogen (LNV, -160 degree C), and warmed before determining survival. Dormant buds from P. trichocarpa clones from Westport and Boardman, OR had regrowth levels between 42 and 100%. Direct rooting of cryopreserved P. trichocarpa was also possible. Ten of 11 cryopreserved Salix accessions, representing 10 different species, exhibited at least 40% bud growth and rooting after 6 weeks when a bottom-heated rooting system was implemented. We demonstrate that dormant buds of P. trichocarpa and Salix accessions can be cryopreserved and successfully regenerated without the use of tissue culture.

  6. Xylan hydrolysis in Populus trichocarpa × P. deltoides and model substrates during hydrothermal pretreatment.

    Science.gov (United States)

    Trajano, Heather L; Pattathil, Sivakumar; Tomkins, Bruce A; Tschaplinski, Timothy J; Hahn, Michael G; Van Berkel, Gary J; Wyman, Charles E

    2015-03-01

    Previous studies defined easy and difficult to hydrolyze fractions of hemicellulose that may result from bonds among cellulose, hemicellulose, and lignin. To understand how such bonds affect hydrolysis, Populus trichocarpa × Populus deltoides, holocellulose isolated from P. trichocarpa × P. deltoides and birchwood xylan were subjected to hydrothermal flow-through pretreatment. Samples were characterized by glycome profiling, HPLC, and UPLC-MS. Glycome profiling revealed steady fragmentation and removal of glycans from solids during hydrolysis. The extent of polysaccharide fragmentation, hydrolysis rate, and total xylose yield were lowest for P. trichocarpa × P. deltoides and greatest for birchwood xylan. Comparison of results from P. trichocarpa × P. deltoides and holocellulose suggested that lignin-carbohydrate complexes reduce hydrolysis rates and limit release of large xylooligomers. Smaller differences between results with holocellulose and birchwood xylan suggest xylan-cellulose hydrogen bonds limited hydrolysis, but to a lesser extent. These findings imply cell wall structure strongly influences hydrolysis. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Cytogenetic Analysis of Populus trichocarpa - Ribosomal DNA, Telomere Repeat Sequence, and Marker-selected BACs

    Science.gov (United States)

    M.N. lslam-Faridi; C.D. Nelson; S.P. DiFazio; L.E. Gunter; G.A. Tuskan

    2009-01-01

    The 185-285 rDNA and 55 rDNA loci in Populus trichocarpa were localized using fluorescent in situ hybridization (FISH). Two 185-285 rDNA sites and one 55 rDNA site were identified and located at the ends of 3 different chromosomes. FISH signals from the Arabidopsis-type telomere repeat sequence were observed at the distal ends of each chromosome. Six BAC clones...

  8. Dynamic DNA cytosine methylation in the Populus trichocarpa genome: tissue-level variation and relationship to gene expression

    Directory of Open Access Journals (Sweden)

    Vining Kelly J

    2012-01-01

    Full Text Available Abstract Background DNA cytosine methylation is an epigenetic modification that has been implicated in many biological processes. However, large-scale epigenomic studies have been applied to very few plant species, and variability in methylation among specialized tissues and its relationship to gene expression is poorly understood. Results We surveyed DNA methylation from seven distinct tissue types (vegetative bud, male inflorescence [catkin], female catkin, leaf, root, xylem, phloem in the reference tree species black cottonwood (Populus trichocarpa. Using 5-methyl-cytosine DNA immunoprecipitation followed by Illumina sequencing (MeDIP-seq, we mapped a total of 129,360,151 36- or 32-mer reads to the P. trichocarpa reference genome. We validated MeDIP-seq results by bisulfite sequencing, and compared methylation and gene expression using published microarray data. Qualitative DNA methylation differences among tissues were obvious on a chromosome scale. Methylated genes had lower expression than unmethylated genes, but genes with methylation in transcribed regions ("gene body methylation" had even lower expression than genes with promoter methylation. Promoter methylation was more frequent than gene body methylation in all tissues except male catkins. Male catkins differed in demethylation of particular transposable element categories, in level of gene body methylation, and in expression range of genes with methylated transcribed regions. Tissue-specific gene expression patterns were correlated with both gene body and promoter methylation. Conclusions We found striking differences among tissues in methylation, which were apparent at the chromosomal scale and when genes and transposable elements were examined. In contrast to other studies in plants, gene body methylation had a more repressive effect on transcription than promoter methylation.

  9. A 34K SNP genotyping array for Populus trichocarpa: design, application to the study of natural populations and transferability to other Populus species.

    Science.gov (United States)

    Geraldes, A; Difazio, S P; Slavov, G T; Ranjan, P; Muchero, W; Hannemann, J; Gunter, L E; Wymore, A M; Grassa, C J; Farzaneh, N; Porth, I; McKown, A D; Skyba, O; Li, E; Fujita, M; Klápště, J; Martin, J; Schackwitz, W; Pennacchio, C; Rokhsar, D; Friedmann, M C; Wasteneys, G O; Guy, R D; El-Kassaby, Y A; Mansfield, S D; Cronk, Q C B; Ehlting, J; Douglas, C J; Tuskan, G A

    2013-03-01

    Genetic mapping of quantitative traits requires genotypic data for large numbers of markers in many individuals. For such studies, the use of large single nucleotide polymorphism (SNP) genotyping arrays still offers the most cost-effective solution. Herein we report on the design and performance of a SNP genotyping array for Populus trichocarpa (black cottonwood). This genotyping array was designed with SNPs pre-ascertained in 34 wild accessions covering most of the species latitudinal range. We adopted a candidate gene approach to the array design that resulted in the selection of 34 131 SNPs, the majority of which are located in, or within 2 kb of, 3543 candidate genes. A subset of the SNPs on the array (539) was selected based on patterns of variation among the SNP discovery accessions. We show that more than 95% of the loci produce high quality genotypes and that the genotyping error rate for these is likely below 2%. We demonstrate that even among small numbers of samples (n = 10) from local populations over 84% of loci are polymorphic. We also tested the applicability of the array to other species in the genus and found that the number of polymorphic loci decreases rapidly with genetic distance, with the largest numbers detected in other species in section Tacamahaca. Finally, we provide evidence for the utility of the array to address evolutionary questions such as intraspecific studies of genetic differentiation, species assignment and the detection of natural hybrids. © 2013 Blackwell Publishing Ltd.

  10. Inheritance of compartmentalization of wounds in sweetgum (Liquidambar styraciflua L.) and eastern cottonwood (Populus deltoides Bartr.)

    Science.gov (United States)

    P. W. Garrett; W. K. Randall; A. L. Shigo; W. C. Shortle

    1979-01-01

    Studies of half-sib progeny tests of sweetgum (Liquidambar styraciflua) and clonal plantings of eastern cottonwood (Populus deltoides) in Mississippi indicate that rate of wound closure and size of discolored columns associated with the wounds are both heritable traits. Both are independent of stem diameter, which was used as a...

  11. Isolation and characterization of cDNAs encoding leucoanthocyanidin reductase and anthocyanidin reductase from Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Lijun Wang

    Full Text Available Proanthocyanidins (PAs contribute to poplar defense mechanisms against biotic and abiotic stresses. Transcripts of PA biosynthetic genes accumulated rapidly in response to infection by the fungus Marssonina brunnea f.sp. multigermtubi, treatments of salicylic acid (SA and wounding, resulting in PA accumulation in poplar leaves. Anthocyanidin reductase (ANR and leucoanthocyanidin reductase (LAR are two key enzymes of the PA biosynthesis that produce the main subunits: (+-catechin and (--epicatechin required for formation of PA polymers. In Populus, ANR and LAR are encoded by at least two and three highly related genes, respectively. In this study, we isolated and functionally characterized genes PtrANR1 and PtrLAR1 from P. trichocarpa. Phylogenetic analysis shows that Populus ANR1 and LAR1 occurr in two distinct phylogenetic lineages, but both genes have little difference in their tissue distribution, preferentially expressed in roots. Overexpression of PtrANR1 in poplar resulted in a significant increase in PA levels but no impact on catechin levels. Antisense down-regulation of PtrANR1 showed reduced PA accumulation in transgenic lines, but increased levels of anthocyanin content. Ectopic expression of PtrLAR1 in poplar positively regulated the biosynthesis of PAs, whereas the accumulation of anthocyanin and flavonol was significantly reduced (P<0.05 in all transgenic plants compared to the control plants. These results suggest that both PtrANR1 and PtrLAR1 contribute to PA biosynthesis in Populus.

  12. Gene Structures, Classification, and Expression Models of the DREB Transcription Factor Subfamily in Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Yunlin Chen

    2013-01-01

    Full Text Available We identified 75 dehydration-responsive element-binding (DREB protein genes in Populus trichocarpa. We analyzed gene structures, phylogenies, domain duplications, genome localizations, and expression profiles. The phylogenic construction suggests that the PtrDREB gene subfamily can be classified broadly into six subtypes (DREB A-1 to A-6 in Populus. The chromosomal localizations of the PtrDREB genes indicated 18 segmental duplication events involving 36 genes and six redundant PtrDREB genes were involved in tandem duplication events. There were fewer introns in the PtrDREB subfamily. The motif composition of PtrDREB was highly conserved in the same subtype. We investigated expression profiles of this gene subfamily from different tissues and/or developmental stages. Sixteen genes present in the digital expression analysis had high levels of transcript accumulation. The microarray results suggest that 18 genes were upregulated. We further examined the stress responsiveness of 15 genes by qRT-PCR. A digital northern analysis showed that the PtrDREB17, 18, and 32 genes were highly induced in leaves under cold stress, and the same expression trends were shown by qRT-PCR. Taken together, these observations may lay the foundation for future functional analyses to unravel the biological roles of Populus’ DREB genes.

  13. Dense genetic linkage maps of three Populus species (Populus deltoides, P. nigra and P. trichocarpa) based on AFLP and microsatellite markers.

    Science.gov (United States)

    Cervera, M T; Storme, V; Ivens, B; Gusmão, J; Liu, B H; Hostyn, V; Van Slycken, J; Van Montagu, M; Boerjan, W

    2001-06-01

    Populus deltoides, P. nigra, and P. trichocarpa are the most important species for poplar breeding programs worldwide. In addition, Populus has become a model for fundamental research on trees. Linkage maps were constructed for these three species by analyzing progeny of two controlled crosses sharing the same female parent, Populus deltoides cv. S9-2 x P. nigra cv. Ghoy and P. deltoides cv. S9-2 x P. trichocarpa cv. V24. The two-way pseudotestcross mapping strategy was used to construct the maps. Amplified fragment length polymorphism (AFLP) markers that segregated 1:1 were used to form the four parental maps. Microsatellites and sequence-tagged sites were used to align homoeologous groups between the maps and to merge linkage groups within the individual maps. Linkage analysis and alignment of the homoeologous groups resulted in 566 markers distributed over 19 groups for P. deltoides covering 86% of the genome, 339 markers distributed over 19 groups for P. trichocarpa covering 73%, and 369 markers distributed over 28 groups for P. nigra covering 61%. Several tests for randomness showed that the AFLP markers were randomly distributed over the genome.

  14. Insertional mutagenesis in Populus: relevance and feasibility

    Science.gov (United States)

    Victor Busov; Matthias Fladung; Andrew Groover; Steven Strauss

    2005-01-01

    The recent sequencing of the first tree genome, that of the black cottonwood (Populus trichocarpa), opens a new chapter in tree functional genomics. While the completion of the genome is a milestone, mobilizing this significant resource for better understanding the growth and development of woody perennials will be an even greater undertaking in the...

  15. Dendroclimatic potential of plains cottonwood (Populus deltoides subsp. monilifera) from the Northern Great Plains, USA

    Science.gov (United States)

    Edmonson, Jesse; Friedman, Jonathan; Meko, David; Touchan, Ramzi; Scott, Julian; Edmonson, Alan

    2014-01-01

    A new 368-year tree-ring chronology (A.D. 1643–2010) has been developed in western North Dakota using plains cottonwood (Populus deltoides subsp. monilifera) growing on the relatively undisturbed floodplain of the Little Missouri River in the North Unit of Theodore Roosevelt National Park. We document many slow-growing living trees between 150–370 years old that contradict the common understanding that cottonwoods grow fast and die young. In this northern location, cottonwood produces distinct annual rings with dramatic interannual variability that strongly crossdate. The detrended tree-ring chronology is significantly positively correlated with local growing season precipitation and soil moisture conditions (r  =  0.69). This time series shows periods of prolonged low radial tree growth during the known droughts of the instrumental record (e.g. 1931–1939 and 1980–1981) and also during prehistory (e.g. 1816–1823 and 1856–1865) when other paleoclimate studies have documented droughts in this region. Tree rings of cottonwood will be a useful tool to help reconstruct climate, streamflow, and the floodplain history of the Little Missouri River and other northern river systems.

  16. Physico-Chemical Properties and Biodegradability of Genetically Modified Populus trichocarpa and Pinus taeda

    Science.gov (United States)

    Edmunds, Charles Warren

    Increasing concerns over greenhouse gas emissions and the finite supply of fossil fuels lead to the goal of utilizing lignocellulosic feedstocks for biofuels, platform chemicals, and biocomposites. Lignin is responsible for the recalcitrance of lignocellulosic biomass and is a major barrier to its deconstruction. Great progress has been made in mapping and modifying the lignin biosynthetic pathway. However, the link between the genetic modification, resulting chemical and physical properties of the wood, and how these properties influence the thermomechanical and recalcitrance to biological and chemical degradation needs further investigation. In this dissertation, the study of modified Populus trichocarpa and Pinus taeda were utilized to accomplish this goal. Thermo-mechanical properties of genetically modified P. trichocarpa with altered lignin content and/or lignin structure were measured with a series of tools including; dynamic mechanical analysis, nuclear magnetic resonance, and wet chemistry techniques. Results demonstrated lignin content and lignin structure likely influence the glass transition temperature (Tg), and that decreased lignin content and the corresponding higher proportion of cell wall carbohydrates may contribute to increased molecular mobility in the wood polymer structure. The effect of lignin biosynthetic pathway modification on biological degradation of these transgenic wood specimens was of interest. However, experimental methods for fungal treatment on small young greenhouse-grown wood specimens are not well established. Therefore, a project was undertaken to develop a method for fungal inoculation and incubation for these unique specimens. Several parameters were tested, and a fungal treatment method was identified with sufficient weight loss after decay and significant reduction in variation of weight loss between replicates compared to previous experiments by direct inoculation of wood with liquid malt extract fungal culture

  17. Overexpression of Populus trichocarpa CYP85A3 promotes growth and biomass production in transgenic trees.

    Science.gov (United States)

    Jin, Yan-Li; Tang, Ren-Jie; Wang, Hai-Hai; Jiang, Chun-Mei; Bao, Yan; Yang, Yang; Liang, Mei-Xia; Sun, Zhen-Cang; Kong, Fan-Jing; Li, Bei; Zhang, Hong-Xia

    2017-10-01

    Brassinosteroids (BRs) are essential hormones that play crucial roles in plant growth, reproduction and response to abiotic and biotic stress. In Arabidopsis, AtCYP85A2 works as a bifunctional cytochrome P450 monooxygenase to catalyse the conversion of castasterone to brassinolide, a final rate-limiting step in the BR-biosynthetic pathway. Here, we report the functional characterizations of PtCYP85A3, one of the three AtCYP85A2 homologous genes from Populus trichocarpa. PtCYP85A3 shares the highest similarity with AtCYP85A2 and can rescue the retarded-growth phenotype of the Arabidopsis cyp85a2-2 and tomato d x mutants. Constitutive expression of PtCYP85A3, driven by the cauliflower mosaic virus 35S promoter, increased the endogenous BR levels and significantly promoted the growth and biomass production in both transgenic tomato and poplar. Compared to the wild type, plant height, shoot fresh weight and fruit yield increased 50%, 56% and 43%, respectively, in transgenic tomato plants. Similarly, plant height and stem diameter increased 15% and 25%, respectively, in transgenic poplar plants. Further study revealed that overexpression of PtCYP85A3 enhanced xylem formation without affecting the composition of cellulose and lignin, as well as the cell wall thickness in transgenic poplar. Our finding suggests that PtCYP85A3 could be used as a potential candidate gene for engineering fast-growing trees with improved wood production. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  18. Rapid production of trees. [Acer platanoides, Fraxinus excelsior, Quercus robus, Sorbus, Picea, and Abies spp. , Betula verrucose, Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Haarjorg, A.

    1976-01-01

    Seedlings of Acer platanoides approximately 2 m tall were produced in southern Norway in one year by seed stratification indoors. Similar results were obtained with Fraxinus excelsior, Quercus robus and Sorbus spp. Trails were also carried out with Betula verrucose (B. pendula), Populus trichocarpa, Picea spp., Abies spp., and other conifers. In all trials growth was increased when plants were raised in a plastic house, and depended on the time that Spring growth was started or whether supplementary light was given and also depended on the seed strain. For northern and high altitude strains it was important to maintain critical day length.

  19. Cottonwood

    Science.gov (United States)

    R. M. Krinard

    1980-01-01

    Cottonwood is pure or comprises a majority of the stocking, but it is associated with other bottomland hardwoods. Eastern, plains, and swamp cottonwood are included under the type name. The chief associates in the younger stages are black and sandbar willow. Sweetgum !s rare. White or green ash, silver maple, and American elm may occur in the northern extremities of...

  20. Effects of light regime and IBA concentration on adventitious rooting of an eastern cottonwood (Populus deltoides) clone

    Science.gov (United States)

    Alexander P. Hoffman; Joshua P. Adams; Andrew Nelson

    2016-01-01

    Eastern cottonwood (Populus deltoides) has received a substantial amount of interest from invitro studies within the past decade. The ability to efficiently multiply the stock of established clones such as clone 110412 is a valuable asset for forest endeavors. However, a common problem encountered is initiating adventitious rooting in new micropropagation protocols....

  1. Genome-wide analysis and heavy metal-induced expression profiling of the HMA gene family in Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Dandan eLi

    2015-12-01

    Full Text Available The heavy metal ATPase (HMA family plays an important role in transition metal transport in plants. However, this gene family has not been extensively studied in Populus trichocarpa. We identified 17 HMA genes in P. trichocarpa (PtHMAs, of which PtHMA1–PtHMA4 belonged to the zinc (Zn/cobalt (Co/cadmium (Cd/lead (Pb subgroup, and PtHMA5–PtHMA8 were members of the copper (Cu/silver (Ag subgroup. Most of the genes were localized to chromosomes I and III. Gene structure, gene chromosomal location, and synteny analyses of PtHMAs indicated that tandem and segmental duplications likely contributed to the expansion and evolution of the PtHMAs. Most of the HMA genes contained abiotic stress-related cis-elements. Tissue-specific expression of PtHMA genes showed that PtHMA1 and PtHMA4 had relatively high expression levels in the leaves, whereas Cu/Ag subgroup (PtHMA5.1- PtHMA8 genes were upregulated in the roots. High concentrations of Cu, Ag, Zn, Cd, Co, Pb and Mn differentially regulated the expression of PtHMAs in various tissues. The preliminary results of the present study generated basic information on the HMA family of Populus that may serve as foundation for future functional studies.

  2. Correlating laser-induced breakdown spectroscopy with neutron activation analysis to determine the elemental concentration in the ionome of the Populus trichocarpa leaf

    Science.gov (United States)

    Martin, Madhavi Z.; Glasgow, David C.; Tschaplinski, Timothy J.; Tuskan, Gerald A.; Gunter, Lee E.; Engle, Nancy L.; Wymore, Ann M.; Weston, David J.

    2017-12-01

    The black cottonwood poplar (Populus trichocarpa) leaf ionome (inorganic trace elements and mineral nutrients) is an important aspect for determining the physiological and developmental processes contributing to biomass production. A number of techniques are used to measure the ionome, yet characterizing the leaf spatial heterogeneity remains a challenge, especially in solid samples. Laser-induced breakdown spectroscopy (LIBS) has been used to determine the elemental composition of leaves and is able to raster across solid matrixes at 10 μm resolution. Here, we evaluate the use of LIBS for solid sample leaf elemental characterization in relation to neutron activation. In fact, neutron activation analysis is a laboratory-based technique which is used by the National Institute of Standards and Technology (NIST) to certify trace elements in candidate reference materials including plant leaf matrices. Introduction to the techniques used in this research has been presented in this manuscript. Neutron activation analysis (NAA) data has been correlated to the LIBS spectra to achieve quantification of the elements or ions present within poplar leaves. The regression coefficients of calibration and validation using multivariate analysis (MVA) methodology for six out of seven elements have been determined and vary between 0.810 and 0.998. LIBS and NAA data has been presented for the elements such as, calcium, magnesium, manganese, aluminum, copper, and potassium. Chlorine was also detected but it did not show good correlation between the LIBS and NAA techniques. This research shows that LIBS can be used as a fast, high-spatial resolution technique to quantify elements as part of large-scale field phenotyping projects.

  3. Flow regime effects on mature Populus fremontii (Fremont cottonwood) productivity on two contrasting dryland river floodplains

    Science.gov (United States)

    Andersen, Douglas C.

    2016-01-01

    I compared riparian cottonwood (Populus fremontii) productivity-discharge relationships in a relictual stand along the highly regulated Green River and in a naturally functioning stand along the unregulated Yampa River in semiarid northwest Colorado. I used multiple regression to model flow effects on annual basal area increment (BAI) from 1982 to 2011, after removing any autocorrelation present. Each BAI series was developed from 20 trees whose mean size (67 cm diameter at breast height [DBH]) was equivalent in the two stands. BAI was larger in the Yampa River stand except in 2 y when defoliating leaf beetles were present there. I found no evidence for a Yampa flood-magnitude threshold above which BAI declined. Flow variables explained ∼45% of residual BAI variability, with most explained by current-year maximum 90-d discharge (QM90) in the Yampa River stand and by a measure of the year-to-year change in QM90 in the Green River stand. The latter reflects a management-imposed ceiling on flood magnitude—Flaming Gorge Dam power plant capacity—infrequently exceeded during the study period. BAI in the relictual stand began to trend upward in 1992 when flows started to mimic a natural flow regime. Mature Fremont cottonwoods appear to be ecologically resilient. Their productivity along regulated rivers might be optimized using multiyear environmental flow designs.

  4. Comparative interrogation of the developing xylem transcriptomes of two wood-forming species: Populus trichocarpa and Eucalyptus grandis.

    Science.gov (United States)

    Hefer, Charles A; Mizrachi, Eshchar; Myburg, Alexander A; Douglas, Carl J; Mansfield, Shawn D

    2015-06-01

    Wood formation is a complex developmental process governed by genetic and environmental stimuli. Populus and Eucalyptus are fast-growing, high-yielding tree genera that represent ecologically and economically important species suitable for generating significant lignocellulosic biomass. Comparative analysis of the developing xylem and leaf transcriptomes of Populus trichocarpa and Eucalyptus grandis together with phylogenetic analyses identified clusters of homologous genes preferentially expressed during xylem formation in both species. A conserved set of 336 single gene pairs showed highly similar xylem preferential expression patterns, as well as evidence of high functional constraint. Individual members of multi-gene orthologous clusters known to be involved in secondary cell wall biosynthesis also showed conserved xylem expression profiles. However, species-specific expression as well as opposite (xylem versus leaf) expression patterns observed for a subset of genes suggest subtle differences in the transcriptional regulation important for xylem development in each species. Using sequence similarity and gene expression status, we identified functional homologs likely to be involved in xylem developmental and biosynthetic processes in Populus and Eucalyptus. Our study suggests that, while genes involved in secondary cell wall biosynthesis show high levels of gene expression conservation, differential regulation of some xylem development genes may give rise to unique xylem properties. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  5. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa

    OpenAIRE

    Li Yang; Xin Zhao; Fan Yang; Di Fan; Yuanzhong Jiang; Keming Luo

    2016-01-01

    WRKY proteins are one of the largest transcription factor families in higher plants and play diverse roles in various biological processes. Previous studies have shown that some WRKY members act as negative regulators of secondary cell wall formation in pith parenchyma cells. However, the regulatory mechanism of pith secondary wall formation in tree species remains largely unknown. In this study, PtrWRKY19 encoding a homolog of Arabidopsis WRKY12 was isolated from Populus trichocarpa. PtrWRKY...

  6. A cell wall-bound anionic peroxidase, PtrPO21, is involved in lignin polymerization in Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Chien-Yuan; Li, Quanzi; Tunlaya-Anukit, Sermsawat; Shi, Rui; Sun, Ying-Hsuan; Wang, Jack P.; Liu, Jie; Loziuk, Philip; Edmunds, Charles W.; Miller, Zachary D.; Peszlen, Ilona; Muddiman, David C.; Sederoff, Ronald R.; Chiang, Vincent L.

    2016-03-11

    Class III peroxidases are members of a large plant-specific sequence-heterogeneous protein family. Several sequence-conserved homologs have been associated with lignin polymerization in Arabidopsis thaliana, Oryza sativa, Nicotiana tabacum, Zinnia elegans, Picea abies, and Pinus sylvestris. In Populus trichocarpa, a model species for studies of wood formation, the peroxidases involved in lignin biosynthesis have not yet been identified. To do this, we retrieved sequences of all PtrPOs from Peroxibase and conducted RNA-seq to identify candidates. Transcripts from 42 PtrPOs were detected in stem differentiating xylem (SDX) and four of them are the most xylem-abundant (PtrPO12, PtrPO21, PtrPO42, and PtrPO64). PtrPO21 shows xylem-specific expression similar to that of genes encoding the monolignol biosynthetic enzymes. Using protein cleavage-isotope dilution mass spectrometry, PtrPO21 is detected only in the cell wall fraction and not in the soluble fraction. Downregulated transgenics of PtrPO21 have a lignin reduction of ~20% with subunit composition (S/G ratio) similar to wild type. The transgenics show a growth reduction and reddish color of stem wood. The modulus of elasticity (MOE) of the stems of the downregulated PtrPO21-line 8 can be reduced to ~60% of wild type. Differentially expressed gene (DEG) analysis of PtrPO21 downregulated transgenics identified a significant overexpression of PtPrx35, suggesting a compensatory effect within the peroxidase family. No significant changes in the expression of the 49 P. trichocarpa laccases (PtrLACs) were observed.

  7. Transcriptome analysis of the Populus trichocarpa-Rhizophagus irregularis Mycorrhizal Symbiosis: Regulation of Plant and Fungal Transportomes under Nitrogen Starvation.

    Science.gov (United States)

    Calabrese, Silvia; Kohler, Annegret; Niehl, Annette; Veneault-Fourrey, Claire; Boller, Thomas; Courty, Pierre-Emmanuel

    2017-06-01

    Nutrient transfer is a key feature of the arbuscular mycorrhizal (AM) symbiosis. Valuable mineral nutrients are transferred from the AM fungus to the plant, increasing its fitness and productivity, and, in exchange, the AM fungus receives carbohydrates as an energy source from the plant. Here, we analyzed the transcriptome of the Populus trichocarpa-Rhizophagus irregularis symbiosis using RNA-sequencing of non-mycorrhizal or mycorrhizal fine roots, with a focus on the effect of nitrogen (N) starvation. In R. irregularis, we identified 1,015 differentially expressed genes, whereby N starvation led to a general induction of gene expression. Genes of the functional classes of cell growth, membrane biogenesis and cell structural components were highly abundant. Interestingly, N starvation also led to a general induction of fungal transporters, indicating increased nutrient demand upon N starvation. In non-mycorrhizal P. trichocarpa roots, 1,341 genes were differentially expressed under N starvation. Among the 953 down-regulated genes in N starvation, most were involved in metabolic processes including amino acids, carbohydrate and inorganic ion transport, while the 342 up-regulated genes included many defense-related genes. Mycorrhization led to the up-regulation of 549 genes mainly involved in secondary metabolite biosynthesis and transport; only 24 genes were down-regulated. Mycorrhization specifically induced expression of three ammonium transporters and one phosphate transporter, independently of the N conditions, corroborating the hypothesis that these transporters are important for symbiotic nutrient exchange. In conclusion, our data establish a framework of gene expression in the two symbiotic partners under high-N and low-N conditions. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  8. The role of water channel proteins in facilitating recovery of leaf hydraulic conductance from water stress in Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Joan Laur

    Full Text Available Gas exchange is constrained by the whole-plant hydraulic conductance (Kplant. Leaves account for an important fraction of Kplant and may therefore represent a major determinant of plant productivity. Leaf hydraulic conductance (Kleaf decreases with increasing water stress, which is due to xylem embolism in leaf veins and/or the properties of the extra-xylary pathway. Water flow through living tissues is facilitated and regulated by water channel proteins called aquaporins (AQPs. Here we assessed changes in the hydraulic conductance of Populus trichocarpa leaves during a dehydration-rewatering episode. While leaves were highly sensitive to drought, Kleaf recovered only 2 hours after plants were rewatered. Recovery of Kleaf was absent when excised leaves were bench-dried and subsequently xylem-perfused with a solution containing AQP inhibitors. We examined the expression patterns of 12 highly expressed AQP genes during a dehydration-rehydration episode to identify isoforms that may be involved in leaf hydraulic adjustments. Among the AQPs tested, several genes encoding tonoplast intrinsic proteins (TIPs showed large increases in expression in rehydrated leaves, suggesting that TIPs contribute to reversing drought-induced reductions in Kleaf. TIPs were localized in xylem parenchyma, consistent with a role in facilitating water exchange between xylem vessels and adjacent living cells. Dye uptake experiments suggested that reversible embolism formation in minor leaf veins contributed to the observed changes in Kleaf.

  9. The role of water channel proteins in facilitating recovery of leaf hydraulic conductance from water stress in Populus trichocarpa.

    Science.gov (United States)

    Laur, Joan; Hacke, Uwe G

    2014-01-01

    Gas exchange is constrained by the whole-plant hydraulic conductance (Kplant). Leaves account for an important fraction of Kplant and may therefore represent a major determinant of plant productivity. Leaf hydraulic conductance (Kleaf) decreases with increasing water stress, which is due to xylem embolism in leaf veins and/or the properties of the extra-xylary pathway. Water flow through living tissues is facilitated and regulated by water channel proteins called aquaporins (AQPs). Here we assessed changes in the hydraulic conductance of Populus trichocarpa leaves during a dehydration-rewatering episode. While leaves were highly sensitive to drought, Kleaf recovered only 2 hours after plants were rewatered. Recovery of Kleaf was absent when excised leaves were bench-dried and subsequently xylem-perfused with a solution containing AQP inhibitors. We examined the expression patterns of 12 highly expressed AQP genes during a dehydration-rehydration episode to identify isoforms that may be involved in leaf hydraulic adjustments. Among the AQPs tested, several genes encoding tonoplast intrinsic proteins (TIPs) showed large increases in expression in rehydrated leaves, suggesting that TIPs contribute to reversing drought-induced reductions in Kleaf. TIPs were localized in xylem parenchyma, consistent with a role in facilitating water exchange between xylem vessels and adjacent living cells. Dye uptake experiments suggested that reversible embolism formation in minor leaf veins contributed to the observed changes in Kleaf.

  10. Ozone uptake (flux) as it relates to ozone-induced foliar symptoms of Prunus serotina and Populus maximowizii x trichocarpa

    International Nuclear Information System (INIS)

    Orendovici-Best, T.; Skelly, J.M.; Davis, D.D.; Ferdinand, J.A.; Savage, J.E.; Stevenson, R.E.

    2008-01-01

    Field studies were conducted during 2003 and 2004 from early June to the end of August, at 20 sites of lower or higher elevation within north-central Pennsylvania, using seedlings of black cherry (Prunus serotina, Ehrh.) and ramets of hybrid poplar (Populus maximowizii x trichocarpa). A linear model was developed to estimate the influence of local environmental conditions on stomatal conductance. The most significant factors explaining stomatal variance were tree species, air temperature, leaf vapor pressure deficit, elevation, and time of day. Overall, environmental factors explained less than 35% of the variation in stomatal conductance. Ozone did not affect gas exchange rates in either poplar or cherry. Ozone-induced foliar injury was positively correlated with cumulative ozone exposures, expressed as SUM40. Overall, the amount of foliar injury was better correlated to a flux-based approach rather than to an exposure-based approach. More severe foliar injuries were observed on plants growing at higher elevations. - Within heterogeneous environments, ozone flux does not completely explain the variation observed in ozone-induced visible injury

  11. Dynamics of Plains Cottonwood ( Populus deltoides) Forests and Historical Landscape Change along Unchannelized Segments of the Missouri River, USA

    Science.gov (United States)

    Dixon, Mark D.; Johnson, W. Carter; Scott, Michael L.; Bowen, Daniel E.; Rabbe, Lisa A.

    2012-05-01

    Construction of six large dams and reservoirs on the Missouri River over the last 50-75 years has resulted in major landscape changes and alterations in flow patterns, with implications for riparian forests dominated by plains cottonwood ( Populus deltoides). We quantified changes in land cover from 1892-1950s and the 1950s-2006 and the current extent and age structure of cottonwood forests on seven segments (two reservoir and five remnant floodplain) comprising 1127 km (53 %) of the unchannelized upper two-thirds of the Missouri River. Riparian forest area declined by 49 %; grassland 61 %; shrubland 52 %; and sandbar habitat 96 %; while agricultural cropland increased six-fold and river/reservoir surface area doubled from 1892 to 2006. Net rates of erosion and accretion declined between the 1892-1950s and 1950s-2006 periods. Accretion exceeded erosion on remnant floodplain segments, resulting in declines in active channel width, particularly in 1950s-2006. Across all study segments in 2006, most cottonwood stands (67 %) were >50 years old, 22 % were 25-50 years old, and only 10 % were <25 years old. Among stands <50 years old, the higher proportion of 25-50 year old stands represents recruitment that accompanied initial post-dam channel narrowing; while declines in sandbar and shrubland area and the low proportion of stands <25 years old suggest declines in geomorphic dynamism and limited recruitment under recent river management. Future conservation and restoration efforts should focus both on limiting further loss of remnant cottonwood stands and developing approaches to restore river dynamics and cottonwood recruitment processes.

  12. On the irrigation requirements of cottonwood (Populus fremontii and Populus deltoides var. wislizenii) and willow (Salix gooddingii) grown in a desert environment

    Science.gov (United States)

    Hartwell, S.; Morino, K.; Nagler, P.L.; Glenn, E.P.

    2010-01-01

    Native tree plots have been established in river irrigation districts in the western U.S. to provide habitat for threatened and endangered birds. Information is needed on the effective irrigation requirements of the target species. Cottonwood (Populus spp.) and willow (Salix gooddingii) trees were grown for seven years in an outdoor plot in a desert environment in Tucson, Arizona. Plants were allowed to achieve a nearly complete canopy cover over the first four years, then were subjected to three daily summer irrigation schedules of 6.20??mm??d-1; 8.26??mm??d-1 and 15.7??mm??d-1. The lowest irrigation rate was sufficient to maintain growth and high leaf area index for cottonwoods over three years, while willows suffered considerable die-back on this rate in years six and seven. These irrigation rates were applied April 15-September 15, but only 0.88??mm??d-1 was applied during the dormant period of the year. Expressed as a fraction of reference crop evapotranspiration (ETo), recommended annual water applications plus precipitation (and including some deep drainage) were 0.83 ETo for cottonwood and 1.01 ETo for willow. Current practices tend to over-irrigate restoration plots, and this study can provide guidelines for more efficient water use. ?? 2010 Elsevier Ltd.

  13. Significance of Lignin S/G Ratio in Biomass Recalcitrance of Populus trichocarpa Variants for Bioethanol Production

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Chang Geun [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; UT−ORNL; Dumitrache, Alexandru [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Muchero, Wellington [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Natzke, Jace [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Akinosho, Hannah [School; Li, Mi [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; UT−ORNL; Sykes, Robert W. [National Renewable Energy Laboratory, U.S. Department of Energy, 15013 Denver West Parkway, Golden, Colorado 80401, United States; Brown, Steven D. [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Davison, Brian [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Tuskan, Gerald A. [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; Pu, Yunqiao [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; UT−ORNL; Ragauskas, Arthur J. [BioEnergy; amp, Center for BioEnergy Innovation, Biosciences; UT−ORNL; Department; amp, Center for Renewable

    2017-12-27

    Lignin S/G ratio has been investigated as an important factor in biomass recalcitrance to bioethanol production. Because of the complexity and variety of biomass, recalcitrance was also reportedly influenced by several other factors, such as total lignin content, degree of cellulose polymerization, etc. In addition, the effect of S/G ratio on biomass conversion is not uniform across plant species. Herein, 11 Populus trichocarpa natural variants grown under the same conditions with similar total lignin content were selected to minimize the effects of other factors. The lignin S/G ratio of the selected P. trichocarpa natural variants showed negative correlations with p-hydroxybenzoate (PB) and ..beta..-5 linkage contents, while it had positive ones with ..beta..-O-4 linkage, lignin molecular weight, and ethanol production. This study showed the importance of lignin S/G ratio as an independent recalcitrance factor that may aid future energy crop engineering and biomass conversion strategies.

  14. Leaf anatomical changes in Populus trichocarpa, Quercus rubra, Pseudotsuga menziesii and Pinus ponderosa exposed to enhanced ultraviolet-B radiation

    International Nuclear Information System (INIS)

    Nagel, L.M.; Bassman, J.H.; Edwards, G.E.; Robberecht, R.; Franceshi, V.R.

    1998-01-01

    Leaf anatomical characteristics are important in determining the degree of injury sustained when plants are exposed to natural and enhanced levels of ultraviolet-B (UV-B) radiation (280–320 nm). The degree to which leaf anatomy can adapt to the increasing levels of UV-B radiation reaching the earth's surface is poorly understood in most tree species. We examined four tree species, representing a wide range of leaf anatomical characteristics, to determine responses of leaf area, specific leaf weight, and leaf tissue parameters after exposure to ambient and enhanced levels of UV-B radiation. Seedlings were grown in a greenhouse with photosynthetically active radiation of 39 mol m −2 day −1 and under one of three daily irradiances of biologically effective UV-B radiation (UV-BBE) supplied for 10 h per day: (1) approximate ambient level received at Pullman, Washington on June 21 (1 x ); two times ambient (2 x ), or three times ambient (3 x ). We hypothesized the response of each species to UV-B radiation would be related to inherent anatomical differences. We found that the conifers responded anatomically to nearly an equal degree as the broad-leaved trees, but that different tissues were involved. Populus trichocarpa, an indeterminate broadleaf species, showed significantly thicker palisade parenchyma in recently mature leaves at the 3 x level and in older leaves under the 2 x level. In addition, individual leaf area was generally greater with increased UV-B irradiance. Quercus rubra, a semi-determinate broadleaf species, exhibited significantly thicker palisade parenchyma at the 2 x and 3 x levels as compared to controls. Psuedotsuga menziesii, an evergreen coniferous species with bifacially flattened needles, and Pinus ponderosa, an evergreen coniferous species with a complete hypodermis, showed no significant change in leaf area or specific leaf weight under enhanced UV-B radiation. Epidermal thickness was unchanged in P. menziesii. However, P. ponderosa

  15. The Concentration of Nutrients in Tissues of Plantation-Grown Eastern Cottonwood (Populus deltoides Bart.)

    Science.gov (United States)

    M. G. Shelton; L. E. Nelson; G. L. Switzer; B. G. Blackmon

    1981-01-01

    Nutrient concentrations were determined for 10 tissues from each of 24 cottonwood trees that ranged in age from four to 16 years. Highest concentrations occurred in the most physiologically active tissues; i.e., stemtips, current branches and foliage. Tree age had little influence on the variation in nutrient concentration of tissues. Some differences in concentrations...

  16. Non-dispersive phloem-protein bodies (NPBs of Populus trichocarpa consist of a SEOR protein and do not respond to cell wounding and Ca2+

    Directory of Open Access Journals (Sweden)

    Daniel L. Mullendore

    2018-04-01

    Full Text Available Differentiating sieve elements in the phloem of angiosperms produce abundant phloem-specific proteins before their protein synthesis machinery is degraded. These P-proteins initially form dense bodies, which disperse into individual filaments when the sieve element matures. In some cases, however, the dense protein agglomerations remain intact and are visible in functional sieve tubes as non-dispersive P-protein bodies, or NPBs. Species exhibiting NPBs are distributed across the entire angiosperm clade. We found that NPBs in the model tree, Populus trichocarpa, resemble the protein bodies described from other species of the order Malpighiales as they all consist of coaligned tubular fibrils bundled in hexagonal symmetry. NPBs of all Malpighiales tested proved unresponsive to sieve tube wounding and Ca2+. The P. trichocarpa NPBs consisted of a protein encoded by a gene that in the genome database of this species had been annotated as a homolog of SEOR1 (sieve element occlusion-related 1 in Arabidopsis. Sequencing of the gene in our plants corroborated this interpretation, and we named the gene PtSEOR1. Previously characterized SEOR proteins form irregular masses of P-protein slime in functional sieve tubes. We conclude that a subgroup of these proteins is involved in the formation of NPBs at least in the Malpighiales, and that these protein bodies have no role in rapid wound responses of the sieve tube network.

  17. Significance of Lignin S/G Ratio in Biomass Recalcitrance of Populus trichocarpa Variants for Bioethanol Production

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Chang Geun [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dumitrache, Alexandru [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Muchero, Wellington [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Natzke, Jace [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Akinosho, Hannah [Georgia Inst. of Technology, Atlanta, GA (United States); Li, Mi [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sykes, Robert W. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Brown, Steven D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Davison, Brian [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Tuskan, Gerald A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pu, Yunqiao [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ragauskas, Arthur J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Univ. of Tennessee, Knoxville, TN (United States)

    2017-12-11

    Lignin S/G ratio has been investigated as an important factor in biomass recalcitrance to bioethanol production. Because of the complexity and variety of biomass, recalcitrance was also reportedly influenced by several other factors, such as total lignin content, degree of cellulose polymerization, etc. In addition, the effect of S/G ratio on biomass conversion is not uniform across plant species. Herein, 11 Populus trichocarpa natural variants grown under the same conditions with similar total lignin content were selected to minimize the effects of other factors. The lignin S/G ratio of the selected P. trichocarpa natural variants showed negative correlations with p-hydroxybenzoate (PB) and β–5 linkage contents, while it had positive ones with β-O-4 linkage, lignin molecular weight, and ethanol production. In conclusion, this study showed the importance of lignin S/G ratio as an independent recalcitrance factor that may aid future energy crop engineering and biomass conversion strategies.

  18. A microarray-based genotyping and genetic mapping approach for highly heterozygous outcrossing species enables localization of a large fraction of the unassembled Populus trichocarpa genome sequence.

    Science.gov (United States)

    Drost, Derek R; Novaes, Evandro; Boaventura-Novaes, Carolina; Benedict, Catherine I; Brown, Ryan S; Yin, Tongming; Tuskan, Gerald A; Kirst, Matias

    2009-06-01

    Microarrays have demonstrated significant power for genome-wide analyses of gene expression, and recently have also revolutionized the genetic analysis of segregating populations by genotyping thousands of loci in a single assay. Although microarray-based genotyping approaches have been successfully applied in yeast and several inbred plant species, their power has not been proven in an outcrossing species with extensive genetic diversity. Here we have developed methods for high-throughput microarray-based genotyping in such species using a pseudo-backcross progeny of 154 individuals of Populus trichocarpa and P. deltoides analyzed with long-oligonucleotide in situ-synthesized microarray probes. Our analysis resulted in high-confidence genotypes for 719 single-feature polymorphism (SFP) and 1014 gene expression marker (GEM) candidates. Using these genotypes and an established microsatellite (SSR) framework map, we produced a high-density genetic map comprising over 600 SFPs, GEMs and SSRs. The abundance of gene-based markers allowed us to localize over 35 million base pairs of previously unplaced whole-genome shotgun (WGS) scaffold sequence to putative locations in the genome of P. trichocarpa. A high proportion of sampled scaffolds could be verified for their placement with independently mapped SSRs, demonstrating the previously un-utilized power that high-density genotyping can provide in the context of map-based WGS sequence reassembly. Our results provide a substantial contribution to the continued improvement of the Populus genome assembly, while demonstrating the feasibility of microarray-based genotyping in a highly heterozygous population. The strategies presented are applicable to genetic mapping efforts in all plant species with similarly high levels of genetic diversity.

  19. Alanine rich peptide from Populus trichocarpa inhibit growth of Staphylococcus aureus via targetting its extracellular domain of Sensor Histidine Kinase YycGex protein.

    Science.gov (United States)

    Al Akeel, Raid; Mateen, Ayesha; Syed, Rabbani; Al-Qahtani, Mohammed S; Alqahtani, A

    2018-05-11

    Due to growing concern towards microbial resistance, ongoing search for developing novel bioactive compounds such as peptides is on rise. The aim of this study was to evaluate antimicrobial effect of Populus trichocarpa extract, chemically identify the active peptide fraction and finds its target in Staphylococcus aureus. In this study the active fraction of P. trichocarpa crude extract was purified and characterized using MS/MS. This peptide PT13 antimicrobial activity was confirmed by in-vitro agar based disk diffusion and in-vivo infection model of G. mellonella. The proteomic expression analysis of S. aureus under influence of PT13 was studied using LTQ-Orbitrap-MS in-solution digestion and identity of target protein was acquired with their quantified expression using label-free approach of Progenesis QI software. Docking study was performed with peptide PT13 and its target YycG protein using CABS-dock. The active fraction PT13 sequence was identified as KVPVAAAAAAAAAVVASSMVVAAAK, with 25 amino acid including 13 alanine having M/Z 2194.2469. PT13 was uniformly inhibited growth S. aureus SA91 and MIC was determined 16 μg/mL for SA91 S. aureus strain. Sensor histidine kinase (YycG) was most significant target found differentially expressed under influence of PT13. G. mellonella larvae were killed rapidly due to S aureus infection, whereas death in protected group was insignificant in compare to control. The docking models showed ten docking models with RMSD value 1.89 for cluster 1 and RMSD value 3.95 for cluster 2 which is predicted to be high quality model. Alanine rich peptide could be useful in constructing as antimicrobial peptide for targeting extracellular Domain of Sensor Histidine Kinase YycG from S. aureus used in the study. Copyright © 2018. Published by Elsevier Ltd.

  20. Investigations on the nutrient demands of different balsam poplar clones (Populus trichocarpa Torr. et Grey) based on growth, nutrient uptake, and vapor exchange. Untersuchungen ueber die Naehrstoffansprueche verschiedener Balsam-Pappelklone (Populus trichocarpa Torr. et Grey) in Hinsicht auf das Wachstum, die Naehrstoffaufnahme und den Gaswechsel

    Energy Technology Data Exchange (ETDEWEB)

    Griese, C.

    1991-01-01

    This work tries to describe the nutrient demands of six different, very fast-growing clones of the species Populus trichocarpa Torr. Et. Grey. Relevant are the capability for taking up different nutrients, and the plants' efficiency in using these nutrients for vapour exchange of the leaves (photosynthesis, respiration in the dark, transpiration) as well as for increasing biomass. A further aim pursued with these measurements is the attempt to explain the different growth of these six popular clones. Here, field experiments have shown a gradiation of the clones' growth performance. From the first to the sixth clone, growth performance declines steadily. Should there be differences among the clones as to the physiological, biometric and phenological variables to be investigated, then this work might lead to the identification of growth-determining factors suitable for postulating of the investigated clones. (orig.).

  1. Observations on the Early Establishment of Foliar Endophytic Fungi in Leaf Discs and Living Leaves of a Model Woody Angiosperm, Populus trichocarpa (Salicaceae

    Directory of Open Access Journals (Sweden)

    Yu-Ling Huang

    2018-05-01

    Full Text Available Fungal endophytes are diverse and widespread symbionts that occur in the living tissues of all lineages of plants without causing evidence of disease. Culture-based and culture-free studies indicate that they often are abundant in the leaves of woody angiosperms, but only a few studies have visualized endophytic fungi in leaf tissues, and the process through which most endophytes colonize leaves has not been studied thoroughly. We inoculated leaf discs and the living leaves of a model woody angiosperm, Populus trichocarpa, which has endophytes that represent three distantly-related genera (Cladosporium, Penicillium, and Trichoderma. We used scanning electron microscopy and light microscopy to evaluate the timeline and processes by which they colonize leaf tissue. Under laboratory conditions with high humidity, conidia germinated on leaf discs to yield hyphae that grew epiphytically and incidentally entered stomata, but did not grow in a directed fashion toward stomatal openings. No cuticular penetration was observed. The endophytes readily colonized the interiors of leaf discs that were detached from living leaves, and could be visualized within discs with light microscopy. Although they were difficult to visualize within the interior of living leaves following in vivo inoculations, standard methods for isolating foliar endophytes confirmed their presence.

  2. Effects of Clone, Silvicultural, and Miticide Treatments on Cottonwood Leafcurl Mite (Acari: Eriophyidae) Damage in Plantation Populus

    Science.gov (United States)

    David R. Coyle

    2002-01-01

    Aculops lobuliferus (Keifer) is a little known pest of plantation Populus spp., which is capable of causing substantial damage. This is the First documented occurrence of A. lobuliferus in South Carolina. Previous anecdotal data indicated clonal variation in Populus susceptibility to A...

  3. Overexpression of PtrMYB119, a R2R3-MYB transcription factor from Populus trichocarpa, promotes anthocyanin production in hybrid poplar.

    Science.gov (United States)

    Cho, Jin-Seong; Nguyen, Van Phap; Jeon, Hyung-Woo; Kim, Min-Ha; Eom, Seok Hyun; Lim, You Jin; Kim, Won-Chan; Park, Eung-Jun; Choi, Young-Im; Ko, Jae-Heung

    2016-09-01

    Anthocyanins are a group of colorful and bioactive natural pigments with important physiological and ecological functions in plants. We found an MYB transcription factor (PtrMYB119) from Populus trichocarpa that positively regulates anthocyanin production when expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis Amino acid sequence analysis revealed that PtrMYB119 is highly homologous to Arabidopsis PAP1 (PRODUCTION OF ANTHOCYANIN PIGMENT1), a well-known transcriptional activator of anthocyanin biosynthesis. Independently produced transgenic poplars overexpressing PtrMYB119 or PtrMYB120 (a paralogous gene to PtrMYB119) (i.e., 35S::PtrMYB119 and 35S::PtrMYB120, respectively) showed elevated accumulation of anthocyanins in the whole plants, including leaf, stem and even root tissues. Using a reverse-phase high-performance liquid chromatography, we confirmed that the majority of the accumulated anthocyanin in our transgenic poplar is cyanidin-3-O-glucoside. Gene expression analyses revealed that most of the genes involved in the anthocyanin biosynthetic pathway were highly upregulated in 35S::PtrMYB119 poplars compared with the nontransformed control poplar. Among these genes, expression of PtrCHS1 (Chalcone Synthase1) and PtrANS2 (Anthocyanin Synthase2), which catalyze the initial and last steps of anthocyanin biosynthesis, respectively, was upregulated by up to 350-fold. Subsequent transient activation assays confirmed that PtrMYB119 activated the transcription of both PtrCHS1 and PtrANS2 Interestingly, expression of MYB182, a repressor of both anthocyanin and proanthocyanidin (PA) biosynthesis, was largely suppressed in 35S::PtrMYB119 poplars, while expression of MYB134, an activator of PA biosynthesis, was not changed significantly. More interestingly, high-level accumulation of anthocyanins in 35S::PtrMYB119 poplars did not have an adverse effect on plant growth. Taken together, our results demonstrate that PtrMYB119 and PtrMYB120

  4. Genetic improvement and evaluation of black cottonwood for short- rotation biomass production. Final report, 1987--1992

    Energy Technology Data Exchange (ETDEWEB)

    Stettler, R.F.; Hinckley, T.M. [Washington Univ., Seattle, WA (United States). Coll. of Forest Resources; Heilman, P.E. [Washington State Univ., Puyallup, WA (United States). Research and Extension Center; Bradshaw, H.D. Jr. [Washington Univ., Seattle, WA (United States). Dept. of Biochemistry

    1993-04-30

    This project was initiated in 1978 to serve three objectives: (1) develop genetically improved poplar cultivars offering increased productivity under short-rotation culture; (2) identify the major components of productivity in poplar and determine ways in which they can be manipulated, genetically and culturally; and (3) engage in technology transfer to regional industry and agencies so as to make poplar culture in the Pacific Northwest economically feasible. The project is aimed at capturing natural variation in the native black cottonwood. Populus trichocarpa T & G, and enhancing it through selective breeding. Major emphasis has been placed on hybridization of black cottonwood with P deltoides and P maximowiczii, more recently with p nigra. First-generation (F{sub 1}) hybrids have consistently outperformed black cottonwood by a factor of 1.5.-2. The high yields of woody biomass obtained from these clonally propagated hybrids, in rotations of 4-7 years, have fostered the establishment of large-scale plantations by the pulp and paper industry in the region. Physiological studies have helped to elucidate hybrid superiority and several of the underlying mechanisms.

  5. The influence of alternative plant propagation and stand establishment techniques on survival and growth of eastern cottonwood (Populus deltoids Bartr.) clones

    Science.gov (United States)

    Donald J. Kaczmarek; Randall Rousseau; Jeff A. Wright; Brian Wachelka

    2014-01-01

    Four eastern cottonwood clones, including standard operational clone ST66 and three advanced clonal selections were produced and included in a test utilizing five different plant propagation methods. Despite relatively large first-year growth differences among clones, all clones demonstrated similar responses to the treatments and clone × cutting treatment interactions...

  6. Wood property variation in Populus

    Science.gov (United States)

    Dean W. Einspahr; Miles K. Benson; John R. Peckham

    1968-01-01

    The use of bigtooth aspen (Populus grandidentata Michx.), quaking aspen (P. tremuloides Michx.), and cottonwood (P. deltoides Bartr.) by the pulp and paper industry has increased greatly during the past decade. This expanded use has stimulated research on the genetic improvement of Populus. For the past 12 years...

  7. Genetic Variation Among Open-Pollinated Progeny of Eastern Cottonwood

    Science.gov (United States)

    R. E. Farmer

    1970-01-01

    Improvement programs in eastern cottonwood (Populus deltoides Bartr.) are most frequently designed to produce genetically superior clones for direct commercial use. This paper describes a progeny test to assess genetic variability on which selection might be based.

  8. Field Guide for Evaluating Cottonwood Sites

    Science.gov (United States)

    W.M. Broadfoot

    1960-01-01

    Two field methods have been developed at the Stoneville Research Center for estimating the capability of Midsouth soils to grow eastern cottonwood (Populus deltoides Bartr.). Data for establishing the procedures were collected from 155 plots* at the locations indicated in Figure 1.The methods give site index-that is, tree-growing...

  9. Biomass productivity improvement for eastern cottonwood

    Science.gov (United States)

    Terry L. Robison; Randy J. Rousseau; Jianwei Zhang

    2006-01-01

    Eastern cottonwood ( Populus deltoides Marsh.) is grown in plantations by MeadWestvaco for use at its Wickliffe Kentucky Fine Papers Mill1. Genetic and productivity research over the past two decades have led to significant increases in biomass yield while reducing production costs.Initially, genetic research identified fast growing...

  10. Evaluating growth effects from an imidacloprid treatment in black willow and eastern cottonwood cuttings

    Science.gov (United States)

    Luciano de Sene Fernandes; Ray A. Souter; Theodor D. Leininger

    2015-01-01

    Black willow (Salix nigra Marsh.) and eastern cottonwood (Populus deltoides Bartram ex Marsh.), two species native in the Lower Mississippi Alluvial Valley, have importance in short rotation woody crop (SRWC) systems for biomass production (Ruark 2006).

  11. Rooting ability of native cottonwoods depends on the clone used

    Science.gov (United States)

    Frank E. Cunningham

    1953-01-01

    Vegetative propagation of eastern cottonwood (Populus deltoides) from dormant cuttings has generally been considered rather easy. Yet test plantings of unrooted cuttings of this species on the Hopkins Memorial Experimental Forest at Williamstown, Mass., showed considerable variation in rooting ability of the clones used.

  12. Intron-Mediated Alternative Splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B Regulates Cell Wall Thickening during Fiber Development in Populus Species1[W

    Science.gov (United States)

    Zhao, Yunjun; Sun, Jiayan; Xu, Peng; Zhang, Rui; Li, Laigeng

    2014-01-01

    Alternative splicing is an important mechanism involved in regulating the development of multicellular organisms. Although many genes in plants undergo alternative splicing, little is understood of its significance in regulating plant growth and development. In this study, alternative splicing of black cottonwood (Populus trichocarpa) wood-associated NAC domain transcription factor (PtrWNDs), PtrWND1B, is shown to occur exclusively in secondary xylem fiber cells. PtrWND1B is expressed with a normal short-transcript PtrWND1B-s as well as its alternative long-transcript PtrWND1B-l. The intron 2 structure of the PtrWND1B gene was identified as a critical sequence that causes PtrWND1B alternative splicing. Suppression of PtrWND1B expression specifically inhibited fiber cell wall thickening. The two PtrWND1B isoforms play antagonistic roles in regulating cell wall thickening during fiber cell differentiation in Populus spp. PtrWND1B-s overexpression enhanced fiber cell wall thickening, while overexpression of PtrWND1B-l repressed fiber cell wall thickening. Alternative splicing may enable more specific regulation of processes such as fiber cell wall thickening during wood formation. PMID:24394777

  13. Intron-mediated alternative splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B regulates cell wall thickening during fiber development in Populus species.

    Science.gov (United States)

    Zhao, Yunjun; Sun, Jiayan; Xu, Peng; Zhang, Rui; Li, Laigeng

    2014-02-01

    Alternative splicing is an important mechanism involved in regulating the development of multicellular organisms. Although many genes in plants undergo alternative splicing, little is understood of its significance in regulating plant growth and development. In this study, alternative splicing of black cottonwood (Populus trichocarpa) wood-associated NAC domain transcription factor (PtrWNDs), PtrWND1B, is shown to occur exclusively in secondary xylem fiber cells. PtrWND1B is expressed with a normal short-transcript PtrWND1B-s as well as its alternative long-transcript PtrWND1B-l. The intron 2 structure of the PtrWND1B gene was identified as a critical sequence that causes PtrWND1B alternative splicing. Suppression of PtrWND1B expression specifically inhibited fiber cell wall thickening. The two PtrWND1B isoforms play antagonistic roles in regulating cell wall thickening during fiber cell differentiation in Populus spp. PtrWND1B-s overexpression enhanced fiber cell wall thickening, while overexpression of PtrWND1B-l repressed fiber cell wall thickening. Alternative splicing may enable more specific regulation of processes such as fiber cell wall thickening during wood formation.

  14. Alternative splicing studies of the reactive oxygen species gene network in Populus reveal two isoforms of high-isoelectric-point superoxide dismutase.

    Science.gov (United States)

    Srivastava, Vaibhav; Srivastava, Manoj Kumar; Chibani, Kamel; Nilsson, Robert; Rouhier, Nicolas; Melzer, Michael; Wingsle, Gunnar

    2009-04-01

    Recent evidence has shown that alternative splicing (AS) is widely involved in the regulation of gene expression, substantially extending the diversity of numerous proteins. In this study, a subset of expressed sequence tags representing members of the reactive oxygen species gene network was selected from the PopulusDB database to investigate AS mechanisms in Populus. Examples of all known types of AS were detected, but intron retention was the most common. Interestingly, the closest Arabidopsis (Arabidopsis thaliana) homologs of half of the AS genes identified in Populus are not reportedly alternatively spliced. Two genes encoding the protein of most interest in our study (high-isoelectric-point superoxide dismutase [hipI-SOD]) have been found in black cottonwood (Populus trichocarpa), designated PthipI-SODC1 and PthipI-SODC2. Analysis of the expressed sequence tag libraries has indicated the presence of two transcripts of PthipI-SODC1 (hipI-SODC1b and hipI-SODC1s). Alignment of these sequences with the PthipI-SODC1 gene showed that hipI-SODC1b was 69 bp longer than hipI-SODC1s due to an AS event involving the use of an alternative donor splice site in the sixth intron. Transcript analysis showed that the splice variant hipI-SODC1b was differentially expressed, being clearly expressed in cambial and xylem, but not phloem, regions. In addition, immunolocalization and mass spectrometric data confirmed the presence of hipI-SOD proteins in vascular tissue. The functionalities of the spliced gene products were assessed by expressing recombinant hipI-SOD proteins and in vitro SOD activity assays.

  15. Alternative Splicing Studies of the Reactive Oxygen Species Gene Network in Populus Reveal Two Isoforms of High-Isoelectric-Point Superoxide Dismutase1[C][W

    Science.gov (United States)

    Srivastava, Vaibhav; Srivastava, Manoj Kumar; Chibani, Kamel; Nilsson, Robert; Rouhier, Nicolas; Melzer, Michael; Wingsle, Gunnar

    2009-01-01

    Recent evidence has shown that alternative splicing (AS) is widely involved in the regulation of gene expression, substantially extending the diversity of numerous proteins. In this study, a subset of expressed sequence tags representing members of the reactive oxygen species gene network was selected from the PopulusDB database to investigate AS mechanisms in Populus. Examples of all known types of AS were detected, but intron retention was the most common. Interestingly, the closest Arabidopsis (Arabidopsis thaliana) homologs of half of the AS genes identified in Populus are not reportedly alternatively spliced. Two genes encoding the protein of most interest in our study (high-isoelectric-point superoxide dismutase [hipI-SOD]) have been found in black cottonwood (Populus trichocarpa), designated PthipI-SODC1 and PthipI-SODC2. Analysis of the expressed sequence tag libraries has indicated the presence of two transcripts of PthipI-SODC1 (hipI-SODC1b and hipI-SODC1s). Alignment of these sequences with the PthipI-SODC1 gene showed that hipI-SODC1b was 69 bp longer than hipI-SODC1s due to an AS event involving the use of an alternative donor splice site in the sixth intron. Transcript analysis showed that the splice variant hipI-SODC1b was differentially expressed, being clearly expressed in cambial and xylem, but not phloem, regions. In addition, immunolocalization and mass spectrometric data confirmed the presence of hipI-SOD proteins in vascular tissue. The functionalities of the spliced gene products were assessed by expressing recombinant hipI-SOD proteins and in vitro SOD activity assays. PMID:19176719

  16. Epigenomics of Development in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, Steve; Freitag, Michael; Mockler, Todd

    2013-01-10

    We conducted research to determine the role of epigenetic modifications during tree development using poplar (Populus trichocarpa), a model woody feedstock species. Using methylated DNA immunoprecipitation (MeDIP) or chromatin immunoprecipitation (ChIP), followed by high-throughput sequencing, we are analyzed DNA and histone methylation patterns in the P. trichocarpa genome in relation to four biological processes: bud dormancy and release, mature organ maintenance, in vitro organogenesis, and methylation suppression. Our project is now completed. We have 1) produced 22 transgenic events for a gene involved in DNA methylation suppression and studied its phenotypic consequences; 2) completed sequencing of methylated DNA from eleven target tissues in wildtype P. trichocarpa; 3) updated our customized poplar genome browser using the open-source software tools (2.13) and (V2.2) of the P. trichocarpa genome; 4) produced summary data for genome methylation in P. trichocarpa, including distribution of methylation across chromosomes and in and around genes; 5) employed bioinformatic and statistical methods to analyze differences in methylation patterns among tissue types; and 6) used bisulfite sequencing of selected target genes to confirm bioinformatics and sequencing results, and gain a higher-resolution view of methylation at selected genes 7) compared methylation patterns to expression using available microarray data. Our main findings of biological significance are the identification of extensive regions of the genome that display developmental variation in DNA methylation; highly distinctive gene-associated methylation profiles in reproductive tissues, particularly male catkins; a strong whole genome/all tissue inverse association of methylation at gene bodies and promoters with gene expression; a lack of evidence that tissue specificity of gene expression is associated with gene methylation; and evidence that genome methylation is a significant impediment to tissue

  17. Estimating Leaf Nitrogen of Eastern Cottonwood Trees with a Chlorophyll Meter

    Science.gov (United States)

    Benoit Moreau; Emile S. Gardiner; John A. Stanturf; Ronald K. Fisher

    2004-01-01

    The utility of the SPAD-502 chlorophyll meter for nondestructive and rapid field determination of leaf nitrogen (N) has been demonstrated in agricultural crops, but this technology has not yet been extended to woody crop applications. Upper canopy leaves from a 5-year-old plantation of two eastern cottonwood (Populus deltoides Bartr. ex Marsh.)...

  18. Increasing the productivity of short-rotation Populus plantations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    DeBell, D.S.; Harrington, C.A.; Clendenen, G.W.; Radwan, M.A.; Zasada, J.C. [Forest Service, Olympia, WA (United States). Pacific Northwest Research Station

    1997-12-31

    This final report represents the culmination of eight years of biological research devoted to increasing the productivity of short rotation plantations of Populus trichocarpa and Populus hybrids in the Pacific Northwest. Studies provide an understanding of tree growth, stand development and biomass yield at various spacings, and how patterns differ by Populus clone in monoclonal and polyclonal plantings. Also included is some information about factors related to wind damage in Populus plantings, use of leaf size as a predictor of growth potential, and approaches for estimating tree and stand biomass and biomass growth. Seven research papers are included which provide detailed methods, results, and interpretations on these topics.

  19. Cottonwood Tree Rings and Climate in Western North America

    Science.gov (United States)

    Friedman, J. M.; Edmondson, J.; Griffin, E. R.; Meko, D. M.; Merigliano, M. F.; Scott, J. A.; Scott, M. L.; Touchan, R.

    2012-12-01

    In dry landscapes of interior western USA, cottonwood (Populus spp.) seedling establishment often occurs only close to river channels after floods. Where winter is sufficiently cold, cottonwoods also have distinct annual rings and can live up to 370 years, allowing us to reconstruct the long-term history of river flows and channel locations. We have analyzed the annual rate of cottonwood establishment along streams in Montana, Wyoming, Colorado, North Dakota and Idaho. Because the trees germinate next to the river, establishment rates are strongly correlated with the rate of channel migration driven by floods. Along large rivers dominated by snowmelt from the mountains, interannual variation in peak flows and cottonwood establishment is small, and century-scale variation driven by climate change is apparent. The upper Snake, Yellowstone and Green rivers all show a strong decrease in cottonwood establishment beginning in the late 1800s and continuing to the present, indicating a decrease in peak flows prior to flow regulation by large dams. This is consistent with published tree-ring studies of montane conifers showing decreases in snowpack at the same time scale. In contrast, beginning in the late 1800s cottonwood ring widths along the Little Missouri River, North Dakota show an increase in annual growth that continues into the present. Because annual growth is strongly correlated with April-July flows (r=0.69) the ring-width data suggest an increase in April-July flows at the same time tree establishment dates suggest a decrease in peak flows. These results may be reconciled by the hypothesis that increases in low temperatures have decreased snowpack while lengthening the growing season.

  20. Disrupting mycorrhizal mutualisms: a potential mechanism by which exotic tamarisk outcompetes native cottonwoods.

    Science.gov (United States)

    Meinhardt, Kelley A; Gehring, Catherine A

    2012-03-01

    The disruption of mutualisms between plants and mycorrhizal fungi is a potentially powerful mechanism by which invasives can negatively impact native species, yet our understanding of this mechanism's role in exotic species invasion is still in its infancy. Here, we provide several lines of evidence indicating that invasive tamarisk (Tamarix sp.) negatively affects native cottonwoods (Populus fremontii) by disrupting their associations with arbuscular mycorrhizal (AM) and ectomycorrhizal (EM) fungi. At a field site in the early stages of tamarisk invasion, cottonwoods with tamarisk neighbors had reduced EM colonization and altered EM fungal community composition relative to cottonwoods with native neighbors, leading to reductions in EM propagule abundance in the soil beneath tamarisk. Similarly, AM colonization of cottonwoods was reduced with a tamarisk neighbor, but there were no significant changes in AM fungal spore communities or propagule abundance. Root colonization by nonmycorrhizal fungi, including potential pathogens, was higher in cottonwoods with tamarisk neighbors. A greenhouse experiment in which AM and EM inoculation and plant neighbor were manipulated in a fully factorial design showed that cottonwoods benefited from mycorrhizas, especially EM, in terms of shoot biomass when grown with a conspecific, but shoot biomass was similar to that of nonmycorrhizal controls when cottonwoods were grown with a tamarisk neighbor. These results are partially explained by a reduction in EM but not AM colonization of cottonwoods by a tamarisk neighbor. Tamarisk neighbors negatively affected cottonwood specific leaf area, but not chlorophyll content, in the field. To pinpoint a mechanism for these changes, we measured soil chemistry in the field and the growth response of an EM fungus (Hebeloma crustuliniforme) to salt-amended media in the laboratory. Tamarisk increased both NO3- concentrations and electrical conductivity 2.5-fold beneath neighboring cottonwoods in

  1. Characterization of MORE AXILLARY GROWTH genes in Populus.

    Directory of Open Access Journals (Sweden)

    Olaf Czarnecki

    Full Text Available Strigolactones are a new class of plant hormones that play a key role in regulating shoot branching. Studies of branching mutants in Arabidopsis, pea, rice and petunia have identified several key genes involved in strigolactone biosynthesis or signaling pathway. In the model plant Arabidopsis, MORE AXILLARY GROWTH1 (MAX1, MAX2, MAX3 and MAX4 are four founding members of strigolactone pathway genes. However, little is known about the strigolactone pathway genes in the woody perennial plants.Here we report the identification of MAX homologues in the woody model plant Populus trichocarpa. We identified the sequence homologues for each MAX protein in P. trichocarpa. Gene expression analysis revealed that Populus MAX paralogous genes are differentially expressed across various tissues and organs. Furthermore, we showed that Populus MAX genes could complement or partially complement the shoot branching phenotypes of the corresponding Arabidopsis max mutants.This study provides genetic evidence that strigolactone pathway genes are likely conserved in the woody perennial plants and lays a foundation for further characterization of strigolactone pathway and its functions in the woody perennial plants.

  2. Light-regulated leaf expansion in two Populus species: dependence on developmentally controlled ion transport.

    Science.gov (United States)

    Stiles, Kari A; Van Volkenburgh, Elizabeth

    2002-07-01

    Leaf growth responses to light have been compared in two species of Populus, P. deltoides and P. trichocarpa. These species differ markedly in morphology, anatomy, and dependence on light during leaf expansion. Light stimulates the growth rate and acidification of cell walls in P. trichocarpa but not in P. deltoides, whereas leaves of P. deltoides maintain growth in the dark. Light-induced growth is promoted in P. deltoides when cells are provided 50-100 mM KCl. In both species, light initially depolarizes, then hyperpolarizes mesophyll plasma membranes. However, in the dark, the resting E(m) of mesophyll cells in P. deltoides, but not in P. trichocarpa, is relatively insensitive to decade changes in external [K+]. Results suggest that light-stimulated leaf growth depends on developmentally regulated cellular mechanisms controlling ion fluxes across the plasma membrane. These developmental differences underlie species-level differences in growth and physiological responses to the photoenvironment.

  3. Increased leaf area dominates carbon flux response to elevated CO2 in stands of Populus deltoides (Bartr.)

    Science.gov (United States)

    Ramesh Murthy; Greg Barron-Gafford; Philip M. Dougherty; Victor c. Engels; Katie Grieve; Linda Handley; Christie Klimas; Mark J. Postosnaks; Stanley J. Zarnoch; Jianwei Zhang

    2005-01-01

    We examined the effects of atmospheric vapor pressure deficit (VPD) and soil moisture stress (SMS) on leaf- and stand-level CO2 exchange in model 3-year-old coppiced cottonwood (Populus deltoides Bartr.) plantations using the large-scale, controlled environments of the Biosphere 2 Laboratory. A short-term experiment was imposed...

  4. Mitochondrial DNA variation and genetic relationships of Populus species.

    Science.gov (United States)

    Barrett, J W; Rajora, O P; Yeh, F C; Dancik, B P; Strobeck, C

    1993-02-01

    We examined variation in and around the region coding for the cytochrome c oxidase I (coxI) and ATPase 6 (atp6) genes in the mitochondrial genomes of four Populus species (P. nigra, P. deltoides, P. maximowiczii, and P. tremuloides) and the natural hybrid P. x canadensis (P. deltoides x P. nigra). Total cellular DNAs of these poplars were digested with 16 restriction endonucleases and probed with maize mtDNA-specific probes (CoxI and Atp6). The only variant observed for Atp6 was interspecific, with P. maximowiczii separated from the other species as revealed by EcoRI digestions. No intraspecific mtDNA variation was observed among individuals of P. nigra, P. maximowiczii, P. x canadensis, or P. tremuloides for the CoxI probe. However, two varieties of P. deltoides were distinct because of a single site change in the KpnI digestions, demonstrating that P. deltoides var. deltoides (eastern cottonwood) and var. occidentalis (plains cottonwood) have distinct mitochondrial genomes in the region of the coxI gene. Populus x canadensis shared the same restriction fragment patterns as its suspected maternal parent P. deltoides. Nucleotide substitutions per base in and around the coxI and atp6 genes among the Populus species and the hybrid ranged from 0.0017 to 0.0077. The interspecific estimates of nucleotide substitution per base suggested that P. tremuloides was furthest removed from P. deltoides and P. x canadensis and least diverged from P. nigra. Populus maximowiczii was placed between these two clusters.

  5. Cottonwoods of the Midwest: A Community Profile

    Science.gov (United States)

    2008-05-01

    As a component of the floodplain forest, cottonwoods provide habitat for many species of birds to roost, nest, and feed in the branches and bole...in the western United States (Malanson 1993). Cottonwood seedlings are preferred forage for cattle , which also trample young plants. Invasive...Cooper and Van Haverbeke 1990; Taylor 2001) Common Name Scientific Name Eastern Plains Invasive Graminoids Creeping bentgrass Agrostis stolonifera

  6. Genome-wide survey and characterization of the WRKY gene family in Populus trichocarpa.

    Science.gov (United States)

    He, Hongsheng; Dong, Qing; Shao, Yuanhua; Jiang, Haiyang; Zhu, Suwen; Cheng, Beijiu; Xiang, Yan

    2012-07-01

    WRKY transcription factors participate in diverse physiological and developmental processes in plants. They have highly conserved WRKYGQK amino acid sequences in their N-termini, followed by the novel zinc-finger-like motifs, Cys₂His₂ or Cys₂HisCys. To date, numerous WRKY genes have been identified and characterized in a number of herbaceous species. Survey and characterization of WRKY genes in a ligneous species would facilitate a better understanding of the evolutionary processes and functions of this gene family. In this study, 104 poplar WRKY genes (PtWRKY) were identified in the latest poplar genome sequence. According to their structural features, the predicted members were divided into the previously defined groups I-III, as described in rice. In addition, chromosomal localization of the genes demonstrated that there might be WRKY gene hot spots in 2.3 Mb regions on chromosome 14. Furthermore, approximately 83% (86 out of 104) WRKY genes participated in gene duplication events, including 69% (29 out of 42) gene pairs which exhibited segmental duplication. Using semi-quantitative RT-PCR, the expression patterns of subgroup III genes were investigated under different stresses [cold, drought, salinity and salicylic acid (SA)]. The data revealed that these genes presented different expression levels in response to various stress conditions. Expression analysis exhibited PtWRKY76 gene induced markedly in 0.1 mM SA or 25% PEG-6000 treatment. The results presented here provide a fundamental clue for cloning specific function genes in further studies and applications. This study identified 104 poplar WRKY genes and demonstrated WRKY gene hot spots on chromosome 14. Furthermore, semi-quantitative RT-PCR showed variable stress responses in subgroup III.

  7. Variable Nitrogen Fixation in Wild Populus.

    Directory of Open Access Journals (Sweden)

    Sharon L Doty

    Full Text Available The microbiome of plants is diverse, and like that of animals, is important for overall health and nutrient acquisition. In legumes and actinorhizal plants, a portion of essential nitrogen (N is obtained through symbiosis with nodule-inhabiting, N2-fixing microorganisms. However, a variety of non-nodulating plant species can also thrive in natural, low-N settings. Some of these species may rely on endophytes, microorganisms that live within plants, to fix N2 gas into usable forms. Here we report the first direct evidence of N2 fixation in the early successional wild tree, Populus trichocarpa, a non-leguminous tree, from its native riparian habitat. In order to measure N2 fixation, surface-sterilized cuttings of wild poplar were assayed using both 15N2 incorporation and the commonly used acetylene reduction assay. The 15N label was incorporated at high levels in a subset of cuttings, suggesting a high level of N-fixation. Similarly, acetylene was reduced to ethylene in some samples. The microbiota of the cuttings was highly variable, both in numbers of cultured bacteria and in genetic diversity. Our results indicated that associative N2-fixation occurred within wild poplar and that a non-uniformity in the distribution of endophytic bacteria may explain the variability in N-fixation activity. These results point to the need for molecular studies to decipher the required microbial consortia and conditions for effective endophytic N2-fixation in trees.

  8. Stock characterization and improvement: DNA fingerprinting and cold tolerance of Populus and Salix clones

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Dolly; Hubbes, M.; Zsuffa, L. [Toronto Univ., ON (Canada). Faculty of Forestry; Tsarouhas, V.; Gullberg, U. [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Genetics; Howe, G.; Hackett, W.; Gardner, G.; Furnier, G. [Minnesota Univ., St. Paul, MN (United States). Dept. of Forest Resources; Tuskan, G. [Oak Ridge National Lab., TN (United States)

    1998-12-31

    Molecular characterization of advanced-generation pedigrees and evaluation of cold tolerance are two aspects of Populus and Salix genetic improvement programmes worldwide that have traditionally received little emphasis. As such, chloroplast DNA markers were tested as a means of determining multi-generation parental contributions to hybrid progeny. Likewise, greenhouse, growth chamber and field studies were used to assess cold tolerance in Populus and Salix. Chloroplast DNA markers did not reveal size polymorphisms among four tested Populus species, but did produce sequence polymorphisms between P. maximowiczii and P. trichocarpa. Additional crosses between multiple genotypes from each species are being used to evaluate the utility of the detected polymorphism for ascertaining parentage within interspecific crosses. Short-day, cold tolerance greenhouse studies revealed that bud set date and frost damage are moderately heritable and genetically correlated in Populus. The relationship between greenhouse and field studies suggests that factors other than short days contribute to cold tolerance in Populus. In Salix, response to artificial fall conditioning varied among full-sibling families, with the fastest growing family displaying the greatest amount of cold tolerance 26 refs, 3 tabs

  9. Rooting Cuttings of Cottonwood, WilIow, and Sycamore

    Science.gov (United States)

    Charles B. Briscoe

    1963-01-01

    Cuttings of cottonwood, willow, and sycamore were collectd monthly through the year and set in nursery beds. Every species yield an appreciable percentage of rooted cuttings every month. The best month was March; the worst month was June. Willow rooted more cuttings than cottonwood or sycamore, and those which rooted grew faster. Cottonwood grew faster than sycamore....

  10. Identifying data gaps and prioritizing restoration strategies for Fremont cottonwood using linked geomorphic and population models

    Science.gov (United States)

    Harper, E. B.; Stella, J. C.; Fremier, A. K.

    2009-12-01

    Fremont cottonwood (Populus fremontii) is an important component of semi-arid riparian ecosystems throughout western North America, but its populations are in decline due to flow regulation. Achieving a balance between human resource needs and riparian ecosystem function requires a mechanistic understanding of the multiple geomorphic and biological factors affecting tree recruitment and survival, including the timing and magnitude of river flows, and the concomitant influence on suitable habitat creation and mortality from scour and sedimentation burial. Despite a great deal of empirical research on some components of the system, such as factors affecting cottonwood recruitment, other key components are less studied. Yet understanding the relative influence of the full suite of physical and life-history drivers is critical to modeling whole-population dynamics under changing environmental conditions. We addressed these issues for the Fremont cottonwood population along the Sacramento River, CA using a sensitivity analysis approach to quantify uncertainty in parameters on the outcomes of a patch-based, dynamic population model. Using a broad range of plausible values for 15 model parameters that represent key physical, biological and climatic components of the ecosystem, we ran 1,000 population simulations that consisted of a subset of 14.3 million possible combinations of parameter estimates to predict the frequency of patch colonization and total forest habitat predicted to occur under current hydrologic conditions after 175 years. Results indicate that Fremont cottonwood populations are highly sensitive to the interactions among flow regime, sedimentation rate and the depth of the capillary fringe (Fig. 1). Estimates of long-term floodplain sedimentation rate would substantially improve model accuracy. Spatial variation in sediment texture was also important to the extent that it determines the depth of the capillary fringe, which regulates the availability of

  11. Comparison of Cottonwood Dendrochronology and Optically Stimulated Luminescence Geochronometers Along a High Plains Meandering River, Powder River, Montana, USA

    Science.gov (United States)

    Hasse, T. R.; Schook, D. M.

    2017-12-01

    Geochronometers at centennial scales can aid our understanding of process rates in fluvial geomorphology. Plains cottonwood trees (Populus deltoides ssp. Monilifera) in the high plains of the United States are known to germinate on freshly created deposits such as point bars adjacent to rivers. As the trees mature they may be partially buried (up to a few meters) by additional flood deposits. Cottonwood age gives a minimum age estimate of the stratigraphic surface where the tree germinated and a maximum age estimate for overlying sediments, providing quantitative data on rates of river migration and sediment accumulation. Optically Stimulated Luminescence (OSL) of sand grains can be used to estimate the time since the sand grains were last exposed to sunlight, also giving a minimum age estimate of sediment burial. Both methods have disadvantages: Browsing, partial burial, and other damage to young cottonwoods can increase the time required for the tree to reach a height where it can be sampled with a tree corer, making the germination point a few years to a few decades older than the measured tree age; fluvial OSL samples can have inherited age (when the OSL age is older than the burial age) if the sediment was not completely bleached prior to burial. We collected OSL samples at 8 eroding banks of the Powder River Montana, and tree cores at breast height (±1.2 m) from cottonwood trees growing on the floodplain adjacent to the OSL sample locations. Using the Minimum Age Model (MAM) we found that OSL ages appear to be 500 to 1,000 years older than the adjacent cottonwood trees which range in age (at breast height) from 60 to 185 years. Three explanations for this apparent anomaly in ages are explored. Samples for OSL could be below a stratigraphic unconformity relative to the cottonwood germination elevation. Shallow samples for OSL could be affected by anthropogenic mixing of sediments due to plowing and leveling of hay fields. The OSL samples could have

  12. Latitudinal variation in cold hardiness in introduced Tamarix and native Populus

    Science.gov (United States)

    Friedman, Jonathan M.; Roelle, James E.; Gaskin, John F.; Pepper, Alan E.; Manhart, James R.

    2008-01-01

    To investigate the evolution of clinal variation in an invasive plant, we compared cold hardiness in the introduced saltcedar (Tamarix ramosissima, Tamarix chinensis, and hybrids) and the native plains cottonwood (Populus deltoidessubsp. monilifera). In a shadehouse in Colorado (41°N), we grew plants collected along a latitudinal gradient in the central United States (29–48°N). On 17 occasions between September 2005 and June 2006, we determined killing temperatures using freeze-induced electrolyte leakage and direct observation. In midwinter, cottonwood survived cooling to −70°C, while saltcedar was killed at −33 to −47°C. Frost sensitivity, therefore, may limit northward expansion of saltcedar in North America. Both species demonstrated inherited latitudinal variation in cold hardiness. For example, from September through January killing temperatures for saltcedar from 29.18°N were 5–21°C higher than those for saltcedar from 47.60°N, and on September 26 and October 11, killing temperatures for cottonwood from 33.06°N were >43°C higher than those for cottonwood from 47.60°N. Analysis of nine microsatellite loci showed that southern saltcedars are more closely related to T. chinensis while northern plants are more closely related to T. ramosissima. Hybridization may have introduced the genetic variability necessary for rapid evolution of the cline in saltcedar cold hardiness.

  13. Planting Season for Cottonwood Can Be Extended

    Science.gov (United States)

    Harvey E. Kennedy

    1979-01-01

    Cottonwood cuttings planted as early as November and as late as May survive and grow well if sufficient soil moisture is available and cuttings are properly handled. About 6 inches or more of well distributed rainfall is needed in September and October to recharge Commerce soil. If these two months are dry, planting should be delayed. In March or later, cuttings should...

  14. Elements in cottonwood trees as an indicator of ground water contaminated by landfill leachate

    Science.gov (United States)

    Erdman, James A.; Christenson, Scott

    2000-01-01

    Ground water at the Norman Landfill Research Site is contaminated by a leachate plume emanating from a closed, unlined landfill formerly operated by the city of Norman, Oklahoma, Ground water contaminated by the leachate plume is known to be elevated in the concentration of many, organic and inorganic constituents. Specific conductance, alkalinity, chloride, dissolved organic carbon, boron, sodium, strontium, and deuterium in ground water are considered to be indicators of the leachate plume at this site. Leaf samples of broad-leafed cottonwood, Populus deltoides, were collected from 57 sites around the closed landfill. Cottonwood, a phreatophyte or “well plant,” functions as a & surrogate well and serves as a ground water quality sampler. The leaf samples were combusted to ash and analyzed by instrumental neutron activation for 35 elements and by prompt-gamma instrumental neutron activation, for boron. A monitoring well was located within a few meters of a sampled cottonwood tree at 15 of the 57 sites, and ground water samples were collected from these monitoring wells simultaneously with a leaf sample. The chemical analyses of the ground water and leaf samples from these 15 sites indicated that boron, bromine, sodium, and strontium concentrations in leaves were significantly correlated with leachate indicator constituents in ground water. A point-plot map of selected percentiles indicated high concentrations of boron, bromine, and sodium in leaf ash from sites downgradient of the most recent landfill and from older landfills nearby. Data from leaf analysis greatly extended the known areal extent of the leachate plume previously determined from a network of monitoring wells and geophysical surveys. This phytosgeochemical study provided a cost-effective method for assessing the extent of a leachate plume from an old landfill. Such a method may be useful as a preliminary sampling tool to guide the design of hydrogeochemical and geophysical studies.

  15. Gibberellins in shoots and developing capsules of Populus species.

    Science.gov (United States)

    Pearce, David W; Hutt, Oliver E; Rood, Stewart B; Mander, Lewis N

    2002-03-01

    Extracts of stems of growing shoots of Populus deltoides and P. trichocarpa, and developing capsules of P. deltoides were analysed for gibberellins (GAs) by gas chromatography-mass spectrometry. The following known GAs were identified by comparison of their Kovats retention indices (KRIs) and mass spectra with those of standards: GA1, GA8, GA9, GA19, GA20, 16 beta,17-dihydro-17-hydroxy GA20, GA23, GA28, GA29, GA34, GA44, and GA97. Several of these have not been previously reported from Populus. In addition, two new GAs were identified as 12 beta-hydroxy GA53 (GA127) and 16 beta,17-dihydro-17-hydroxy GA53 and their structures were confirmed by partial synthesis. Evidence was found of 16,17-dihydro-16,17-dihydroxy GA9, 16,17-dihydro-16,17-dihydroxy GA12, 12-hydroxy GA14, and GA34-catabolite by comparison of mass spectra and KRIs with published data. Several putative GAs (hydroxy- and dihydroxy-GA12-like) were also found. The catabolites of active GAs or of key precursors, hydroxylated at C-2 in stems and either C-2, C-12, C-17, or C-16,17 in capsules, were the major proportion of the GAs.

  16. Differentiation of Populus species using chloroplast single nucleotide polymorphism (SNP) markers--essential for comprehensible and reliable poplar breeding.

    Science.gov (United States)

    Schroeder, H; Hoeltken, A M; Fladung, M

    2012-03-01

    Within the genus Populus several species belonging to different sections are cross-compatible. Hence, high numbers of interspecies hybrids occur naturally and, additionally, have been artificially produced in huge breeding programmes during the last 100 years. Therefore, determination of a single poplar species, used for the production of 'multi-species hybrids' is often difficult, and represents a great challenge for the use of molecular markers in species identification. Within this study, over 20 chloroplast regions, both intergenic spacers and coding regions, have been tested for their ability to differentiate different poplar species using 23 already published barcoding primer combinations and 17 newly designed primer combinations. About half of the published barcoding primers yielded amplification products, whereas the new primers designed on the basis of the total sequenced cpDNA genome of Populus trichocarpa Torr. & Gray yielded much higher amplification success. Intergenic spacers were found to be more variable than coding regions within the genus Populus. The highest discrimination power of Populus species was found in the combination of two intergenic spacers (trnG-psbK, psbK-psbl) and the coding region rpoC. In barcoding projects, the coding regions matK and rbcL are often recommended, but within the genus Populus they only show moderate variability and are not efficient in species discrimination. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.

  17. Methane Fluxes at the Tree Stem, Soil, and Ecosystem-scales in a Cottonwood Riparian Forest

    Science.gov (United States)

    Flanagan, L. B.; Nikkel, D. J.; Scherloski, L. M.; Tkach, R. E.; Rood, S. B.

    2017-12-01

    Trees can emit methane to the atmosphere that is produced by microbes inside their decaying stems or by taking up and releasing methane that is produced by microbes in adjacent, anoxic soil layers. The significance of these two methane production pathways for possible net release to the atmosphere depends on the magnitude of simultaneous oxidation of atmospheric methane that occurs in well-aerated, shallow soil zones. In order to quantify the significance of these processes, we made methane flux measurements using the eddy covariance technique at the ecosystem-scale and via chamber-based methods applied on the soil surface and on tree stems in a riparian cottonwood ecosystem in southern Alberta that was dominated by Populus tree species and their natural hybrids. Tree stem methane fluxes varied greatly among individual Populus trees and changed seasonally, with peak growing season average values of 4 nmol m-2 s-1 (tree surface area basis). When scaled to the ecosystem, the tree stem methane emissions (0.9 nmol m-2 s-1, ground area basis) were slightly higher than average soil surface methane uptake rates (-0.8 nmol m-2 s-1). In addition, we observed regular nighttime increases in methane concentration within the forest boundary layer (by 300 nmol mol-1 on average at 22 m height during July). The majority of the methane concentration build-up was flushed from the ecosystem to the well-mixed atmosphere, with combined eddy covariance and air column storage fluxes reaching values of 70-80 nmol m-2 s-1 for approximately one hour after sunrise. Daily average net methane emission rates at the ecosystem-scale were 4.4 nmol m-2 s-1 during July. Additional lab studies demonstrated that tree stem methane was produced via the CO2-reduction pathway, as tissue in the central stem of living Populus trees was being decomposed. This study demonstrated net methane emission from an upland, cottonwood forest ecosystem, resulting from microbe methane production in tree stems that

  18. Cottonwood Response to Nitrogen Related To Plantation Age and Site

    Science.gov (United States)

    B.G. Blackmon

    1977-01-01

    When applied at plantation age 4,336 kg N/ha increased diameter growth of cottonwood on Sharkey clay by 33 percent over unfertilized controls. Fertilizing at ages 2 and 3 resulted in no response, nor was there any benefit from applying nitrogen fertilizer to cottonwood on Commerce silt loam. On both sites, foliar N levels were increased by fertilization regardless of...

  19. Identification of Quantitative Trait Loci (QTL) and Candidate Genes for Cadmium Tolerance in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Induri, Brahma R [West Virginia University; Ellis, Danielle R [West Virginia University; Slavov, Gancho [West Virginia University; Yin, Tongming [ORNL; Muchero, Wellington [ORNL; Tuskan, Gerald A [ORNL; DiFazio, Stephen P [West Virginia University

    2012-01-01

    Knowledge of genetic variation in response of Populus to heavy metals like cadmium (Cd) is an important step in understanding the underlying mechanisms of tolerance. In this study, a pseudo-backcross pedigree of Populus trichocarpa and Populus deltoides was characterized for Cd exposure. The pedigree showed significant variation for Cd tolerance thus enabling the identification of relatively tolerant and susceptible genotypes for intensive characterization. A total of 16 QTLs at logarithm of odds (LOD) ratio > 2.5, were found to be associated with total dry weight, its components, and root volume. Four major QTLs for total dry weight were mapped to different linkage groups in control (LG III) and Cd conditions (LG XVI) and had opposite allelic effects on Cd tolerance, suggesting that these genomic regions were differentially controlled. The phenotypic variation explained by Cd QTL for all traits under study varied from 5.9% to 11.6% and averaged 8.2% across all QTL. Leaf Cd contents also showed significant variation suggesting the phytoextraction potential of Populus genotypes, though heritability of this trait was low (0.22). A whole-genome microarray study was conducted by using two genotypes with extreme responses for Cd tolerance in the above study and differentially expressed genes were identified. Candidate genes including CAD2 (CADMIUM SENSITIVE 2), HMA5 (HEAVY METAL ATPase5), ATGTST1 (Arabidopsis thaliana Glutathione S-Transferase1), ATGPX6 (Glutathione peroxidase 6), and ATMRP 14 (Arabidopsis thaliana Multidrug Resistance associated Protein 14) were identified from QTL intervals and microarray study. Functional characterization of these candidate genes could enhance phytoremediation capabilities of Populus.

  20. Aldehyde Dehydrogenase Gene Superfamily in Populus: Organization and Expression Divergence between Paralogous Gene Pairs.

    Directory of Open Access Journals (Sweden)

    Feng-Xia Tian

    Full Text Available Aldehyde dehydrogenases (ALDHs constitute a superfamily of NAD(P+-dependent enzymes that catalyze the irreversible oxidation of a wide range of reactive aldehydes to their corresponding nontoxic carboxylic acids. ALDHs have been studied in many organisms from bacteria to mammals; however, no systematic analyses incorporating genome organization, gene structure, expression profiles, and cis-acting elements have been conducted in the model tree species Populus trichocarpa thus far. In this study, a comprehensive analysis of the Populus ALDH gene superfamily was performed. A total of 26 Populus ALDH genes were found to be distributed across 12 chromosomes. Genomic organization analysis indicated that purifying selection may have played a pivotal role in the retention and maintenance of PtALDH gene families. The exon-intron organizations of PtALDHs were highly conserved within the same family, suggesting that the members of the same family also may have conserved functionalities. Microarray data and qRT-PCR analysis indicated that most PtALDHs had distinct tissue-specific expression patterns. The specificity of cis-acting elements in the promoter regions of the PtALDHs and the divergence of expression patterns between nine paralogous PtALDH gene pairs suggested that gene duplications may have freed the duplicate genes from the functional constraints. The expression levels of some ALDHs were up- or down-regulated by various abiotic stresses, implying that the products of these genes may be involved in the adaptation of Populus to abiotic stresses. Overall, the data obtained from our investigation contribute to a better understanding of the complexity of the Populus ALDH gene superfamily and provide insights into the function and evolution of ALDH gene families in vascular plants.

  1. Aldehyde Dehydrogenase Gene Superfamily in Populus: Organization and Expression Divergence between Paralogous Gene Pairs.

    Science.gov (United States)

    Tian, Feng-Xia; Zang, Jian-Lei; Wang, Tan; Xie, Yu-Li; Zhang, Jin; Hu, Jian-Jun

    2015-01-01

    Aldehyde dehydrogenases (ALDHs) constitute a superfamily of NAD(P)+-dependent enzymes that catalyze the irreversible oxidation of a wide range of reactive aldehydes to their corresponding nontoxic carboxylic acids. ALDHs have been studied in many organisms from bacteria to mammals; however, no systematic analyses incorporating genome organization, gene structure, expression profiles, and cis-acting elements have been conducted in the model tree species Populus trichocarpa thus far. In this study, a comprehensive analysis of the Populus ALDH gene superfamily was performed. A total of 26 Populus ALDH genes were found to be distributed across 12 chromosomes. Genomic organization analysis indicated that purifying selection may have played a pivotal role in the retention and maintenance of PtALDH gene families. The exon-intron organizations of PtALDHs were highly conserved within the same family, suggesting that the members of the same family also may have conserved functionalities. Microarray data and qRT-PCR analysis indicated that most PtALDHs had distinct tissue-specific expression patterns. The specificity of cis-acting elements in the promoter regions of the PtALDHs and the divergence of expression patterns between nine paralogous PtALDH gene pairs suggested that gene duplications may have freed the duplicate genes from the functional constraints. The expression levels of some ALDHs were up- or down-regulated by various abiotic stresses, implying that the products of these genes may be involved in the adaptation of Populus to abiotic stresses. Overall, the data obtained from our investigation contribute to a better understanding of the complexity of the Populus ALDH gene superfamily and provide insights into the function and evolution of ALDH gene families in vascular plants.

  2. Comparative genomic analysis of the WRKY III gene family in populus, grape, arabidopsis and rice.

    Science.gov (United States)

    Wang, Yiyi; Feng, Lin; Zhu, Yuxin; Li, Yuan; Yan, Hanwei; Xiang, Yan

    2015-09-08

    WRKY III genes have significant functions in regulating plant development and resistance. In plant, WRKY gene family has been studied in many species, however, there still lack a comprehensive analysis of WRKY III genes in the woody plant species poplar, three representative lineages of flowering plant species are incorporated in most analyses: Arabidopsis (a model plant for annual herbaceous dicots), grape (one model plant for perennial dicots) and Oryza sativa (a model plant for monocots). In this study, we identified 10, 6, 13 and 28 WRKY III genes in the genomes of Populus trichocarpa, grape (Vitis vinifera), Arabidopsis thaliana and rice (Oryza sativa), respectively. Phylogenetic analysis revealed that the WRKY III proteins could be divided into four clades. By microsynteny analysis, we found that the duplicated regions were more conserved between poplar and grape than Arabidopsis or rice. We dated their duplications by Ks analysis of Populus WRKY III genes and demonstrated that all the blocks were formed after the divergence of monocots and dicots. Strong purifying selection has played a key role in the maintenance of WRKY III genes in Populus. Tissue expression analysis of the WRKY III genes in Populus revealed that five were most highly expressed in the xylem. We also performed quantitative real-time reverse transcription PCR analysis of WRKY III genes in Populus treated with salicylic acid, abscisic acid and polyethylene glycol to explore their stress-related expression patterns. This study highlighted the duplication and diversification of the WRKY III gene family in Populus and provided a comprehensive analysis of this gene family in the Populus genome. Our results indicated that the majority of WRKY III genes of Populus was expanded by large-scale gene duplication. The expression pattern of PtrWRKYIII gene identified that these genes play important roles in the xylem during poplar growth and development, and may play crucial role in defense to drought

  3. Natural Selection and Recombination Rate Variation Shape Nucleotide Polymorphism Across the Genomes of Three Related Populus Species.

    Science.gov (United States)

    Wang, Jing; Street, Nathaniel R; Scofield, Douglas G; Ingvarsson, Pär K

    2016-03-01

    A central aim of evolutionary genomics is to identify the relative roles that various evolutionary forces have played in generating and shaping genetic variation within and among species. Here we use whole-genome resequencing data to characterize and compare genome-wide patterns of nucleotide polymorphism, site frequency spectrum, and population-scaled recombination rates in three species of Populus: Populus tremula, P. tremuloides, and P. trichocarpa. We find that P. tremuloides has the highest level of genome-wide variation, skewed allele frequencies, and population-scaled recombination rates, whereas P. trichocarpa harbors the lowest. Our findings highlight multiple lines of evidence suggesting that natural selection, due to both purifying and positive selection, has widely shaped patterns of nucleotide polymorphism at linked neutral sites in all three species. Differences in effective population sizes and rates of recombination largely explain the disparate magnitudes and signatures of linked selection that we observe among species. The present work provides the first phylogenetic comparative study on a genome-wide scale in forest trees. This information will also improve our ability to understand how various evolutionary forces have interacted to influence genome evolution among related species. Copyright © 2016 by the Genetics Society of America.

  4. Populus (Salicaceae plantations

    Directory of Open Access Journals (Sweden)

    Gonzalo M. Romano

    2013-01-01

    Full Text Available Aunque los cultivos forestales son comunidades artificiales, modifican condiciones ambientales que pueden alterar la diversidad fúngica nativa. Se estudiaron los efectos del manejo forestal de una plantación de sauces (Salix y álamos (Populus sobre la biodiversidad de Agaromycetes durante un año en una isla del Delta del Paraná, Argentina. Se midieron el peso seco y el número de basidiomas. Se identificaron 28 especies pertenecientes a los Agaricomycetes: 26 especies de Agaricales, una de Polyporales y una de Russulales. Nuestros resultados sugieren que el manejo forestal de dicha plantación no afecta la abundancia ni la diversidad de basidiomas de Agaricomycetes.

  5. Increasing the productivity of biomass plantations of Populus species and hybrids in the Pacific Northwest. Final report, September 14, 1981--December 31, 1996

    Energy Technology Data Exchange (ETDEWEB)

    DeBell, D.S.; Harrington, C.A.; Clendenen, G.W. [USDA Forest Service, Olympia, WA (United States)] [and others

    1997-08-01

    This final report represents the culmination of eight years of biological research devoted to increasing the productivity of short rotation plantations of Populus trichocarpa and Populus hybrids in the Pacific Northwest. Studies described herein provide an understanding of tree growth, stand development and biomass yield at various spacings, and how patterns thereof differ by Populus clone in monoclonal and polyclonal plantings. Also included is some information about factors related to wind damage in Populus plantings, use of leaf size as a predictor of growth potential, and approaches for estimating tree and stand biomass and biomass growth. The work was accomplished in three research plantations, all established cooperatively with the Washington State Department of Natural Resources (DNR) and located at the DNR Tree Improvement Center near Olympia. The first plantation was established in Spring 1986 to evaluate the highly touted {open_quotes}woodgrass{close_quotes} concept and compare it with more conventional short-rotation management regimes, using two Populus hybrid clones planted at five spacings. Besides providing scientific data to resolve the politicized {open_quotes}wood-grass{close_quotes} dispute, this plantation has furnished excellent data on stand dynamics and woody biomass yield. A second plantation was established at the same time; groups of trees therein received two levels of irrigation and different amounts of four fertilizer amendments, resulting in microsites with diverse moisture and nutrient conditions.

  6. Ambrosia Beetle (Coleoptera: Scolytidae) Species, Flight, and Attack on Living Eastern Cottonwood Trees.

    Energy Technology Data Exchange (ETDEWEB)

    Coyle, D R; D.C. Booth: M.S. Wallace

    2005-12-01

    ABSTRACT In spring 2002, ambrosia beetles (Coleoptera: Scolytidae) infested an intensively managed 22-ha tree plantation on the upper coastal plain of South Carolina. Nearly 3,500 scolytids representing 28 species were captured in ethanol-baited traps from 18 June 2002 to 18 April 2004. More than 88% of total captures were exotic species. Five species [Dryoxylon onoharaensum (Murayama), Euwallacea validus (Eichhoff), Pseudopityophthorus minutissimus (Zimmermann), Xyleborus atratus Eichhoff, and Xyleborus impressus Eichhoff]) were collected in South Carolina for the first time. Of four tree species in the plantation, eastern cottonwood, Populus deltoides Bartram, was the only one attacked, with nearly 40% of the trees sustaining ambrosia beetle damage. Clone ST66 sustained more damage than clone S7C15. ST66 trees receiving fertilization were attacked more frequently than trees receiving irrigation, irrigation_fertilization, or controls, although the number of S7C15 trees attacked did not differ among treatments. The study location is near major shipping ports; our results demonstrate the necessity for intensive monitoring programs to determine the arrival, spread, ecology, and impact of exotic scolytids.

  7. Tree mortality in mature riparian forest: Implications for Fremont cottonwood conservation in the American southwest

    Science.gov (United States)

    Andersen, Douglas

    2015-01-01

    Mature tree mortality rates are poorly documented in desert riparian woodlands. I monitored deaths and calculated annual survivorship probability (Ps) in 2 groups of large (27–114 cm DBH), old (≥40 years old) Fremont cottonwood (Populus fremontii Wats.) in a stand along the free-flowing Yampa River in semiarid northwestern Colorado. Ps = 0.993 year-1 in a group (n = 126) monitored over 2003–2013, whereas Ps = 0.985 year-1 in a group (n = 179) monitored over the same period plus 3 earlier years (2000–2003) that included drought and a defoliating insect outbreak. Assuming Ps was the same for both groups during the 10-year postdrought period, the data indicate that Ps = 0.958 year-1 during the drought. I found no difference in canopy dieback level between male and female survivors. Mortality was equal among size classes, suggesting Ps is independent of age, but published longevity data imply that either Ps eventually declines with age or, as suggested in this study, periods with high Ps are interrupted by episodes of increased mortality. Stochastic population models featuring episodes of low Ps suggest a potential for an abrupt decline in mature tree numbers where recruitment is low. The modeling results have implications for woodland conservation, especially for relictual stands along regulated desert rivers.

  8. Microsatellite DNA fingerprinting, differentiation, and genetic relationships of clones, cultivars, and varieties of six poplar species from three sections of the genus Populus.

    Science.gov (United States)

    Rahman, Muhammad H; Rajora, Om P

    2002-12-01

    Accurate identification of Populus clones and cultivars is essential for effective selection, breeding, and genetic resource management programs. The unit of cultivation and breeding in poplars is a clone, and individual cultivars are normally represented by a single clone. Microsatellite DNA markers of 10 simple sequence repeat loci were used for genetic fingerprinting and differentiation of 96 clones/cultivars and varieties belonging to six Populus species (P. deltoides, P. nigra, P. balsamifera, P. trichocarpa, P. grandidentata, and P maximowiczii) from three sections of the genus. All 96 clones/cultivars could be uniquely fingerprinted based on their single- or multilocus microsatellite genotypes. The five P. grandidentata clones could be differentiated based on their single-locus genotypes, while six clones of P. trichocarpa and 11 clones of P. maximowiczii could be identified by their two-locus genotypes. Twenty clones of P. deltoides and 25 clones of P. nigra could be differentiated by their multilocus genotypes employing three loci, and 29 clones of P. balsamifera required the use of multilocus genotypes at five loci for their genetic fingerprinting and differentiation. The loci PTR3, PTR5, and PTR7 were found to be the most informative for genetic fingerprinting and differentiation of the clones. The mean number of alleles per locus ranged from 2.9 in P. trichocarpa or P. grandidentata to 6.0 in P. balsamifera and 11.2 in 96 clones of the six species. The mean number of observed genotypes per locus ranged from 2.4 in P. grandidentata to 7.4 in P. balsamifera and 19.6 in 96 clones of the six species. The mean number of unique genotypes per locus ranged from 1.3 in P. grandidentata to 3.9 in P. deltoides and 8.8 in 96 clones of the six species. The power of discrimination of the microsatellite DNA markers in the 96 clones ranged from 0.726 for PTR4 to 0.939 for PTR7, with a mean of 0.832 over the 10 simple sequence repeat loci. Clones/cultivars from the same

  9. Nitrogen Fertilization Increases Cottonwood Growth on Old-Field Soil

    Science.gov (United States)

    B. G. Blackmon; E. H. White

    1972-01-01

    Nitrogen (150 lb ./acre as NH4N03 ) applied to a 6-year-old eastern cottonwood plantation in an old field on Commerce silt loam soil increased diameter, basal area, and volume growth by 200 percent over untreated controls. The plantation did not respond to 100 pounds P per acre from concentrated superphosphate.

  10. Status and Trend of Cottonwood Forests Along the Missouri River

    Science.gov (United States)

    2010-03-03

    Rhamnus davurica), green ash, chokecherry ( Prunus virginiana ), and some Russian olive (Figure 30a). Younger cottonwood (all sapling stands, and...argentea), common chokecherry ( Prunus virginiana ), service berry (Amelanchier spp.) and rarely, red-osier dogwood (Cornus stolonifera) (Figure 32). In...sagebrush (Artemisia cana), common chokecherry ( Prunus virginiana ), and rarely, red-osier dogwood (Cornus stolonifera) (Ross and Hunter 1976, Scott

  11. Subcellular localization of cadmium in hyperaccumulator Populus ...

    African Journals Online (AJOL)

    In this study, subcellular localization of cadmium in hyperaccumulator grey poplar (Populus × canescens) was investigated by the transmission electron microscopy (TEM) method. Young Populus × canescens were grown and hydroponic experiments were conducted under four Cd2+ concentrations (10, 30, 50, and 70 μM) ...

  12. Diversity of Pseudomonas Genomes, Including Populus-Associated Isolates, as Revealed by Comparative Genome Analysis.

    Science.gov (United States)

    Jun, Se-Ran; Wassenaar, Trudy M; Nookaew, Intawat; Hauser, Loren; Wanchai, Visanu; Land, Miriam; Timm, Collin M; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A; Ussery, David W

    2016-01-01

    The Pseudomonas genus contains a metabolically versatile group of organisms that are known to occupy numerous ecological niches, including the rhizosphere and endosphere of many plants. Their diversity influences the phylogenetic diversity and heterogeneity of these communities. On the basis of average amino acid identity, comparative genome analysis of >1,000 Pseudomonas genomes, including 21 Pseudomonas strains isolated from the roots of native Populus deltoides (eastern cottonwood) trees resulted in consistent and robust genomic clusters with phylogenetic homogeneity. All Pseudomonas aeruginosa genomes clustered together, and these were clearly distinct from other Pseudomonas species groups on the basis of pangenome and core genome analyses. In contrast, the genomes of Pseudomonas fluorescens were organized into 20 distinct genomic clusters, representing enormous diversity and heterogeneity. Most of our 21 Populus-associated isolates formed three distinct subgroups within the major P. fluorescens group, supported by pathway profile analysis, while two isolates were more closely related to Pseudomonas chlororaphis and Pseudomonas putida. Genes specific to Populus-associated subgroups were identified. Genes specific to subgroup 1 include several sensory systems that act in two-component signal transduction, a TonB-dependent receptor, and a phosphorelay sensor. Genes specific to subgroup 2 contain hypothetical genes, and genes specific to subgroup 3 were annotated with hydrolase activity. This study justifies the need to sequence multiple isolates, especially from P. fluorescens, which displays the most genetic variation, in order to study functional capabilities from a pangenomic perspective. This information will prove useful when choosing Pseudomonas strains for use to promote growth and increase disease resistance in plants. Copyright © 2015 Jun et al.

  13. Hsf and Hsp gene families in Populus: genome-wide identification, organization and correlated expression during development and in stress responses.

    Science.gov (United States)

    Zhang, Jin; Liu, Bobin; Li, Jianbo; Zhang, Li; Wang, Yan; Zheng, Huanquan; Lu, Mengzhu; Chen, Jun

    2015-03-14

    Heat shock proteins (Hsps) are molecular chaperones that are involved in many normal cellular processes and stress responses, and heat shock factors (Hsfs) are the transcriptional activators of Hsps. Hsfs and Hsps are widely coordinated in various biological processes. Although the roles of Hsfs and Hsps in stress responses have been well characterized in Arabidopsis, their roles in perennial woody species undergoing various environmental stresses remain unclear. Here, a comprehensive identification and analysis of Hsf and Hsp families in poplars is presented. In Populus trichocarpa, we identified 42 paralogous pairs, 66.7% resulting from a whole genome duplication. The gene structure and motif composition are relatively conserved in each subfamily. Microarray and quantitative real-time RT-PCR analyses showed that most of the Populus Hsf and Hsp genes are differentially expressed upon exposure to various stresses. A coexpression network between Populus Hsf and Hsp genes was generated based on their expression. Coordinated relationships were validated by transient overexpression and subsequent qPCR analyses. The comprehensive analysis indicates that different sets of PtHsps are downstream of particular PtHsfs and provides a basis for functional studies aimed at revealing the roles of these families in poplar development and stress responses.

  14. Growth of Populus and Salix Species under Compost Leachate Irrigation

    OpenAIRE

    Tooba Abedi; Shamim Moghaddami; Ebrahim Lashkar Bolouki

    2014-01-01

    According to the known broad variation in remediation capacity, three plant species were used in the experiment: two fast growing poplar’s clones - Populus deltoides, Populus euramericana, and willows Salix alba. Populus and Salix cuttings were collected from the nursery of the Populus Research Center of Safrabasteh in the eastern part of Guilan province at north of Iran. The Populus clones were chosen because of their high biomass production capacity and willow- because it is native in Iran....

  15. Dendrogeochronologic and Anatomic Analysis of Excavated Plains Cottonwoods Determine Overbank Sedimentation Rates and Historical Channel Positions Along the Interior of a Migrating Meander Bend, Powder River, Montana

    Science.gov (United States)

    Metzger, T. L.; Pizzuto, J. E.; Schook, D. M.; Hasse, T. R.; Affinito, R. A.

    2017-12-01

    Dendrochronological dating of buried trees precisely determines the germination year and identifies the stratigraphic context of germination for the trees. This recently developed application of dendrochronology provides accurate time-averaged sedimentation rates of overbank deposition along floodplains and can be used to identify burial events. Previous studies have demonstrated that tamarisk (Tamarix ramosissima) and sandbar willow (Salix exigua) develop anatomical changes within the tree rings (increased vessel size and decreased ring widths) on burial, but observations of plains cottonwood (Populus deltoides ssp. monilifera) are lacking. In September 2016 and June 2017, five buried plains cottonwoods were excavated along a single transect of the interior of a meander bend of the Powder River, Montana. Sediment samples were obtained near each tree for 210Pb and 137Cs dating, which will allow for comparison between dendrochronological and isotopic dating methods. The plains cottonwood samples collected exhibit anatomical changes associated with burial events that are observed in other species. All trees germinated at the boundary between thinly bedded fine sand and mud and coarse sand underlain by sand and gravel, indicating plains cottonwoods germinate on top of point bars prior to overbank deposition. The precise germination age and depth provide elevations and minimum age constraints for the point bar deposits and maximum ages for the overlying sediment, helping constrain past channel positions and overbank deposition rates. Germination years of the excavated trees, estimated from cores taken 1.5 m above ground level, range from 2014 to 1862. Accurate establishment years determined by cross-dating the buried section of the tree can add an additional 10 years to the cored age. The sedimentation rate and accumulation thickness varied with tree age. The germination year, total sediment accumulation, and average sedimentation rate at the five sampled trees is

  16. Production costs for SRIC Populus biomass

    International Nuclear Information System (INIS)

    Strauss, C.H.

    1991-01-01

    Production costs for short rotation, intensive culture (SRIC) Populus biomass were developed from commercial-sized plantations under investigation throughout the US. Populus hybrid planted on good quality agricultural sites at a density of 850 cuttings/acre was projected to yield an average of 7 ovendry (OD) tons/acre/year. Discounted cash-flow analysis of multiple rotations showed preharvest production costs of $14/ton (OD). Harvesting and transportation expenses would increase the delivered cost to $35/ton (OD). Although this total cost compared favorably with the regional market price for aspen (Populus tremuloides), future investments in SRIC systems will require the development of biomass energy markets

  17. Developmental and environmental regulation of Aquaporin gene expression across Populus species: divergence or redundancy?

    Science.gov (United States)

    Cohen, David; Bogeat-Triboulot, Marie-Béatrice; Vialet-Chabrand, Silvère; Merret, Rémy; Courty, Pierre-Emmanuel; Moretti, Sébastien; Bizet, François; Guilliot, Agnès; Hummel, Irène

    2013-01-01

    Aquaporins (AQPs) are membrane channels belonging to the major intrinsic proteins family and are known for their ability to facilitate water movement. While in Populus trichocarpa, AQP proteins form a large family encompassing fifty-five genes, most of the experimental work focused on a few genes or subfamilies. The current work was undertaken to develop a comprehensive picture of the whole AQP gene family in Populus species by delineating gene expression domain and distinguishing responsiveness to developmental and environmental cues. Since duplication events amplified the poplar AQP family, we addressed the question of expression redundancy between gene duplicates. On these purposes, we carried a meta-analysis of all publicly available Affymetrix experiments. Our in-silico strategy controlled for previously identified biases in cross-species transcriptomics, a necessary step for any comparative transcriptomics based on multispecies design chips. Three poplar AQPs were not supported by any expression data, even in a large collection of situations (abiotic and biotic constraints, temporal oscillations and mutants). The expression of 11 AQPs was never or poorly regulated whatever the wideness of their expression domain and their expression level. Our work highlighted that PtTIP1;4 was the most responsive gene of the AQP family. A high functional divergence between gene duplicates was detected across species and in response to tested cues, except for the root-expressed PtTIP2;3/PtTIP2;4 pair exhibiting 80% convergent responses. Our meta-analysis assessed key features of aquaporin expression which had remained hidden in single experiments, such as expression wideness, response specificity and genotype and environment interactions. By consolidating expression profiles using independent experimental series, we showed that the large expansion of AQP family in poplar was accompanied with a strong divergence of gene expression, even if some cases of functional redundancy

  18. Developmental and environmental regulation of Aquaporin gene expression across Populus species: divergence or redundancy?

    Directory of Open Access Journals (Sweden)

    David Cohen

    Full Text Available Aquaporins (AQPs are membrane channels belonging to the major intrinsic proteins family and are known for their ability to facilitate water movement. While in Populus trichocarpa, AQP proteins form a large family encompassing fifty-five genes, most of the experimental work focused on a few genes or subfamilies. The current work was undertaken to develop a comprehensive picture of the whole AQP gene family in Populus species by delineating gene expression domain and distinguishing responsiveness to developmental and environmental cues. Since duplication events amplified the poplar AQP family, we addressed the question of expression redundancy between gene duplicates. On these purposes, we carried a meta-analysis of all publicly available Affymetrix experiments. Our in-silico strategy controlled for previously identified biases in cross-species transcriptomics, a necessary step for any comparative transcriptomics based on multispecies design chips. Three poplar AQPs were not supported by any expression data, even in a large collection of situations (abiotic and biotic constraints, temporal oscillations and mutants. The expression of 11 AQPs was never or poorly regulated whatever the wideness of their expression domain and their expression level. Our work highlighted that PtTIP1;4 was the most responsive gene of the AQP family. A high functional divergence between gene duplicates was detected across species and in response to tested cues, except for the root-expressed PtTIP2;3/PtTIP2;4 pair exhibiting 80% convergent responses. Our meta-analysis assessed key features of aquaporin expression which had remained hidden in single experiments, such as expression wideness, response specificity and genotype and environment interactions. By consolidating expression profiles using independent experimental series, we showed that the large expansion of AQP family in poplar was accompanied with a strong divergence of gene expression, even if some cases of

  19. Practical breeding of cottonwood in the north-central region

    Science.gov (United States)

    Carl A. Mohn

    1973-01-01

    More than 20 years ago Scott Pauley (1949) designated the genus Populus as the "guinea pig of forest-tree breeding. This designation is still appropriate as evidenced by the steady, almost overwhelming, stream of publications related to the genetics and breeding of poplars. A good indication of the scope and depth of genetic work with poplars...

  20. Leaf water relations and sapflow in eastern cottonwood (Populus deltoides Bartr.) trees planted for phytoremediation of a groundwater pollutant

    Science.gov (United States)

    James M. Vose; Wayne T. Swank; Gregory J. Harvey; Barton D. Clinton; Christine Sobek

    2000-01-01

    Plants that remediate groundwater pollutants may offer a feasible alternative to the traditional and more expensive practices. Because its success depends on water use, this approach requires a complete understanding of species-specific transpiration patterns. The objectives of this study were (1) to quantify tree and stand-level transpiration in two age classes (whips...

  1. Protein (Viridiplantae): 224169381 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5297 3694:5297 predicted protein Populus trichocarpa MMINVVFAADSGLGSDAVFAADAEIGSDAVFAADSGLGSDAVFAADAEIGSDAVFAADSGLGSDAVFAADSGLVFAA...DSGLGNDAVFAADSGLGSDAVFAADAEIDSDAVFAADSGMGSDAAFAADSGLGSDAVFAADAEISSDAVFAADSGLGSDAVFAA...HFLIGSDAVFAADAEIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRGKTDFR ...

  2. Characterization of genomic sequence showing strong association with polyembryony among diverse Citrus species and cultivars, and its synteny with Vitis and Populus.

    Science.gov (United States)

    Nakano, Michiharu; Shimada, Takehiko; Endo, Tomoko; Fujii, Hiroshi; Nesumi, Hirohisa; Kita, Masayuki; Ebina, Masumi; Shimizu, Tokurou; Omura, Mitsuo

    2012-02-01

    Polyembryony, in which multiple somatic nucellar cell-derived embryos develop in addition to the zygotic embryo in a seed, is common in the genus Citrus. Previous genetic studies indicated polyembryony is mainly determined by a single locus, but the underlying molecular mechanism is still unclear. As a step towards identification and characterization of the gene or genes responsible for nucellar embryogenesis in Citrus, haplotype-specific physical maps around the polyembryony locus were constructed. By sequencing three BAC clones aligned on the polyembryony haplotype, a single contiguous draft sequence consisting of 380 kb containing 70 predicted open reading frames (ORFs) was reconstructed. Single nucleotide polymorphism genotypes detected in the sequenced genomic region showed strong association with embryo type in Citrus, indicating a common polyembryony locus is shared among widely diverse Citrus cultivars and species. The arrangement of the predicted ORFs in the characterized genomic region showed high collinearity to the genomic sequence of chromosome 4 of Vitis vinifera and linkage group VI of Populus trichocarpa, suggesting that the syntenic relationship among these species is conserved even though V. vinifera and P. trichocarpa are non-apomictic species. This is the first study to characterize in detail the genomic structure of an apomixis locus determining adventitious embryony. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  3. A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

    2014-04-14

    Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

  4. A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

    2015-04-15

    Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

  5. Development of a spatially-distributed hydroecological model to simulate cottonwood seedling recruitment along rivers.

    Science.gov (United States)

    Benjankar, Rohan; Burke, Michael; Yager, Elowyn; Tonina, Daniele; Egger, Gregory; Rood, Stewart B; Merz, Norm

    2014-12-01

    Dam operations have altered flood and flow patterns and prevented successful cottonwood seedling recruitment along many rivers. To guide reservoir flow releases to meet cottonwood recruitment needs, we developed a spatially-distributed, GIS-based model that analyzes the hydrophysical requirements for cottonwood recruitment. These requirements are indicated by five physical parameters: (1) annual peak flow timing relative to the interval of seed dispersal, (2) shear stress, which characterizes disturbance, (3) local stage recession after seedling recruitment, (4) recruitment elevation above base flow stage, and (5) duration of winter flooding, which may contribute to seedling mortality. The model categorizes the potential for cottonwood recruitment in four classes and attributes a suitability value at each individual spatial location. The model accuracy was estimated with an error matrix analysis by comparing simulated and field-observed recruitment success. The overall accuracies of this Spatially-Distributed Cottonwood Recruitment model were 47% for a braided reach and 68% for a meander reach along the Kootenai River in Idaho, USA. Model accuracies increased to 64% and 72%, respectively, when fewer favorability classes were considered. The model predicted areas of similarly favorable recruitment potential for 1997 and 2006, two recent years with successful cottonwood recruitment. This model should provide a useful tool to quantify impacts of human activities and climatic variability on cottonwood recruitment, and to prescribe instream flow regimes for the conservation and restoration of riparian woodlands. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Eucalyptus and Populus short rotation woody crops for phosphate mined lands in Florida USA

    Energy Technology Data Exchange (ETDEWEB)

    Rockwood, D L; Carter, D R; Langholtz, M H [The School of Forest Resources and Conservation, University of Florida, Box 110410, Gainesville, FL 32611 0410 (United States); Stricker, J A [Polk County Extension Service, University of Florida, Gainesville, FL 32611 (United States)

    2006-08-15

    Our short-rotation woody crops (SRWC) research in central and southern Florida is (1) developing superior Eucalyptus grandis (EG), E. amplifolia (EA), and cottonwood (Populus deltoides, PD) genotypes, (2) determining appropriate management practices for and associated productivities of these genotypes, and (3) assessing their economics and markets. Reclaimed clay settling areas (CSA) and overburden sites in phosphate mined areas in central Florida are a potential land base of over 80,000ha for SRWC production. On CSAs, PD grows well in the absence of cogongrass (Imperata cylindrica) but is not as productive as the non-invasive EG and EA. SRWC establishment on CSAs requires strict implementation of the following cultural practices: thorough site preparation through herbiciding/disking and bedding, superior trees, watering/packing seedlings, fertilization with ammonium nitrate at planting and annually thereafter as feasible, high planting density possibly including double row planting, and winter harvesting so that coppice regeneration suppresses weeds. PD cultural requirements, that may require post-planting weed control to suppress herbaceous competition, exceed those of the eucalypts. EG SRWCs on CSAs are at risk of blowdown 3-4 years after planting or coppicing; younger PD, EG, and EA SRWCs appear much less susceptible to wind damage. Genetic improvement must continue if EG, EA, and PD are to increase in commercial feasibility. SRWC cost competitiveness will depend on establishment success, yield improvements, harvesting costs, and identifying/using incentives. Strong collaboration among public and private partners is necessary for commercializing SRWCs in Florida. (author)

  7. Genome-wide Identification of WRKY Genes in the Desert Poplar Populus euphratica and Adaptive Evolution of the Genes in Response to Salt Stress.

    Science.gov (United States)

    Ma, Jianchao; Lu, Jing; Xu, Jianmei; Duan, Bingbing; He, Xiaodong; Liu, Jianquan

    2015-01-01

    WRKY transcription factors play important roles in plant development and responses to various stresses in plants. However, little is known about the evolution of the WRKY genes in the desert poplar species Populus euphratica, which is highly tolerant of salt stress. In this study, we identified 107 PeWRKY genes from the P. euphratica genome and examined their evolutionary relationships with the WRKY genes of the salt-sensitive congener Populus trichocarpa. Ten PeWRKY genes are specific to P. euphratica, and five of these showed altered expression under salt stress. Furthermore, we found that two pairs of orthologs between the two species showed evidence of positive evolution, with dN/dS ratios>1 (nonsynonymous/synonymous substitutions), and both of them altered their expression in response to salinity stress. These findings suggested that both the development of new genes and positive evolution in some orthologs of the WRKY gene family may have played an important role in the acquisition of high salt tolerance by P. euphratica.

  8. Allelopathic potential of populus euphratica olivier

    International Nuclear Information System (INIS)

    Sher, Z.; Hussain, F.; Ahmad, B.; Wahab, M.

    2011-01-01

    Populus euphratica Olivier is frequently cultivated deciduous tree in Pakistan on agricultural land for its shade, fodder, timber and fuel wood. A relatively reduced under storey is often observed below it. Therefore the present study was conducted to assess the allelopathic potential of Populus euphratica against some crop species. Plant material of Populus euphratica were collected from the agriculture fields of Lahor, District Swabi in 2008 and were dried at room temperature (258 deg. C-308 deg. C). Allelopathic studies conducted by using aqueous extracts from various parts including young leaves, mature leaves, bark, litter and mulching in various experiments invariably retarded the germination, plumule, radical growth, fresh and dry weight of Sorghum vulgare Perse, Setaria italica (L.) P. Beauv and Triticum aestivum L., in laboratory experiments. The aqueous extracts obtained after 48 h were more inhibitory than 24 h. Leaves were more toxic than bark. Litter and mulching experiments also proved to be inhibitory. It is suggested that the various assayed parts of Populus euphratica have strong allelopathic potential at least against the tested species. Further investigation is required to see its allelopathic behavior under field condition against its associated species and to identify the toxic principles. (author)

  9. Phytoremediation of landfill leachate using Populus

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Richard B. Hall; Bart Sexton

    2006-01-01

    Proper genotype selection is required for successful phytoremediation. We selected eight Populus clones (NC13460, NC14018, DM115, NC14104, NC14106, DN5, NM2, NM6) of four genomic groups after three cycles of phyto-recurrent selection for a field trial that began June 2005 at the Oneida County Landfill in Rhinelander, WI, USA.

  10. Barcoding poplars (Populus L. from western China.

    Directory of Open Access Journals (Sweden)

    Jianju Feng

    Full Text Available BACKGROUND: Populus is an ecologically and economically important genus of trees, but distinguishing between wild species is relatively difficult due to extensive interspecific hybridization and introgression, and the high level of intraspecific morphological variation. The DNA barcoding approach is a potential solution to this problem. METHODOLOGY/PRINCIPAL FINDINGS: Here, we tested the discrimination power of five chloroplast barcodes and one nuclear barcode (ITS among 95 trees that represent 21 Populus species from western China. Among all single barcode candidates, the discrimination power is highest for the nuclear ITS, progressively lower for chloroplast barcodes matK (M, trnG-psbK (G and psbK-psbI (P, and trnH-psbA (H and rbcL (R; the discrimination efficiency of the nuclear ITS (I is also higher than any two-, three-, or even the five-locus combination of chloroplast barcodes. Among the five combinations of a single chloroplast barcode plus the nuclear ITS, H+I and P+I differentiated the highest and lowest portion of species, respectively. The highest discrimination rate for the barcodes or barcode combinations examined here is 55.0% (H+I, and usually discrimination failures occurred among species from sympatric or parapatric areas. CONCLUSIONS/SIGNIFICANCE: In this case study, we showed that when discriminating Populus species from western China, the nuclear ITS region represents a more promising barcode than any maternally inherited chloroplast region or combination of chloroplast regions. Meanwhile, combining the ITS region with chloroplast regions may improve the barcoding success rate and assist in detecting recent interspecific hybridizations. Failure to discriminate among several groups of Populus species from sympatric or parapatric areas may have been the result of incomplete lineage sorting, frequent interspecific hybridizations and introgressions. We agree with a previous proposal for constructing a tiered barcoding system in

  11. Genotyping-by-sequencing for Populus population genomics: an assessment of genome sampling patterns and filtering approaches.

    Directory of Open Access Journals (Sweden)

    Martin P Schilling

    Full Text Available Continuing advances in nucleotide sequencing technology are inspiring a suite of genomic approaches in studies of natural populations. Researchers are faced with data management and analytical scales that are increasing by orders of magnitude. With such dramatic advances comes a need to understand biases and error rates, which can be propagated and magnified in large-scale data acquisition and processing. Here we assess genomic sampling biases and the effects of various population-level data filtering strategies in a genotyping-by-sequencing (GBS protocol. We focus on data from two species of Populus, because this genus has a relatively small genome and is emerging as a target for population genomic studies. We estimate the proportions and patterns of genomic sampling by examining the Populus trichocarpa genome (Nisqually-1, and demonstrate a pronounced bias towards coding regions when using the methylation-sensitive ApeKI restriction enzyme in this species. Using population-level data from a closely related species (P. tremuloides, we also investigate various approaches for filtering GBS data to retain high-depth, informative SNPs that can be used for population genetic analyses. We find a data filter that includes the designation of ambiguous alleles resulted in metrics of population structure and Hardy-Weinberg equilibrium that were most consistent with previous studies of the same populations based on other genetic markers. Analyses of the filtered data (27,910 SNPs also resulted in patterns of heterozygosity and population structure similar to a previous study using microsatellites. Our application demonstrates that technically and analytically simple approaches can readily be developed for population genomics of natural populations.

  12. Exploiting the transcriptome of Euphrates Poplar, Populus euphratica (Salicaceae to develop and characterize new EST-SSR markers and construct an EST-SSR database.

    Directory of Open Access Journals (Sweden)

    Fang K Du

    Full Text Available BACKGROUND: Microsatellite markers or Simple Sequence Repeats (SSRs are the most popular markers in population/conservation genetics. However, the development of novel microsatellite markers has been impeded by high costs, a lack of available sequence data and technical difficulties. New species-specific microsatellite markers were required to investigate the evolutionary history of the Euphratica tree, Populus euphratica, the only tree species found in the desert regions of Western China and adjacent Central Asian countries. METHODOLOGY/PRINCIPAL FINDINGS: A total of 94,090 non-redundant Expressed Sequence Tags (ESTs from P. euphratica comprising around 63 Mb of sequence data were searched for SSRs. 4,202 SSRs were found in 3,839 ESTs, with 311 ESTs containing multiple SSRs. The most common motif types were trinucleotides (37% and hexanucleotides (33% repeats. We developed primer pairs for all of the identified EST-SSRs (eSSRs and selected 673 of these pairs at random for further validation. 575 pairs (85% gave successful amplification, of which, 464 (80.7% were polymorphic in six to 24 individuals from natural populations across Northern China. We also tested the transferability of the polymorphic eSSRs to nine other Populus species. In addition, to facilitate the use of these new eSSR markers by other researchers, we mapped them onto Populus trichocarpa scaffolds in silico and compiled our data into a web-based database (http://202.205.131.253:8080/poplar/resources/static_page/index.html. CONCLUSIONS: The large set of validated eSSRs identified in this work will have many potential applications in studies on P. euphratica and other poplar species, in fields such as population genetics, comparative genomics, linkage mapping, QTL, and marker-assisted breeding. Their use will be facilitated by their incorporation into a user-friendly web-based database.

  13. Populus species from diverse habitats maintain high night-time conductance under drought.

    Science.gov (United States)

    Cirelli, Damián; Equiza, María Alejandra; Lieffers, Victor James; Tyree, Melvin Thomas

    2016-02-01

    We investigated the interspecific variability in nocturnal whole-plant stomatal conductance under well-watered and drought conditions in seedlings of four species of Populus from habitats characterized by abundant water supply (mesic and riparian) or from drier upland sites. The study was carried out to determine whether (i) nocturnal conductance varies across different species of Populus according to their natural habitat, (ii) nocturnal conductance is affected by water stress similarly to daytime conductance based on species habitat and (iii) differences in conductance among species could be explained partly by differences in stomatal traits. We measured whole-plant transpiration and conductance (G) of greenhouse-grown seedlings using an automated high-resolution gravimetric technique. No relationship was found between habitat preference and daytime G (GD), but night-time G (GN) was on average 1.5 times higher in riparian and mesic species (P. deltoides Bartr. ex Marsh. and P. trichocarpa Torr. & Gray) than in those from drier environments (P. tremuloides Michx. and P. × petrowskyana Schr.). GN was not significantly reduced under drought in riparian species. Upland species restricted GN significantly in response to drought, but it was still at least one order of magnitude greater that the cuticular conductance until leaf death was imminent. Under both well-watered and drought conditions, GN declined with increasing vapour pressure deficit (D). Also, a small increase in GN towards the end of the night period was observed in P. deltoides and P. × petrowskyana, suggesting the involvement of endogenous regulation. The anatomical analyses indicated a positive correlation between G and variable stomatal pore index among species and revealed that stomata are not likely to be leaky but instead seem capable of complete occlusion, which raises the question of the possible physiological role of the significant GN observed under drought. Further comparisons among

  14. Establishment and early management of Populus species in southern Sweden

    OpenAIRE

    Mc Carthy, Rebecka

    2016-01-01

    Populus species are among the most productive tree species in Sweden. Interest in growing them has increased during the 21st century due to political goals to increase the share of renewable energy and to increase the proportion of hardwood species in forests. Populus species have been shown to be potentially profitable, but currently they are mostly planted on abandoned agricultural land. There is a lack of knowledge about the establishment of Populus species on forest sites. There is also a...

  15. VEGETATIVNO RAZMNOŽEVANJE TOPOLOV (Populus spp.) S POTAKNJENCI

    OpenAIRE

    Sternad, Rebeka

    2010-01-01

    Raziskava je bila opravljena na treh vrstah topolov: črnem topolu (Populus nigra L.), belem topolu (Populus alba L.) in trepetliki (Populus tremula L.). Namen diplomskega dela je bil proučiti ukoreninjenje potaknjencev topolov glede na okolje koreninjenja, termin potikanja in vrsto uporabljenega substrata. Zeleni in pololeseneli potaknjenci so bili večinoma nabrani v okolici celjske regije in Žalca. Koreninjeni so bili v šestih terminih (od junija do septembra) v okolju meglenja in neposredne...

  16. PHYTOREMEDIATION OF CHLORPYRIFOS BY POPULUS AND SALIX

    OpenAIRE

    Young Lee, Keum; Strand, Stuart E.; Doty, Sharon L.

    2012-01-01

    Chlorpyrifos is one of the commonly used organophosphorus insecticides that are implicated in serious environmental and human health problems. To evaluate plant potential for uptake of chlorpyrifos, several plant species of poplar (Populus sp.) and willow (Salix sp.) were investigated. Chlorpyrifos was taken up from nutrient solution by all seven plant species. Significant amounts of chlorpyrifos accumulated in plant tissues, and roots accumulated higher concentrations of chlorpyrifos than di...

  17. Production, transport, and metabolism of ethanol in eastern cottonwood

    International Nuclear Information System (INIS)

    MacDonald, R.C.

    1991-01-01

    In plant tissues, the production of acetaldehyde and ethanol are usually thought to occur as a mechanism to allow tolerance of hypoxic conditions. Acetaldehyde and ethanol were found to be common in vascular cambium and the transpiration stream of trees. Ethanol concentrations in the vascular cambium of Populus deltoides were not changed by placing logs from nonflooded trees in a pure oxygen environment for as long as 96 h, but increased by almost 3 orders of magnitude when exposed to low external pO 2 s. Ethanol is present in the xylem sap of flooded and nonflooded trees. Because of the constitutive presence of alcohol dehydrogenase in the mature leaves of woody plants, it was hypothesized that the leaves and shoots of trees had the ability to metabolize ethanol supplied by the transpiration stream. 1-[ 14 C]ethanol was supplied to excised leaves and shoots of Populus deltoides Bartr. in short- and long-term experiments. Greater than 99% of the radiolabel was incorporated into plant tissue in short-term experiments, with more than 95% of the label remaining in plant tissue after 24 h. Very little label reached the leaf mesophyll cells of excised shoots, as revealed by autoradiography. Radiolabel appeared primarily in the water- and chloroform-soluble fractions in short-term experiments, while in long-term experiments, label was also incorporated into protein. When labelled ethanol was supplied to excised petioles in a 5 min pulse, 41% of the label was incorporated into organic acids. Some label was also incorporated into amino acids, protein, and the chloroform-soluble fraction, with very little appearing in neutral sugars, starch, or the insoluble pellet. Labelled organic acids were separated by HPLC, and were comprised of acetate, isocitrate, α-ketoglutarate, and succinate. There was no apparent incorporation of label into phosphorylated compounds

  18. Cavitation vulnerability in roots and shoots: does Populus euphratica Oliv., a poplar from arid areas of Central Asia, differ from other poplar species?

    Science.gov (United States)

    Hukin, D; Cochard, H; Dreyer, E; Le Thiec, D; Bogeat-Triboulot, M B

    2005-08-01

    Populus euphratica is a poplar species growing in arid regions of Central Asia, where its distribution remains nevertheless restricted to river-banks or to areas with an access to deep water tables. To test whether the hydraulic architecture of this species differs from that of other poplars with respect to this ecological distribution, the vulnerability to cavitation of P. euphratica was compared with that of P. alba and of P. trichocarpa x koreana. The occurrence of a potential hydraulic segmentation through cavitation was also investigated by assessing the vulnerability of roots, stems, and leaf mid-rib veins. Cryo-scanning electron microscopy (cryo-SEM) was used to assess the level of embolism in fine roots and leaf mid-ribs and a low pressure flowmeter (LPFM) was used for stems and main roots. The cryo-SEM technique was validated against LPFM measurements on paired samples. In P. alba and P. trichocarpa x koreana, leaf mid-ribs were more vulnerable to cavitation than stems and roots. In P. euphratica, leaf mid-ribs and stems were equally vulnerable and, contrary to what has been observed in other species, roots were significantly less vulnerable than shoots. P. euphratica was by far the most vulnerable. The water potential inducing 50% loss of conductivity in stems was close to -0.7 MPa, against approximately -1.45 MPa for the two others species. Such a large vulnerability was confirmed by recording losses of conductivity during a gradual drought. Moreover, significant stem embolism was recorded before stomatal closure, indicating the lack of an efficient safety margin for hydraulic functions in this species. Embolism was not reversed by rewatering. These observations are discussed with respect to the ecology of P. euphratica.

  19. Hydrogeochemical and stream sediment detailed geochemical survey for Thomas Range-Wasatch, Utah. Cottonwood project area

    International Nuclear Information System (INIS)

    Butz, T.R.; Bard, C.S.; Witt, D.A.; Helgerson, R.N.; Grimes, J.G.; Pritz, P.M.

    1980-01-01

    Results of Cottonwood project area of the Thomas Range-Wasatch detailed geochemical survey are reported. Field and laboratory data are presented for 15 groundwater samples, 79 stream sediment samples, and 85 radiometric readings. Statistical and areal distributions of uranium and possible uranium-related variables are given. A generalized geologic map of the project area is provided, and pertinent geologic factors which may be of significance in evaluating the potential for uranium mineralization are briefly discussed. Uranium concentrations in groundwater range from 0.25 to 3.89 ppB. The highest concentrations are from groundwaters from the Little Cottonwood and Ferguson Stocks. Variables that appear to be associated with uranium in groundwater include cobalt, iron, potassium, manganese, nickel, sulfate, and to a lesser extent, molybdenum and strontium. This association is attributed to the Monzonitic Little Cottonwood Stock, granodioritic to granitic and lamprophyric dikes, and known sulfide deposits. Soluble uranium concentrations (U-FL) in stream sediments range from 0.31 to 72.64 ppM. Total uranium concentrations (U-NT) range from 1.80 to 75.20 ppM. Thorium concentrations range from <2 to 48 ppM. Anomalous values for uranium and thorium are concentrated within the area of outcrop of the Little Cottonwood and Ferguson Stocks. Variables which are areally associated with high values of uranium, thorium, and the U-FL:U-NT ratio within the Little Cottonwood Stock are barium, copper, molybdenum, and zinc. High concentrations of these variables are located near sulfide deposits within the Little Cottonwood Stock

  20. Growth and biomass of Populus irrigated with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; David R. Coyle; Richard B. Hall

    2007-01-01

    Resource managers are challenged with waste disposal and leachate produced from its degradation. Poplar (Populus spp.) trees offer an opportunity for ecological leachate disposal as an irrigation source for managed tree systems. Our objective was to irrigate Populus trees with municipal solid waste landfill leachate or fertilized well water (control...

  1. Characterization of the photosynthetic induction response in a Populus species with stomata barely responding to light changes.

    Science.gov (United States)

    Tang, Y; Liang, N

    2000-08-01

    The photosynthetic induction response is constrained by stomatal and biochemical limitations. However, leaves in some plants like Populus koreana x trichocarpa cv. Peace (a hybrid clone) may have little stomatal limitation because their stomata barely respond to changes in photon flux density (PFD). We examined the induction responses of leaves of well-watered and dehydrated P. koreana x trichocarpa plants grown in a high-light or a low-light regime. With an increase in PFD from 50 to 500 micromol m(-2) s(-1), steady-state stomatal conductance (g(s)) increased by only 0.25-8.2%, regardless of the initial g(s), but steady-state assimilation rate (A) increased by 550-1810%. Photosynthetic induction times required to reach 50% (IT50) and 90% (IT90) of A at high PFD were 60-90 s and 210-360 s, respectively. Examination of the dynamic relationships between A and g(s), and between A and intercellular CO2 concentration, indicated that the induction limitation was imposed completely by the biochemical components within 30-40 s after the PFD increase. Values of IT50 and IT90 were significantly higher in low-light leaves than in high-light leaves, whereas the induction state at 60 s and the induction efficiency at 60 and 120 s after the increase in PFD were lower in low-light leaves than in high-light leaves. Dehydration reduced leaf water potential (psi) significantly, resulting in a significantly decreased initial g(s). Leaf water potential had no significant effects on induction time in high-light leaves, but a low psi significantly reduced the induction time in low-light leaves. We conclude that the photosynthetic induction response was limited almost completely by biochemical components because the stomata barely responded to light changes. The biochemical limitation appeared to be higher in low-light leaves than in high-light leaves. Mild water stress may have reduced steady-state A and g(s), but it had little effect on the photosynthetic induction response in high

  2. 76 FR 34197 - Anchorage; Change to Cottonwood Island Anchorage, Columbia River, Oregon and Washington

    Science.gov (United States)

    2011-06-13

    ... Cottonwood Island in the vicinity of the spoil area to approximately the Kalama North dock and the previous... litigation, eliminate ambiguity, and reduce burden. Protection of Children We have analyzed this proposed rule under Executive Order 13045, Protection of Children from Environmental Health Risks and Safety...

  3. Survival and Growth of Cottonwood Clones After Angle Planting and Base Angle Treatments

    Science.gov (United States)

    W.K. Randall; Harvey E. Kennedy

    1976-01-01

    Presently, commercial cottonwood plantations in the lower Mississippi Valley are established using vertically planted, unrooted cuttings with a flat (90°) base. Neither survival nor first-year growth of a group of six Stoneville clones was improved by angle planting or cutting base angles diagonally. For one clone, survival was significantly better when base angle was...

  4. Response of the Cottonwood Leaf Beetle (Coleoptera: Chrysomelidae) to Bacillus thuringiensis var. san diego

    Science.gov (United States)

    Leah S. Bauer

    1990-01-01

    A standardized laboratory bioassay was used to quantify the lethal and sub-lethal responses of larval and adult cottonwood leaf beetles, Chrysomela scripta F., to Bacillus thuringiensis var. san diego, formulated as M-One standard powder (Mycogen Corporation, San Diego). The median lethal concentration (LC

  5. Ecophysiology of riparian cottonwood and willow before, during, and after two years of soil water removal.

    Science.gov (United States)

    Hultine, K R; Bush, S E; Ehleringer, J R

    2010-03-01

    Riparian cottonwood/willow forest assemblages are highly valued in the southwestern United States for their wildlife habitat, biodiversity, and watershed protection. Yet these forests are under considerable threat from climate change impacts on water resources and land-use activities to support human enterprise. Stream diversions, groundwater pumping, and extended drought have resulted in the decline of cottonwood/willow forests along many riparian corridors in the Southwest and, in many cases, the replacement of these forests with less desirable invasive shrubs and trees. Nevertheless, ecophysiological responses of cottonwood and willow, along with associated ecohydrological feedbacks of soil water depletion, are not well understood. Ecophysiological processes of mature Fremont cottonwood and coyote willow stands were examined over four consecutive growing seasons (2004-2007) near Salt Lake City, Utah, USA. The tree stands occurred near the inlet of a reservoir that was drained in the spring of 2005 and remained empty until mid-summer of 2006, effectively removing the primary water source for most of two growing seasons. Stem sap flux density (Js) in cottonwood was highly correlated with volumetric soil moisture (theta) in the upper 60 cm and decreased sevenfold as soil moisture dropped from 12% to 7% after the reservoir was drained. Conversely, Js in willow was marginally correlated with 0 and decreased by only 25% during the same period. Opposite patterns emerged during the following growing season: willow had a lower whole-plant conductance (kt) in June and higher leaf carbon isotope ratios (delta13C) than cottonwood in August, whereas k(t) and delta13C were otherwise similar between species. Water relations in both species recovered quickly from soil water depletion, with the exception that sapwood area to stem area (As:Ast) was significantly lower in both species after the 2007 growing season compared to 2004. Results suggest that cottonwood has a greater

  6. Sex-Specific Response to Stress in Populus

    Directory of Open Access Journals (Sweden)

    Nataliya V. Melnikova

    2017-10-01

    Full Text Available Populus is an effective model for genetic studies in trees. The genus Populus includes dioecious species, and the differences exhibited in males and females have been intensively studied. This review focused on the distinctions between male and female poplar and aspen plants under stress conditions, such as drought, salinity, heavy metals, and nutrient deficiency on morphological, physiological, proteome, and gene expression levels. In most studies, males of Populus species were more adaptive to the majority of the stress conditions and showed less damage, better growth, and higher photosynthetic capacity and antioxidant activity than that of the females. However, in two recent studies, no differences in non-reproductive traits were revealed for male and female trees. This discrepancy of the results could be associated with experimental design: different species and genotypes, stress conditions, types of plant materials, sampling sizes. Knowledge of sex-specific differences is crucial for basic and applied research in Populus species.

  7. Remetabolism of transpired ethanol by Populus deltoides

    International Nuclear Information System (INIS)

    MacDonald, R.C.; Kimmerer, T.W.

    1990-01-01

    Ethanol is present in the transpiration stream of flooded and unflooded trees in concentrations up to 0.5mM. Transpired ethanol does not evaporate but is remetabolized by foliage and upper stems in Populus deltoides. 14 C-ethanol was supplied in the transpiration stream to excised leaves and shoots; more than 98% was incorporated. Less than 1% was respired as CO 2 . Organic and amino acids were labelled initially, with eventual accumulations in water- and chloroform-soluble fractions and into protein. Much of the label was incorporated into stem tissue, with little reaching the lamina. These experiments suggest that ethanol is not lost transpirationally through the leaves, but is efficiently recycled in a manner resembling lactate recycling in mammals

  8. Protein (Viridiplantae): 224094212 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5297 3694:5297 predicted protein Populus trichocarpa MMMNAVFAADAEIGSDAVFAADSGLGSDAVFAADFGLGSDAVFAADAEIGSDAVFAA...DSGLGSDTAFTTDTEIGSNTVFAAHFLIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRVFAADAEIGSDAVFAADSGLGSEAVFAADSGLGSDAVFAA...DAEIGSDAVFAADSGLGSDAVFAADSGLGSDAVFAADAEIGSDKVFAADSGLGSDAVFAADSGLGSHAVFAADAEIGSDAVFAADSGLGSDAVFAA...DSGLGSDAAFTTDTEIGSDTVFAAHFLIGSDAVFAADAEIGSDAVFAADFSMNSDAELGGRGKNWF ...

  9. The Cottonwood Lake study area, a long-term wetland ecosystem monitoring site

    Science.gov (United States)

    Mushet, David M.; Euliss, Ned H.

    2012-01-01

    The Cottonwood Lake study area is one of only three long-term wetland ecosystem monitoring sites in the prairie pothole region of North America; the other two are Orchid Meadows in South Dakota and St. Denis in Saskatchewan. Of the three, Cottonwood Lake has, by far, the longest continuous data-collection record. Research was initiated at the study area in 1966, and intensive investigations of the hydrology, chemistry, and biology of prairie pothole wetlands continue at the site today. This fact sheet describes the study area, provides an overview of wetland ecology research that has been conducted at the site in the past, and provides an introduction to current work being conducted at the study area by USGS scientists.

  10. Climatic data for the Cottonwood Lake area, Stutsman County, North Dakota 1982

    Science.gov (United States)

    Sturrock, A.M.; Hanson, B.A.; Scarborough, J.L.; Winter, T.C.

    1986-01-01

    Research on the hydrology of the Cottonwood Lake area, Stutsman County, North Dakota, includes study of evaporation. Presented here are those climatic data needed for energy-budget and mass-transfer evaporation studies, including: water-surface temperature, sediment temperature dry-bulb and wet-bulb air temperatures, vapor pressure at and above the water surface, wind speed, and short- and long-wave radiation. Data were collected at raft and land stations.

  11. Climatic data for the Cottonwood Lake area, Stutsman County, North Dakota, 1983

    Science.gov (United States)

    Sturrock, A.M.; Hanson, B.A.; Scarborough, J.L.; Winter, T.C.

    1987-01-01

    Research on the hydrology of the Cottonwood Lake area, Stutsman County, North Dakota, includes study of evaporation. Climatic data needed for energy-budget and mass-transfer evaporation studies that were collected during 1983 include water-surface temperature, sediment temperature, dry-bulb and wet-bulb air temperature, vapor pressure at and above the water surface, wind speed, and short-and long-wave radiation. Data are collected at raft and land stations. (USGS)

  12. Field performance of alternative landfill covers vegetated with cottonwood and eucalyptus trees.

    Science.gov (United States)

    Abichou, Tarek; Musagasa, Jubily; Yuan, Lei; Chanton, Jeff; Tawfiq, Kamal; Rockwood, Donald; Licht, Louis

    2012-01-01

    A field study was conducted to assess the ability of landfill covers to control percolation into the waste. Performance of one conventional cover was compared to that of two evapotranspiration (ET) tree covers, using large (7 x 14 m) lined lysimeters at the Leon County Solid Waste management facility in Tallahassee, Florida. Additional unlined test sections were also constructed and monitored in order to compare soil water storage, soil temperature, and tree growth inside lysimeters and in unlined test sections. The unlined test sections were in direct contact with landfill gas. Surface runoff on the ET covers was a small proportion of the water balance (1% of precipitation) as compared to 13% in the conventional cover. Percolation in the ET covers averaged 17% and 24% of precipitation as compared to 33% in the conventional cover. On average, soil water storage was higher in the lined lysimeters (429 mm) compared to unlined test sections (408 mm). The average soil temperature in the lysimeters was lower than in the unlined test sections. The average tree height inside the lysimeters was not significantly lower (8.04 mfor eucalyptus and 7.11 mfor cottonwood) than outside (8.82 m for eucalyptus and 8.01 m for cottonwood). ET tree covers vegetated with cottonwood or eucalyptus are feasible for North Florida climate as an alternative to GCL covers.

  13. Biomass and genotype × environment interactions of Populus energy crops in the midwestern United States

    Science.gov (United States)

    Ronald S., Jr. Zalesny; Richard B. Hall; Jill A. Zalesny; Bernard G. McMahon; William E. Berguson; Glen R. Stanosz

    2009-01-01

    Using Populus feedstocks for biofuels, bioenergy, and bioproducts is becoming economically feasible as global fossil fuel prices increase. Maximizing Populus biomass production across regional landscapes largely depends on understanding genotype × environment interactions, given broad genetic variation at strategic (...

  14. Growth of Populus and Salix Species under Compost Leachate Irrigation

    Directory of Open Access Journals (Sweden)

    Tooba Abedi

    2014-12-01

    Full Text Available According to the known broad variation in remediation capacity, three plant species were used in the experiment: two fast growing poplar’s clones - Populus deltoides, Populus euramericana, and willows Salix alba. Populus and Salix cuttings were collected from the nursery of the Populus Research Center of Safrabasteh in the eastern part of Guilan province at north of Iran. The Populus clones were chosen because of their high biomass production capacity and willow- because it is native in Iran. The highest diameter growth rate was exhibited for all three plant species by the 1:1 treatment with an average of 0.26, 0.22 and 0.16 cm in eight months period for P. euroamericana, P. deltoides and S. alba, respectively. Over a period of eight months a higher growth rate of height was observed in (P and (1:1 treatment for S. alba (33.70 and 15.77 cm, respectively and in (C treatment for P. deltoides (16.51 cm. P. deltoides and S. alba produced significantly (p<0.05 smaller aboveground biomass in (P treatment compared to all species. P. deltoides exhibited greater mean aboveground biomass in the (1:1 treatment compared to other species. There were significant differences (p<0.05 in the growth of roots between P. deltoides, P. euramericana and S. alba in all of the treatments.

  15. Repeated unidirectional introgression towards Populus balsamifera in contact zones of exotic and native poplars

    NARCIS (Netherlands)

    Thompson, S.L.; Lamothe, M.; Meirmans, P.G.; Périnet, P.; Isabel, N.

    2010-01-01

    As the evolutionary significance of hybridization is largely dictated by its extent beyond the first generation, we broadly surveyed patterns of introgression across a sympatric zone of two native poplars (Populus balsamifera, Populus deltoides) in Quebec, Canada within which European exotic Populus

  16. Efficient Agrobacterium-Mediated Transformation of Hybrid Poplar Populus davidiana Dode × Populus bollena Lauche

    Directory of Open Access Journals (Sweden)

    Xue Han

    2013-01-01

    Full Text Available Poplar is a model organism for high in vitro regeneration in woody plants. We have chosen a hybrid poplar Populus davidiana Dode × Populus bollena Lauche. By optimizing the Murashige and Skoog medium with (0.3 mg/L 6-benzylaminopurine and (0.08 mg/L naphthaleneacetic acid, we have achieved the highest frequency (90% for shoot regeneration from poplar leaves. It was also important to improve the transformation efficiency of poplar for genetic breeding and other applications. In this study, we found a significant improvement of the transformation frequency by controlling the leaf age. Transformation efficiency was enhanced by optimizing the Agrobacterium concentration (OD600 = 0.8–1.0 and an infection time (20–30 min. According to transmission electron microscopy observations, there were more Agrobacterium invasions in the 30-day-old leaf explants than in 60-day-old and 90-day-old explants. Using the green fluorescent protein (GFP marker, the expression of MD–GFP fusion proteins in the leaf, shoot, and root of hybrid poplar P. davidiana Dode × P. bollena Lauche was visualized for confirmation of transgene integration. Southern and Northern blot analysis also showed the integration of T-DNA into the genome and gene expression of transgenic plants. Our results suggest that younger leaves had higher transformation efficiency (~30% than older leaves (10%.

  17. Climate, streamflow, and legacy effects on growth of riparian Populus angustifolia in the arid San Luis Valley, Colorado

    Science.gov (United States)

    Andersen, Douglas

    2016-01-01

    Knowledge of the factors affecting the vigor of desert riparian trees is important for their conservation and management. I used multiple regression to assess effects of streamflow and climate (12–14 years of data) or climate alone (up to 60 years of data) on radial growth of clonal narrowleaf cottonwood (Populus angustifolia), a foundation species in the arid, Closed Basin portion of the San Luis Valley, Colorado. I collected increment cores from trees (14–90 cm DBH) at four sites along each of Sand and Deadman creeks (total N = 85), including both perennial and ephemeral reaches. Analyses on trees conditions was common. Models for trees farther from the channel or over a deep water table explained 23–71% of SGI variability, and 4 of 5 contained a streamflow variable. Analyses using solely climate variables over longer time periods explained 17–85% of SGI variability, and 10 of 12 included a variable indexing summer precipitation. Three large, abrupt shifts in recent decades from wet to dry conditions (indexed by a seasonal Palmer Drought Severity Index) coincided with dramatically reduced radial growth. Each shift was presumably associated with branch dieback that produced a legacy effect apparent in many SGI series: uncharacteristically low SGI in the year following the shift. My results suggest trees in locations distant from the active channel rely on the regional shallow unconfined aquifer, summer rainfall, or both to meet water demands. The landscape-level differences in the water supplies sustaining these trees imply variable effects from shifts in winter-versus monsoon-related precipitation, and from climate change versus streamflow or groundwater management.

  18. Successful grafting in poplar species (Populus spp.) breeding

    Science.gov (United States)

    A. Assibi Mahama; Brian Sparks; Ronald S., Zalesny; Richard B. Hall

    2006-01-01

    Poor rooting of Populus deltoides Bartr. ex Marsh hardwood cuttings often has contributed to delays in breeding progress as a result of failures of scion wood before and/or after pollination. Seventeen clones were used, and the study was conducted in the greenhouse to test an "intervenous feeding" (IV) method, along with three different...

  19. Trinucleotide repeat microsatellite markers for Black Poplar (Populus nigra L.)

    NARCIS (Netherlands)

    Smulders, M.J.M.; Schoot, van der J.; Arens, P.; Vosman, B.

    2001-01-01

    Using an enrichment procedure, we have cloned microsatellite repeats from black poplar (Populus nigra L.) and developed primers for microsatellite marker analysis. Ten primer pairs, mostly for trinucleotide repeats, produced polymorphic fragments in P. nigra. Some of them also showed amplification

  20. Micropropagation, genetic engineering, and molecular biology of Populus

    Science.gov (United States)

    N. B. Klopfenstein; Y. W. Chun; M. -S. Kim; M. A. Ahuja; M. C. Dillon; R. C. Carman; L. G. Eskew

    1997-01-01

    Thirty-four Populus biotechnology chapters, written by 85 authors, are comprised in 5 sections: 1) in vitro culture (micropropagation, somatic embryogenesis, protoplasts, somaclonal variation, and germplasm preservation); 2) transformation and foreign gene expression; 3) molecular biology (molecular/genetic characterization); 4) biotic and abiotic resistance (disease,...

  1. Creation and genomic analysis of irradiation hybrids in Populus

    Science.gov (United States)

    Matthew S. Zinkgraf; K. Haiby; M.C. Lieberman; L. Comai; I.M. Henry; Andrew Groover

    2016-01-01

    Establishing efficient functional genomic systems for creating and characterizing genetic variation in forest trees is challenging. Here we describe protocols for creating novel gene-dosage variation in Populus through gamma-irradiation of pollen, followed by genomic analysis to identify chromosomal regions that have been deleted or inserted in...

  2. Influence of water table decline on growth allocation and endogenous gibberellins in black cottonwood

    Energy Technology Data Exchange (ETDEWEB)

    Rood, S.B.; Zanewich, K.; Stefura, C. [Lethbridge Univ., Lethbridge, AB (Canada). Dept. of Biological Sciences; Mahoney, J.M. [Alberta Environmental Protection, Lethbridge, AB (Canada)

    2000-06-01

    Cottonwoods have shown an adaptation to the riparian zone by coordinating root elongation to maintain contact with the water table, whose depth varies with the elevation of the adjacent river. The rate of water decline on growth allocation and concentrations of endogenous gibberellins (GAs) in black cottonwood saplings were studied at the University of Lethbridge, Alberta. Water declines were achieved by using rhizopods, and root elongation approximately doubled in response whereas leaf area was reduced. At some point, a greater water decline rate led to water stress resulting in reduced growth, increased leaf diffusive resistance, decreased water potential, and leaf senescence and abscission. After extraction of endogenous GAs, they were purified and analysed by gas chromatography-selected ion monitoring with internal ({sup 2}H{sub 2})GA standards. The results showed that GAs were higher in shoot tips and sequentially lower in basal stems, root tips, leaves and upper roots. Noticeable relationships did not appear between GA concentration and growth allocation across the water decline treatments. Only GA{sub 8} showed a consistent reduction in plants experiencing water table decline. This research did not permit the authors to conclude whether endogenous GAs play a primary role in the regulation of root elongation in response to water table decline. 7 figs., 25 refs.

  3. Cloning and characterization of an AUX/IAA gene in Populus davidiana x P. alba var. Pyramidalis and the correlation between its time-course expression and the levels of indole-3-acetic in saplings inoculated with Trichoderma

    International Nuclear Information System (INIS)

    Yao, Z.; Baloch, A.M.; Zhai, T.; Jiang, C.; Liu, Z.; Zhang, R.

    2018-01-01

    Poda AUX/IAA gene, encoding an early-stage responsive protein to auxin in Populus davidiana x P. alba var. pyramidalis (Shanxin poplar), was cloned. The length of mRNA transcript of Poda AUX/IAA was 741bp, encoding a 248-amino-acid protein product, Poda AUX/IAA ORF analysis suggested that Poda AUX/IAA contained one conserved domain (pfam02309). Predicted molecular weight of Poda AUX/IAA was found to be 27kDa and its theoretical isoelectric point was determined as 8.21. Poda AUX/IAA was predicted to be a hydrophilic nucleoprotein and its multi-sequence alignment analysis showed that it shares high identity in four conserved domains with eight AUX/IAA proteins in other Populus species and these sequences of Poda AUX/IAA shared highest similarity with Pt-IAA14.1 in P. trichocarpa. In this study, we found that Poda AUX/IAA was expressed in both leaves and roots of Shanxin poplar. Three strains of Trichoderma asperellum were used to inoculate Shanxin poplar saplings. Inoculated saplings were cultured for 72 h. It was then found that IAA levels in both leaves and roots of inoculated saplings gradually increased and time-course expression patterns of PodaAUX/IAA was changed along with IAA levels. Results of Pearson correlation analysis demonstrated a negative correlation between expression levels of Poda AUX/IAA and IAA levels in both leaves and roots of Shanxin poplar saplings when compared with control. Negative correlation in inoculated saplings were less significant, probably as a result of Trichoderma inducing. (author)

  4. Laboratory-scale measurements of N2O and CH4 emissions from hybrid poplars (Populus deltoides x Populus nigra).

    Science.gov (United States)

    McBain, M C; Warland, J S; McBride, R A; Wagner-Riddle, C

    2004-12-01

    The purpose of this study was to determine whether or not young hybrid poplar (Populus deltoides x Populus nigra) could transport landfill biogas internally from the root zone to the atmosphere, thereby acting as conduits for landfill gas release. Fluxes of methane (CH4) and nitrous oxide (N2O) from the seedlings to the atmosphere were measured under controlled conditions using dynamic flux chambers and a tunable diode laser trace gas analyser (TDLTGA). Nitrous oxide was emitted from the seedlings, but only when extremely high soil N2O concentrations were applied to the root zone. In contrast, no detectable emissions of CH4 were measured in a similar experimental trial. Visible plant morphological responses, characteristic of flood-tolerant trees attempting to cope with the negative effects of soil hypoxia, were observed during the CH4 experiments. Leaf chlorosis, leaf abscission and adventitious roots were all visible plant responses. In addition, seedling survival was observed to be highest in the biogas 'hot spot' areas of a local municipal solid waste landfill involved in this study. Based on the available literature, these observations suggest that CH4 can be transported internally by Populus deltoides x Populus nigra seedlings in trace amounts, although future research is required to fully test this hypothesis.

  5. Het geslacht Populus in verband met zijn beteekenis voor de houtteelt = The genus populus and its significance in silviculture

    NARCIS (Netherlands)

    Houtzagers, G.

    1937-01-01

    The genus Populus L. can be divided into 5 sections. This study deals with the classification and description of the species and varieties of the section Aigeiros Duby (black poplars), which contains almost all the important cultivated types in the Netherlands. The botanical information was

  6. Towards a map of the Populus biomass protein-protein interaction network

    Energy Technology Data Exchange (ETDEWEB)

    Beers, Eric [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Brunner, Amy [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Helm, Richard [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Dickerman, Allan [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States)

    2015-07-31

    Biofuels can be produced from a variety of plant feedstocks. The value of a particular feedstock for biofuels production depends in part on the degree of difficulty associated with the extraction of fermentable sugars from the plant biomass. The wood of trees is potentially a rich source fermentable sugars. However, the sugars in wood exist in a tightly cross-linked matrix of cellulose, hemicellulose, and lignin, making them largely recalcitrant to release and fermentation for biofuels production. Before breeders and genetic engineers can effectively develop plants with reduced recalcitrance to fermentation, it is necessary to gain a better understanding of the fundamental biology of the mechanisms responsible for wood formation. Regulatory, structural, and enzymatic proteins are required for the complicated process of wood formation. To function properly, proteins must interact with other proteins. Yet, very few of the protein-protein interactions necessary for wood formation are known. The main objectives of this project were to 1) identify new protein-protein interactions relevant to wood formation, and 2) perform in-depth characterizations of selected protein-protein interactions. To identify relevant protein-protein interactions, we cloned a set of approximately 400 genes that were highly expressed in the wood-forming tissue (known as secondary xylem) of poplar (Populus trichocarpa). We tested whether the proteins encoded by these biomass genes interacted with each other in a binary matrix design using the yeast two-hybrid (Y2H) method for protein-protein interaction discovery. We also tested a subset of the 400 biomass proteins for interactions with all proteins present in wood-forming tissue of poplar in a biomass library screen design using Y2H. Together, these two Y2H screens yielded over 270 interactions involving over 75 biomass proteins. For the second main objective we selected several interacting pairs or groups of interacting proteins for in

  7. Functional Gene Discovery and Characterization of Genes and Alleles Affecting Wood Biomass Yield and Quality in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Busov, Victor [Michigan Technological Univ., Houghton, MI (United States)

    2017-02-12

    Adoption of biofuels as economically and environmentally viable alternative to fossil fuels would require development of specialized bioenergy varieties. A major goal in the breeding of such varieties is the improvement of lignocellulosic biomass yield and quality. These are complex traits and understanding the underpinning molecular mechanism can assist and accelerate their improvement. This is particularly important for tree bioenergy crops like poplars (species and hybrids from the genus Populus), for which breeding progress is extremely slow due to long generation cycles. A variety of approaches have been already undertaken to better understand the molecular bases of biomass yield and quality in poplar. An obvious void in these undertakings has been the application of mutagenesis. Mutagenesis has been instrumental in the discovery and characterization of many plant traits including such that affect biomass yield and quality. In this proposal we use activation tagging to discover genes that can significantly affect biomass associated traits directly in poplar, a premier bioenergy crop. We screened a population of 5,000 independent poplar activation tagging lines under greenhouse conditions for a battery of biomass yield traits. These same plants were then analyzed for changes in wood chemistry using pyMBMS. As a result of these screens we have identified nearly 800 mutants, which are significantly (P<0.05) different when compared to wild type. Of these majority (~700) are affected in one of ten different biomass yield traits and 100 in biomass quality traits (e.g., lignin, S/G ration and C6/C5 sugars). We successfully recovered the position of the tag in approximately 130 lines, showed activation in nearly half of them and performed recapitulation experiments with 20 genes prioritized by the significance of the phenotype. Recapitulation experiments are still ongoing for many of the genes but the results are encouraging. For example, we have shown successful

  8. Capturing the Alternative Cleavage and Polyadenylation Sites of 14 NAC Genes in Populus Using a Combination of 3′-RACE and High-Throughput Sequencing

    Directory of Open Access Journals (Sweden)

    Haoran Wang

    2018-03-01

    Full Text Available Detection of complex splice sites (SSs and polyadenylation sites (PASs of eukaryotic genes is essential for the elucidation of gene regulatory mechanisms. Transcriptome-wide studies using high-throughput sequencing (HTS have revealed prevalent alternative splicing (AS and alternative polyadenylation (APA in plants. However, small-scale and high-depth HTS aimed at detecting genes or gene families are very few and limited. We explored a convenient and flexible method for profiling SSs and PASs, which combines rapid amplification of 3′-cDNA ends (3′-RACE and HTS. Fourteen NAC (NAM, ATAF1/2, CUC2 transcription factor genes of Populus trichocarpa were analyzed by 3′-RACE-seq. Based on experimental reproducibility, boundary sequence analysis and reverse transcription PCR (RT-PCR verification, only canonical SSs were considered to be authentic. Based on stringent criteria, candidate PASs without any internal priming features were chosen as authentic PASs and assumed to be PAS-rich markers. Thirty-four novel canonical SSs, six intronic/internal exons and thirty 3′-UTR PAS-rich markers were revealed by 3′-RACE-seq. Using 3′-RACE and real-time PCR, we confirmed that three APA transcripts ending in/around PAS-rich markers were differentially regulated in response to plant hormones. Our results indicate that 3′-RACE-seq is a robust and cost-effective method to discover SSs and label active regions subjected to APA for genes or gene families. The method is suitable for small-scale AS and APA research in the initial stage.

  9. Multiple factors affect pest and pathogen damage on 31 Populus clones in South Carolina

    Science.gov (United States)

    David R. Coyle; Mark D. Coleman; Jaclin A. Durant; Lee A. Newman

    2006-01-01

    Populus species and hybrids have many practical applications, but there is a paucity of data regarding selections that perform well in the southeastern US. We compared pest susceptibility of 31 Populus clones over 3 years in South Carolina, USA. Cuttings were planted in spring 2001 on two study sites. Clones planted in the...

  10. Leaf, woody, and root biomass of Populus irrigated with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; D.R. Coyle; R.B. Hall

    2007-01-01

    Poplar (Populus spp.) trees can be utilized for ecological leachate disposal when applied as an irrigation source for managed tree systems. Our objective was to evaluate differences in tree height, diameter, volume, and biomass of leaf, stem, branch, and root tissues of Populus trees after two seasons of irrigation with municipal...

  11. Paraffin dispersant application for cleaning subsea flow lines in the deep water Gulf of Mexico cottonwood development

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, David; White, Jake; Pogoson, Oje [Baker Hughes Inc., Houston, TX (United States); Barros, Dalmo; Ramachandran, Kartik; Bonin, George; Waltrich, Paulo; Shecaira, Farid [PETROBRAS America, Houston, TX (United States); Ziglio, Claudio [Petroleo Brasileiro S.A. (CENPES/PETROBRAS), Rio de Janeiro, RJ (Brazil). Centro de Pesquisa e Desenvolvimento

    2012-07-01

    This paper discusses a paraffin dispersant (in seawater) application to clean paraffin deposition from a severely restricted 17.4-mile dual subsea flow line system in the Gulf of Mexico Cottonwood development. In principle, dispersant treatments are simple processes requiring effective dispersant packages and agitation to break-up and disperse deposition. Dispersants have been used onshore for treating wax deposition for decades. Implementation of a treatment in a long deep water production system, however, poses numerous challenges. The Cottonwood application was one of the first ever deep water dispersant applications. The application was designed in four separate phases: pre-treatment displacement for hydrate protection, dispersant treatment for paraffin deposition removal, pigging sequence for final flow line cleaning, and post-treatment displacement for hydrate protection. In addition, considerable job planning was performed to ensure the application was executed in a safe and environmentally responsible manner. Two dynamically positioned marine vessels were used for pumping fluids and capturing returns. The application was extremely successful in restoring the deep water flow lines back to near pre-production state. Final pigging operations confirmed the flow lines were cleaned of all restrictions. Significant paraffin deposition was removed in the application. Approximately 900 bbls of paraffin sludge was recovered from the 4000 bbl internal volume flow line loop. Furthermore, the application was completed with zero discharge of fluids. The application provided significant value for the Cottonwood development. It allowed production from wells to be brought on-line at a higher capacity, thereby generating increased revenue. It also allowed resumption of routine pigging operations. As such, the Cottonwood dispersant application illustrates that with proper planning and execution, paraffin dispersant treatments can be highly effective solutions for cleaning

  12. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume II Yakima (Overview, Report, Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  13. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume III (Overview and Tools).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  14. Deposition velocities to Sorbus aria, Acer campestre, Populus deltoides x trichocarpa 'Beaupre', Pinus nigra and x Cupressocyparis leylandii for coarse, fine and ultra-fine particles in the urban environment

    International Nuclear Information System (INIS)

    Freer-Smith, P.H.; Beckett, K.P.; Taylor, Gail

    2005-01-01

    Trees are effective in the capture of particles from urban air to the extent that they can significantly improve urban air quality. As a result of their aerodynamic properties conifers, with their smaller leaves and more complex shoot structures, have been shown to capture larger amounts of particle matter than broadleaved trees. This study focuses on the effects of particle size on the deposition velocity of particles (Vg) to five urban tree species (coniferous and broadleaved) measured at two field sites, one urban and polluted and a second more rural. The larger uptake to conifers is confirmed, and for broadleaves and conifers Vg values are shown to be greater for ultra-fine particles (Dp<1.0 μm) than for fine and coarse particles. This is important since finer particles are more likely to be deposited deep in the alveoli of the human lung causing adverse health effects. The finer particle fraction is also shown to be transported further from the emission source; in this study a busy urban road. In further sets of data the aqueous soluble and insoluble fractions of the ultra-fines were separated, indicating that aqueous insoluble particles made up only a small proportion of the ultra-fines. Much of the ultra-fine fraction is present as aerosol. Chemical analysis of the aqueous soluble fractions of coarse, fine and ultra-fine particles showed the importance of nitrates, chloride and phosphates in all three size categories at the polluted and more rural location

  15. Glycosylation-mediated phenylpropanoid partitioning in Populus tremuloides cell cultures

    Directory of Open Access Journals (Sweden)

    Babst Benjamin A

    2009-12-01

    Full Text Available Abstract Background Phenylpropanoid-derived phenolic glycosides (PGs and condensed tannins (CTs comprise large, multi-purpose non-structural carbon sinks in Populus. A negative correlation between PG and CT concentrations has been observed in several studies. However, the molecular mechanism underlying the relationship is not known. Results Populus cell cultures produce CTs but not PGs under normal conditions. Feeding salicyl alcohol resulted in accumulation of salicins, the simplest PG, in the cells, but not higher-order PGs. Salicin accrual reflected the stimulation of a glycosylation response which altered a number of metabolic activities. We utilized this suspension cell feeding system as a model for analyzing the possible role of glycosylation in regulating the metabolic competition between PG formation, CT synthesis and growth. Cells accumulated salicins in a dose-dependent manner following salicyl alcohol feeding. Higher feeding levels led to a decrease in cellular CT concentrations (at 5 or 10 mM, and a negative effect on cell growth (at 10 mM. The competition between salicin and CT formation was reciprocal, and depended on the metabolic status of the cells. We analyzed gene expression changes between controls and cells fed with 5 mM salicyl alcohol for 48 hr, a time point when salicin accumulation was near maximum and CT synthesis was reduced, with no effect on growth. Several stress-responsive genes were up-regulated, suggestive of a general stress response in the fed cells. Salicyl alcohol feeding also induced expression of genes associated with sucrose catabolism, glycolysis and the Krebs cycle. Transcript levels of phenylalanine ammonia lyase and most of the flavonoid pathway genes were reduced, consistent with down-regulated CT synthesis. Conclusions Exogenous salicyl alcohol was readily glycosylated in Populus cell cultures, a process that altered sugar utilization and phenolic partitioning in the cells. Using this system, we

  16. Pyrolysis and Combustion Kinetics of Raw and Carbonized Cottonwood and Switchgrass Agroforests

    Directory of Open Access Journals (Sweden)

    Sammy Sadaka

    2015-06-01

    Full Text Available Raw biomass is not commonly suitable as feedstock for existing power plants, mainly because of the substantial required infrastructural changes. As a result, most raw feedstock requires pre-treatment to improve its physical and thermal characteristics. Biomass carbonization is one of the pre-treatments that produces charcoal-like feedstock. This paper explores the effects of the carbonization process on the physiochemical characteristics of biomass produced from two cottonwood clones, S7C20 and ST66, and switchgrass (var. Alamo. Additionally, it studies the thermal degradation kinetics of raw and carbonized agroforestry products in nitrogen and air environments. Feedstock samples were carbonized in a batch reactor at 400 °C in an oxygen-free environment for 2 hours. Carbonization decreased biomass bulk density, moisture content, and volatile solids while increasing fixed carbon, ash content, pH, and heating values. The heating value of S7C20, ST66, and switchgrass increased by 58.6%, 60.3%, and 69.7%, respectively. Carbonization increased the activation energy values under the condition of pyrolysis and decreased these values under the condition of combustion. The carbonization process produced a charcoal-like feedstock that may be processed with coal or even replace it.

  17. Water use sources of desert riparian Populus euphratica forests.

    Science.gov (United States)

    Si, Jianhua; Feng, Qi; Cao, Shengkui; Yu, Tengfei; Zhao, Chunyan

    2014-09-01

    Desert riparian forests are the main body of natural oases in the lower reaches of inland rivers; its growth and distribution are closely related to water use sources. However, how does the desert riparian forest obtains a stable water source and which water sources it uses to effectively avoid or overcome water stress to survive? This paper describes an analysis of the water sources, using the stable oxygen isotope technique and the linear mixed model of the isotopic values and of desert riparian Populus euphratica forests growing at sites with different groundwater depths and conditions. The results showed that the main water source of Populus euphratica changes from water in a single soil layer or groundwater to deep subsoil water and groundwater as the depth of groundwater increases. This appears to be an adaptive selection to arid and water-deficient conditions and is a primary reason for the long-term survival of P. euphratica in the desert riparian forest of an extremely arid region. Water contributions from the various soil layers and from groundwater differed and the desert riparian P. euphratica forests in different habitats had dissimilar water use strategies.

  18. Patterns of genetic diversity and differentiation in resistance gene clusters of two hybridizing European Populus species

    OpenAIRE

    Casey, Céline; Stölting, Kai N.; Barbará, Thelma; González-Martínez, Santiago C.; Lexer, Christian

    2015-01-01

    Resistance genes (R-genes) are essential for long-lived organisms such as forest trees, which are exposed to diverse herbivores and pathogens. In short-lived model species, R-genes have been shown to be involved in species isolation. Here, we studied more than 400 trees from two natural hybrid zones of the European Populus species Populus alba and Populus tremula for microsatellite markers located in three R-gene clusters, including one cluster situated in the incipient sex chromosome region....

  19. Genome-Wide Analysis of a TaLEA-Introduced Transgenic Populus simonii × Populus nigra Dwarf Mutant

    Directory of Open Access Journals (Sweden)

    Jing Jiang

    2012-03-01

    Full Text Available A dwarf mutant (dwf1 was obtained among 15 transgenic lines, when TaLEA (Tamarix androssowii late embryogenesis abundant gene was introduced into Populus simonii × Populus nigra by Agrobacterium tumefaciens-mediated transformation. Under the same growth conditions, dwf1 height was significantly reduced compared with the wild type and the other transgenic lines. Because only one transgenic line (dwf1 displayed the dwarf phenotype, we considered that T-DNA insertion sites may play a role in the mutant formation. The mechanisms underlying this effect were investigated using TAIL-PCR (thermal asymmetric interlaced PCR and microarrays methods. According to the TAIL-PCR results, two flanking sequences located on chromosome IV and VIII respectively, were cloned. The results indicated the integration of two independent T-DNA copies. We searched for the potential genes near to the T-DNA insertions. The nearest gene was a putative poplar AP2 transcription factor (GI: 224073210. Expression analysis showed that AP2 was up-regulated in dwf1 compared with the wild type and the other transgenic lines. According to the microarrays results, a total of 537 genes involved in hydrolase, kinase and transcription factor activities, as well as protein and nucleotide binding, showed significant alterations in gene expression. These genes were expressed in more than 60 metabolic pathways, including starch, sucrose, galactose and glycerolipid metabolism and phenylpropanoids and flavonoid biosyntheses. Our transcriptome and T-DNA insertion sites analyses might provide some useful insights into the dwarf mutant formation.

  20. Performance of Salix viminalis and Populus nigra x Populus maximowiczii in short rotation intensive culture under high irrigation

    Energy Technology Data Exchange (ETDEWEB)

    Fillion, Maud; Brisson, Jacques [Departement de Sciences biologiques, Universite de Montreal, C.P. 6128, succ. Centre-ville, Montreal, Quebec (Canada); Institut de recherche en biologie vegetale, 4101 Sherbrooke East, Montreal, Quebec (Canada); Teodorescu, Traian I.; Labrecque, Michel [Institut de recherche en biologie vegetale, 4101 Sherbrooke East, Montreal, Quebec (Canada); Sauve, Sebastien [Departement de chimie, Universite de Montreal, C.P. 6128, succursale Centre-ville, Montreal, Quebec (Canada)

    2009-09-15

    On a plantation established in 2004 from stem cuttings at a density of 20,000 trees per hectare, we investigated growth and nutritional plant response to a high hydraulic regime for two species (Salix viminalis and Populus nigra x Populus maximowiczii), using a comparative approach with measurements from irrigated and control plots. The plantation was irrigated from June to September 2005 with about 140 mm per day. The equivalent of 120 Kg NO{sub 3}-N, 40 Kg P{sub 2}O{sub 5}-P and 85 Kg K{sub 2}O-K per hectare per year was applied by means of irrigation with wastewater. No mortality occurred and stem biomass production of both poplar and willow species were not statistically different on irrigated and control areas. However, S. viminalis revealed to be more tolerant to flooded conditions since these corresponded more closely to its nutritional requirements (foliar concentration of 20 mgN g{sup -1}). The capacity of S. viminalis to withstand waterlogged conditions could play an important role in the sustainability of a plantation for the filtration of effluent at low pollutant concentration. (author)

  1. Mechanisms of Cottonwood Establishment in Gravel-Bed Rivers, across Scales from the Bar to the Reach

    Science.gov (United States)

    Meier, C. I.

    2017-12-01

    Riparian cottonwoods are pioneer trees adapted to colonizing fluvial corridors, with strong effects on ecosystem structure and function. As their populations are being affected by flow alterations and invasive species, their recruitment mechanisms need to be understood, to support scientifically-based restoration efforts. I propose new concepts for cottonwood establishment in gravelly streams, from the local to the reach scale. These notions complement the currently-accepted ideas, which apply only to the landscape scale, and whose basic assumptions (existence of an alluvial water table, which is planar, almost horizontal, and linked to the river stage, with a parallel, spatially-uniform capillary fringe) seem to be based on a physical template that is only valid in the case of sand-bed streams. At the local, within-the-bar scale, two concepts drive establishment success. First, a finer matrix material helps retain more capillary water after the yearly snowmelt flood or a precipitation event. Second, the coarse surface layer of clean gravel and cobble acts as rock mulch, strongly decreasing evaporative losses. At the reach scale, we find that the commonly reported arcuate bands of cottonwoods do not depend on groundwater, but are caused by water dispersal (hydrochory). Wind-dispersed seeds fall into the river, are entrained into the drift, and start germinating as they travel under water. Some of the seeds and germinants find their way into the shallow, high relative roughness flow along the cobble shoreline. They are able to deposit in this environment, where they start growing, also under water. As waters recede, during the period of seed availability in the drift, the river seeds its banks and bars. Thus, the boundaries of observed bands and patches with successful seedling recruitment correspond to the location of flow profiles at different dates during the flood recession.

  2. Using low energy x-ray radiography to evaluate root initiation and growth of Populus

    Science.gov (United States)

    Ronald S., Jr. Zalesny; A. L. Friend; B. Kodrzycki; D.W. McDonald; R. Michaels; A.H. Wiese; J.W. Powers

    2007-01-01

    Populus roots have been studied less than aboveground tissues. However, there is an overwhelming need to evaluate root initiation and growth in order to understand the genetics and physiology of rooting, along with genotype x environment interactions.

  3. Protein (Viridiplantae): 761681 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3688:2831 ... 238069:2831 ... 3689:2831 ... 3694:2831 ... caprice family protein Populus trichocarpa MDRRRKKQAKTTSCCSEQEVSSIEWEFINMSEQEEDLIYRMHNLVGDRWALIAGRIPGRKAEEIERFWLMRHGEGFASRRREQKRCHS

  4. Flooding Regime Impacts on Radiation, Evapotranspiration, and Latent Energy Fluxes over Groundwater-Dependent Riparian Cottonwood and Saltcedar Forests

    Directory of Open Access Journals (Sweden)

    James Cleverly

    2015-01-01

    Full Text Available Radiation and energy balances are key drivers of ecosystem water and carbon cycling. This study reports on ten years of eddy covariance measurements over groundwater-dependent ecosystems (GDEs in New Mexico, USA, to compare the role of drought and flooding on radiation, water, and energy budgets of forests differing in species composition (native cottonwood versus nonnative saltcedar and flooding regime. After net radiation (700–800 W m−2, latent heat flux was the largest energy flux, with annual values of evapotranspiration exceeding annual precipitation by 250–600%. Evaporative cooling dominated the energy fluxes of both forest types, although cottonwood generated much lower daily values of sensible heat flux (<−5 MJ m−2 d−1. Drought caused a reduction in evaporative cooling, especially in the saltcedar sites where evapotranspiration was also reduced, but without a substantial decline in depth-to-groundwater. Our findings have broad implications on water security and the management of native and nonnative vegetation within semiarid southwestern North America. Specifically, consideration of the energy budgets of GDEs as they respond to fluctuations in climatic conditions can inform the management options for reducing evapotranspiration and maintaining in-stream flow, which is legally mandated as part of interstate and international water resources agreements.

  5. Oldman river dam mitigation program downstream vegetation project report, Volume II: The potential effects of an operating plan for the Oldman River dam on Riparian cottonwood forests

    Energy Technology Data Exchange (ETDEWEB)

    Mahoney, J.M.

    1993-01-01

    Extensive cottonwood (poplar) forests exist in the Oldman River valley downstream of the Oldman River dam. Studies of similar forests in nearby river valleys and elsewhere on the western prairies have found significant declines of some riparian forests following river damming. This investigation was initiated to determine the causes of cottonwood forest decline downstream from existing dams in southern Alberta; inventory the existing river valley forests in the Oldman Basin; establish study sites in the Oldman River forests to monitor changes in forest status following commissioning of the Oldman River dam, and evaluate the probable impact of proposed operating plans for the Oldman River dam and associated water control structures on downstream forests. This report summarizes the progress made in the analyses of the probable effects on the survival of the forests, including a discussion of the hydrological conditions essential for cottonwood forest regeneration and an explanation of the effects of altering these characteristics on riparian forests; the hydrological alterations expected along various river reaches in the Oldman Basin with the implementation of the proposed OD05 Oldman Dam operating plan; and preliminary analyses of the problem impacts of the OD05 operating plan on the cottonwood forests along these reaches.

  6. Widespread triploidy in Western North American aspen (Populus tremuloides.

    Directory of Open Access Journals (Sweden)

    Karen E Mock

    Full Text Available We document high rates of triploidy in aspen (Populus tremuloides across the western USA (up to 69% of genets, and ask whether the incidence of triploidy across the species range corresponds with latitude, glacial history (as has been documented in other species, climate, or regional variance in clone size. Using a combination of microsatellite genotyping, flow cytometry, and cytology, we demonstrate that triploidy is highest in unglaciated, drought-prone regions of North America, where the largest clone sizes have been reported for this species. While we cannot completely rule out a low incidence of undetected aneuploidy, tetraploidy or duplicated loci, our evidence suggests that these phenomena are unlikely to be significant contributors to our observed patterns. We suggest that the distribution of triploid aspen is due to a positive synergy between triploidy and ecological factors driving clonality. Although triploids are expected to have low fertility, they are hypothesized to be an evolutionary link to sexual tetraploidy. Thus, interactions between clonality and polyploidy may be a broadly important component of geographic speciation patterns in perennial plants. Further, cytotypes are expected to show physiological and structural differences which may influence susceptibility to ecological factors such as drought, and we suggest that cytotype may be a significant and previously overlooked factor in recent patterns of high aspen mortality in the southwestern portion of the species range. Finally, triploidy should be carefully considered as a source of variance in genomic and ecological studies of aspen, particularly in western U.S. landscapes.

  7. Gamma radiation effect on Populus nigra assimilatory pigments

    International Nuclear Information System (INIS)

    Creanga, I. A.; Tudorie, Marcela; Mocanasu, C.; Creanga, Dorina

    2002-01-01

    The influence of low intensity gamma radiation on the photosynthesis in young poplar saplings was studied. Black poplar (Populus nigra) was chosen due to its ecological importance, as fast growing tree species with many hybrids, in the frame of a polluted environment. Assimilatory pigments in the leaves of irradiated saplings were assayed using standard spectrophotometric method in acetone extract. Series of five saplings formed the experimental samples. Chlorophyll a and chlorophyll b levels appeared as diminished in exposed samples in comparison to the controls. Linear regression was established in every case, the line slope showing the higher effect in chlorophyll b. Carotene pigments presented a slight increasing tendency in the exposed samples. Assimilatory pigment sum was shown to be affected by the same decreasing tendency. Student t-test was applied (two tailed, pair type) to reveal statistical significance of observed modifications. Though not very deep, the modifications induced by exposure to gamma radiation of low intensity (comparable to the local atmospheric variations, caused by both natural and artificial sources) represent putative inhibitory factors in young plant photosynthesis. The main mechanism of radiation action seems to be water radiolysis, triggering peroxide cascade, generally producing toxic products for the cell metabolism. Nevertheless, living cell ability to repair some damages caused by external stress could be revealed in the present case by the enhancing tendency of the carotenes which sustain photosynthesis as secondary pigments. (authors)

  8. The Populus ARBORKNOX1 homeodomain transcription factor regulates woody growth through binding to evolutionarily conserved target genes of diverse function

    Science.gov (United States)

    Lijun Liu; Matthew S. Zinkgraf; H. Earl Petzold; Eric P. Beers; Vladimir Filkov; Andrew Groover

    2014-01-01

    The class I KNOX homeodomain transcription factor ARBORKNOX1 (ARK1) is a key regulator of vascular cambium maintenance and cell differentiation in Populus. Currently, basic information is lacking concerning the distribution, functional characteristics, and evolution of ARK1 binding in the Populus genome.

  9. Uptake of macro- and micro-nutrients into leaf, woody, and root tissue of Populus after irrigation with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Bart T. Sexton; Richard B. Hall

    2008-01-01

    Information about macro- and micro-nutrient uptake and distribution into tissues of Populus irrigated with landfill leachate helps to maximize biomass production and understand impacts of leachate chemistry on tree health. We irrigated eight Populus clones (NC 13460, NCI4O18, NC14104, NC14106, DM115, DN5, NM2, NM6) with fertilized (N, P, K) well...

  10. Detection of a variable number of ribosomal DNA loci by fluorescent in situ hybridization in Populus species.

    Science.gov (United States)

    Prado, E A; Faivre-Rampant, P; Schneider, C; Darmency, M A

    1996-10-01

    Fluorescent in situ hybridization (FISH) was applied to related Populus species (2n = 19) in order to detect rDNA loci. An interspecific variability in the number of hybridization sites was revealed using as probe an homologous 25S clone from Populus deltoides. The application of image analysis methods to measure fluorescence intensity of the hybridization signals has enabled us to characterize major and minor loci in the 18S-5.8S-25S rDNA. We identified one pair of such rDNA clusters in Populus alba; two pairs, one major and one minor, in both Populus nigra and P. deltoides; and three pairs in Populus balsamifera, (two major and one minor) and Populus euroamericana (one major and two minor). FISH results are in agreement with those based on RFLP analysis. The pBG13 probe containing 5S sequence from flax detected two separate clusters corresponding to the two size classes of units that coexist within 5S rDNA of most Populus species. Key words : Populus spp., fluorescent in situ hybridization, FISH, rDNA variability, image analysis.

  11. The Wall-Rock Record of Incremental Emplacement in the Little Cottonwood-Alta Magmatic and Hydrothermal System, Wasatch Mountains, Utah, U.S.A.

    Science.gov (United States)

    Stearns, M.; Callis, S.; Beno, C.; Bowman, J. R.; Bartley, J. M.

    2017-12-01

    Contact aureoles record the cumulative effects on wall rocks of magma emplacement. Like the plutons they surround, contact aureoles have long been regarded to form geologically instantaneously. Protracted incremental emplacement of plutons must be reconciled with the wall-rock record of heat and mass transfer. Fundamental questions include how heat and material move from intrusions into their aureoles and how long that process takes. The Little Cottonwood stock is surrounded by a 2 km-wide contact aureole that contains prograde AFM mineral assemblages in the pelitic layers of the Proterozoic Big Cottonwood Formation. The Alta stock is surrounded by a well characterized 1 km-wide contact aureole containing both prograde AFM and CMS mineral assemblages in Ophir Shale and Mississippian dolostones, respectively. Understanding the petrogenesis of these aureoles requires the timing of magmatism and wall-rock metamorphism to be independently determined. Preliminary petrochronology (U/Th-Pb dates and trace element concentrations collected by LASS-ICP-MS) from the inner aureoles of both intrusions establishes a protracted history of monazite (re)crystallization from 35-25 Ma in the Little Cottonwood aureole and 35 Ma in the Alta aureole. Little Cottonwood aureole monazites are characterized by a positive age correlation with heavy rare earth elements (HREE) and a negative correlation with Eu/Eu*. Alta aureole monazites have a similar range of the HREE concentrations and Eu/Eu* variation. Zircon growth interpreted to record emplacement-level magmatic crystallization of the western Little Cottonwood stock ranges from 33-28 Ma near the contact. Multi-grain U-Pb zircon TIMS dates from the Alta stock range from 35-33 Ma and are interpreted to suggest the full range of emplacement-level magmatism in the Alta stock. Additionally, in situ U-Pb titanite dates from the Alta stock record intermittent high temperature hydrothermal activity in the stock margin from 35-24 Ma. These new

  12. [Seasonal variation of Tamarix ramosissima and Populus euphratica water potentials in southern fringe of Taklamakan Desert].

    Science.gov (United States)

    Zeng, Fanjiang; Zhang, Ximing; Li, Xiangyi; Foetzki, Andrea; Runge, Michael

    2005-08-01

    The measurement of the seasonal and diurnal variations of Tamarix ramosissima and Populus euphratica water potentials in the southern fringe of Taklamakan Desert indicated that there was no apparent water stress for the two species during their growth period, with little change of predawn water potential and some extent decrease of midday water potential. Irrigation once or thinning had no significant effects on the water status of the plants, while groundwater appeared to be a prerequisite for the survival and growth of these species. It is very important to ensure a stable groundwater table for the restoration of Tamarix ramosissima and Populus euphratica in this area.

  13. Optimization of agrobacterium tumefaciens mediated transformation in populus deltoides

    International Nuclear Information System (INIS)

    John, E.; Maqbool, A.; Malik, K.A.

    2014-01-01

    The objective of the study was to develop an efficient protocol for Populus deltoides transformation through Agrobacterium tumefaciens LBA4404. Agrobacterium strain harboring binary plasmid pGA482 with Gus (uidA) gene under CamV35S promoter and Neomycin phosphotransferase (nptII) gene under Nos promoter was used for the transformation. Nodal, internodal and leaf explants from 4-5 months In vitro and fieldgrown plants were used for the transformation. Transformation was done under different conditions including, preculture time, optical density, acetosyringone concentration, infection time and co-cultivation time. Confirmation of transformation was done through GUS histochemical staining. Highest transformation efficiency was observed in one week precultured leaf explants from field grown source on preculture medium containing 200 meu M acetosyringone. Precultured explants from In vitro source also gave good results for transformation but the callus formation was found to be slow in leaf explant. Calli from the both sources did not show any transformation when infected with O.D A600nm range from 0.3-0.8. Node and internode though showed less transformation rate but the callogenesis was found to be highest in node and internode explants on CIM 1. Leaf explants from field source also gave high callus induction on CIM 5. A. tumefaciens O.D A600nm 0.3-0.5 was found to be effective. Infection time of 1-2 hour and co-cultivation time of 1day in dark were found to be optimum for the transformation. 200mg/l of timentin was found the best to control the overgrowth of Agrobacterium.100mg/l Kanamycin in growth medium was found to sufficient for selection for transformants. Selected transformants were confirmed through PCR for the presence of transgene. The present protocol for P. deltoides was found to be efficient for genetic transformation and can be used to introduce novel traits in the P. deltoides. (author)

  14. Sex-specific responses of Populus deltoides to defoliation

    Directory of Open Access Journals (Sweden)

    Li Shuxin

    2017-12-01

    Full Text Available There has been an increasing interest in understanding the differential effects of sexual dimorphism on plant stress responses. However, there is no clear pattern in the responses of the sexes to defoliation. In this study, the effects of different severity of artificial defoliation on biomass production, total nonstructural carbohydrate (NSC concentration, and photosynthetic rate (PN of male and female Populus deltoides were examined. We used half and full defoliation to observe the differences between the sexes in three harvest dates (1 week, 4 weeks, and 8 weeks after treatments. We hypothesized that female and male P. deltoides compared with an undefoliated control would have compensatory growth in response to defoliation treatments. Results showed that half and full defoliation reduced the growth of both sexes. Following half defoliation, root growth was reduced, especially in males, at T2 (4 weeks after defoliation and T3 (8 weeks after defoliation, while males showed an increase in height increment under the half defoliation compared with the nondefoliation treatments. By contrast, females were more negatively affected by defoliation than males in terms of biomass after 8 weeks. One week after defoliation, PN increased significantly in females and males under half defoliation (+30%, +32%, respectively and full defoliation (+58%, +56%, respectively. However, 8 weeks after defoliation, there was little difference in PN between defoliated and undefoliated female cuttings. Increases in stomatal conductance (gs and leaf nitrogen were observed under fully defoliated female and male cuttings. Moreover, males had less NSC concentrations following half defoliation compared with females. Our results indicate that leaf compensatory growth in male cuttings of P. deltoides was maintained by obtaining greater photosynthetic capacity, higher leaf nitrogen, and lower NSC concentration following half and full defoliation. Our results highlight that

  15. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume I Kootenai River (Overview, Report and Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  16. Soil temperature and precipitation affect the rooting ability of dormant hardwood cuttings of Populus

    Science.gov (United States)

    R.S., Jr. Zalesny; R.B. Hall; E.O. Bauer; D.E. Riemenschneider

    2005-01-01

    In addition to genetic control, responses to environmental stimuli affect the success of rooting. Our objectives were to: 1) assess the variation in rooting ability among 21 Populus clones grown under varying soil temperatures and amounts of precipitation and 2) identify combinations of soil temperature and precipitation that promote rooting. The...

  17. Shoot position affects root initiation and growth of dormant unrooted cuttings of Populus

    Science.gov (United States)

    R.S., Jr. Zalesny; R.B. Hall; E.O. Bauer; D.E. Riemenschneider

    2003-01-01

    Rooting of dormant unrooted cuttings is crucial to the commercial deployment of intensively cultured poplar (Populus spp.) plantations because it is the first biological prerequisite to stand establishment. Rooting can be genetically controlled and subject to selection. Thus, our objective was to test for differences in rooting ability among cuttings...

  18. Light regimes in Populus plantations using the Voxel-based Light Interception Model

    NARCIS (Netherlands)

    Van der Zande, D.; Dieussart, K.; Stuckens, J.; Verstraeten, W.W.; Coppin, P.

    2011-01-01

    Three-dimensional light interception by three uniform Populus canopies was studied using the Voxel-based Light Interception Model (VLIM) in combination with ground-based Light Detection and Ranging (LiDAR) measurements. As the VLIM was developed and validated in a virtual environment to ensure

  19. Constitutively elevated salicylic acid levels alter photosynthesis and oxidative state but not growth in transgenic populus.

    Science.gov (United States)

    Xue, Liang-Jiao; Guo, Wenbing; Yuan, Yinan; Anino, Edward O; Nyamdari, Batbayar; Wilson, Mark C; Frost, Christopher J; Chen, Han-Yi; Babst, Benjamin A; Harding, Scott A; Tsai, Chung-Jui

    2013-07-01

    Salicylic acid (SA) has long been implicated in plant responses to oxidative stress. SA overproduction in Arabidopsis thaliana leads to dwarfism, making in planta assessment of SA effects difficult in this model system. We report that transgenic Populus tremula × alba expressing a bacterial SA synthase hyperaccumulated SA and SA conjugates without negative growth consequences. In the absence of stress, endogenously elevated SA elicited widespread metabolic and transcriptional changes that resembled those of wild-type plants exposed to oxidative stress-promoting heat treatments. Potential signaling and oxidative stress markers azelaic and gluconic acids as well as antioxidant chlorogenic acids were strongly coregulated with SA, while soluble sugars and other phenylpropanoids were inversely correlated. Photosynthetic responses to heat were attenuated in SA-overproducing plants. Network analysis identified potential drivers of SA-mediated transcriptome rewiring, including receptor-like kinases and WRKY transcription factors. Orthologs of Arabidopsis SA signaling components NON-EXPRESSOR OF PATHOGENESIS-RELATED GENES1 and thioredoxins were not represented. However, all members of the expanded Populus nucleoredoxin-1 family exhibited increased expression and increased network connectivity in SA-overproducing Populus, suggesting a previously undescribed role in SA-mediated redox regulation. The SA response in Populus involved a reprogramming of carbon uptake and partitioning during stress that is compatible with constitutive chemical defense and sustained growth, contrasting with the SA response in Arabidopsis, which is transient and compromises growth if sustained.

  20. Influence of Populus Genotype on Gene Expression by the Wood Decay Fungus Phanerochaete chrysosporium

    Science.gov (United States)

    Jill Gaskell; Amber Marty; Michael Mozuch; Philip J. Kersten; Sandra Splinter Bondurant; Grzegorz Sabat; Ali Azarpira; John Ralph; Oleksandr Skyba; Shawn D. Mansfield; Robert A. Blanchette; Dan Cullen

    2014-01-01

    We examined gene expression patterns in the lignin-degrading fungus Phanerochaete chrysosporium when it colonizes hybrid poplar (Populus alba tremula) and syringyl (S)-rich transgenic derivatives. Acombination ofmicroarrays and liquid chromatography- tandem mass spectrometry (LC-MS/MS) allowed detection of a total of 9,959 transcripts and 793...

  1. Multilocus analysis of nucleotide variation and speciation in three closely related Populus (Salicaceae) species.

    Science.gov (United States)

    Du, Shuhui; Wang, Zhaoshan; Ingvarsson, Pär K; Wang, Dongsheng; Wang, Junhui; Wu, Zhiqiang; Tembrock, Luke R; Zhang, Jianguo

    2015-10-01

    Historical tectonism and climate oscillations can isolate and contract the geographical distributions of many plant species, and they are even known to trigger species divergence and ultimately speciation. Here, we estimated the nucleotide variation and speciation in three closely related Populus species, Populus tremuloides, P. tremula and P. davidiana, distributed in North America and Eurasia. We analysed the sequence variation in six single-copy nuclear loci and three chloroplast (cpDNA) fragments in 497 individuals sampled from 33 populations of these three species across their geographic distributions. These three Populus species harboured relatively high levels of nucleotide diversity and showed high levels of nucleotide differentiation. Phylogenetic analysis revealed that P. tremuloides diverged earlier than the other two species. The cpDNA haplotype network result clearly illustrated the dispersal route from North America to eastern Asia and then into Europe. Molecular dating results confirmed that the divergence of these three species coincided with the sundering of the Bering land bridge in the late Miocene and a rapid uplift of the Qinghai-Tibetan Plateau around the Miocene/Pliocene boundary. Vicariance-driven successful allopatric speciation resulting from historical tectonism and climate oscillations most likely played roles in the formation of the disjunct distributions and divergence of these three Populus species. © 2015 John Wiley & Sons Ltd.

  2. Litter Quality of Populus Species as Affected by Free-Air CO2

    NARCIS (Netherlands)

    Vermue, E.; Buurman, P.; Hoosbeek, M.R.

    2009-01-01

    The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter

  3. Molecular genetic analysis of black poplar (Populus nigra L.) along Dutch rivers

    NARCIS (Netherlands)

    Arens, P.; Coops, H.; Jansen, J.; Vosman, B.

    1998-01-01

    The genetic structure of remaining black poplar (Populus nigra) trees on the banks of the Dutch Rhine branches was investigated using the AFLP technique. In total, 143 trees, including one P. deltoides and some P. x euramericana, were analysed using six AFLP primer combinations which generated 319

  4. A role for stomata in regulating water use efficiency in Populus x ...

    African Journals Online (AJOL)

    A role for stomata in regulating water use efficiency in Populus x euramericana and characterization of a related gene, PdERECTA. P Guo, X Xia, WL Yin. Abstract. The physiological mechanism of water use efficiency (WUE) remains elucidated, especially in poplar. We studied WUEi (instantaneous leaf transpiration ...

  5. Transcriptional and Hormonal Regulation of Gravitropism of Woody Stems in Populus

    Science.gov (United States)

    Suzanne Gerttula; Matthew S. Zinkgraf; Gloria K. Muday; Daniel R. Lewis; Farid M. Ibatullin; Harry Brumer; Foster Hart; Shawn D. Mansfield; Vladimir Filkov; Andrew Groover

    2015-01-01

    Angiosperm trees reorient their woody stems by asymmetrically producing a specialized xylem tissue, tension wood, which exerts a strong contractile force resulting in negative gravitropism of the stem. Here, we show, in Populus trees, that initial gravity perception and response occurs in specialized cells through sedimentation of starch-filled...

  6. Use of belowground growing degree days to predict rooting of dormant hardwood cuttings of Populus

    Science.gov (United States)

    R.S., Jr. Zalesny; E.O. Bauer; D.E. Riemenschneider

    2004-01-01

    Planting Populus cuttings based on calendar days neglects soil temperature extremes and does not promote rooting based on specific genotypes. Our objectives were to: 1) test the biological efficacy of a thermal index based on belowground growing degree days (GDD) across the growing period, 2) test for interactions between belowground GDD and clones,...

  7. Bud removal affects shoot, root, and callus development of hardwood Populus cuttings

    Science.gov (United States)

    A.H. Wiese; J.A. Zalesny; D.M. Donner; Ronald S., Jr. Zalesny

    2006-01-01

    The inadvertent removal and/or damage of buds during processing and planting of hardwood poplar (Populus spp.) cuttings are a concern because of their potential impact on shoot and root development during establishment. The objective of the current study was to test for differences in shoot dry mass, root dry mass, number of roots, length of the...

  8. Leaf chemical composition of twenty-one Populus hybrid clones grown under intensive culture

    Science.gov (United States)

    Richard E. Dickson; Philip R. Larson

    1976-01-01

    Leaf material from 21 nursery-grown Populus hybrid clones was analyzed for three nitrogen fractions (total N, soluble protein, and soluble amino acids) and three carbhydrate fractions (reducing sugars, total soluble sugars, and total nonstructural carbohydrates-TNC). In addition, nursery-grown green ash and silver maple, field-grown bigtooth and trembling aspen, and...

  9. Chloride and sodium uptake potential over an entire rotation of Populus irrigated with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny

    2009-01-01

    There is a need for information about the response of Populus genotypes to repeated application of high-salinity water and nutrient sources throughout an entire rotation. We have combined establishment biomass and uptake data with mid- and full-rotation growth data to project potential chloride (Cl−) and sodium (Na...

  10. Clonal variation in lateral and basal rooting of Populus irrigated with landfill leachate

    Science.gov (United States)

    R.S. Zalesny Jr.; J.A. Zalesny

    2011-01-01

    Successful establishment and productivity of Populus depends upon adventitious rooting from: 1) lateral roots that develop from either preformed or induced primordia and 2) basal roots that differentiate from callus at the base of the cutting in response to wounding. Information is needed for phytotechnologies about the degree to which ...

  11. Evaluation of Populus and Salix continuously irrigated with landfill leachate I. Genotype-specific elemental phytoremediation.

    Science.gov (United States)

    Zalesny, Ronald S; Bauer, Edmund O

    2007-01-01

    There is a need for the identification and selection of specific tree genotypes that can sequester elements from contaminated soils, with elevated rates of uptake. We irrigated Populus (DN17, DN182, DN34, NM2, NM6) and Salix (94003, 94012, S287, S566, SX61) genotypes planted in large soil-filled containers with landfill leachate or municipal water and tested for differences in inorganic element concentrations (P, K, Ca, Mg, S, Zn, B, Mn, Fe, Cu, Al, Na, and Cl) in the leaves, stems, and roots. Trees were irrigated with leachate or water during the final 12 wk of the 18-wk study. Genotype-specific uptake existed. For genera, tissue concentrations exhibited four responses. First, Populus had the greatest uptake of P, K, S, Cu, and Cl. Second, Salix exhibited the greatest uptake of Zn, B, Fe, and Al. Third, Salix had greater concentrations of Ca and Mg in leaves, while Populus had greater concentrations in stems and roots. Fourth, Populus had greater concentrations of Mn and Na in leaves and stems, while Salix had greater concentrations in roots. Populus deltoides x P. nigra clones exhibited better overall phytoremediation than the P. nigra x P. maximowiczii genotypes tested. Phytoremediation for S. purpurea clones 94003 and 94012 was generally less than for other Salix genotypes. Overall, concentrations of elements in the leaves, stems, and roots corroborated those in the plant-sciences literature. Uptake was dependent upon the specific genotype for most elements. Our results corroborated the need for further testing and selecting of specific clones for various phytoremediation needs, while providing a baseline for future researchers developing additional studies and resource managers conducting on-site remediation.

  12. Biochemical basis of drought tolerance in hybrid Populus grown under field production conditions. CRADA final report

    Energy Technology Data Exchange (ETDEWEB)

    Tschaplinski, T.J.; Tuskan, G.A. [Oak Ridge National Lab., TN (United States); Wierman, C. [Boise Cascade Corp., Wallula, WA (United States)

    1997-04-01

    The purpose of this cooperative effort was to assess the use of osmotically active compounds as molecular selection criteria for drought tolerance in Populus in a large-scale field trial. It is known that some plant species, and individuals within a plant species, can tolerate increasing stress associated with reduced moisture availability by accumulating solutes. The biochemical matrix of such metabolites varies among species and among individuals. The ability of Populus clones to tolerate drought has equal value to other fiber producers, i.e., the wood products industry, where irrigation is used in combination with other cultural treatments to obtain high dry weight yields. The research initially involved an assessment of drought stress under field conditions and characterization of changes in osmotic constitution among the seven clones across the six moisture levels. The near-term goal was to provide a mechanistic basis for clonal differences in productivity under various irrigation treatments over time.

  13. PROCESS OPTIMIZATION OF TETRA ACETYL ETHYLENE DIAMINE ACTIVATED HYDROGEN PEROXIDE BLEACHING OF POPULUS NIGRA CTMP

    OpenAIRE

    Qiang Zhao; Junwen Pu; Shulei Mao; Guibo Qi

    2010-01-01

    To enhance the bleaching efficiency, the activator of tetra acetyl ethylene diamine (TAED) was used in conventional H2O2 bleaching. The H2O2/TAED bleaching system can accelerate the reaction rate and shorten bleaching time at relative low temperature, which can reduce the production cost. In this research, the process with hydrogen peroxide activated by TAED bleaching of Populus nigra chemi-thermo mechanical pulp was optimized. Suitable bleaching conditions were confirmed as follows: pulp con...

  14. Litter Quality of Populus Species as Affected by Free-Air CO2

    OpenAIRE

    Vermue, E.; Buurman, P.; Hoosbeek, M.R.

    2009-01-01

    The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher c...

  15. Stem respiration of Populus species in the third year of free-air CO2 enrichment

    OpenAIRE

    GIELEN, Birgit; Scarascia-Mugnozza, G.; Ceulemans, R.

    2003-01-01

    Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO2 concentrations. Regarding this question, effects of elevated [CO2 ] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-...

  16. Genetic analysis of post-mating reproductive barriers in hybridizing European Populus species.

    Science.gov (United States)

    Macaya-Sanz, D; Suter, L; Joseph, J; Barbará, T; Alba, N; González-Martínez, S C; Widmer, A; Lexer, C

    2011-10-01

    Molecular genetic analyses of experimental crosses provide important information on the strength and nature of post-mating barriers to gene exchange between divergent populations, which are topics of great interest to evolutionary geneticists and breeders. Although not a trivial task in long-lived organisms such as trees, experimental interspecific recombinants can sometimes be created through controlled crosses involving natural F(1)'s. Here, we used this approach to understand the genetics of post-mating isolation and barriers to introgression in Populus alba and Populus tremula, two ecologically divergent, hybridizing forest trees. We studied 86 interspecific backcross (BC(1)) progeny and >350 individuals from natural populations of these species for up to 98 nuclear genetic markers, including microsatellites, indels and single nucleotide polymorphisms, and inferred the origin of the cytoplasm of the cross with plastid DNA. Genetic analysis of the BC(1) revealed extensive segregation distortions on six chromosomes, and >90% of these (12 out of 13) favored P. tremula donor alleles in the heterospecific genomic background. Since selection was documented during early diploid stages of the progeny, this surprising result was attributed to epistasis, cyto-nuclear coadaptation, heterozygote advantage at nuclear loci experiencing introgression or a combination of these. Our results indicate that gene flow across 'porous' species barriers affects these poplars and aspens beyond neutral, Mendelian expectations and suggests the mechanisms responsible. Contrary to expectations, the Populus sex determination region is not protected from introgression. Understanding the population dynamics of the Populus sex determination region will require tests based on natural interspecific hybrid zones.

  17. Selecting and utilizing Populus and Salix for landfill covers: implications for leachate irrigation.

    Science.gov (United States)

    Zalesny, Ronald S; Bauer, Edmund O

    2007-01-01

    The success of using Populus and Salix for phytoremediation has prompted further use of leachate as a combination of irrigation and fertilization for the trees. A common protocol for such efforts has been to utilize a limited number of readily-available genotypes with decades of deployment in other applications, such as fiber or windbreaks. However, it may be possible to increase phytoremediation success with proper genotypic screening and selection, followed by the field establishment of clones that exhibited favorable potential for cleanup of specific contaminants. There is an overwhelming need for testing and subsequent deployment of diverse Populus and Salix genotypes, given current availability of clonal material and the inherent genetic variation among and within these genera. Therefore, we detail phyto-recurrent selection, a method that consists of revising and combining crop and tree improvement protocols to meet the objective of utilizing superior Populus and Salix clones for remediation applications. Although such information is lacking for environmental clean-up technologies, centuries of plant selection success in agronomy, horticulture, and forestry validate the need for similar approaches in phytoremediation. We bridge the gap between these disciplines by describing project development, clone selection, tree establishment, and evaluation of success metrics in the context of their importance to utilizing trees for phytoremediation.

  18. Preparation and Characterization of Lignocellulosic Oil Sorbent by Hydrothermal Treatment of Populus Fiber

    Directory of Open Access Journals (Sweden)

    Yue Zhang

    2014-09-01

    Full Text Available This study is aimed at achieving the optimum conditions of hydrothermal treatment and acetylation of Populus fiber to improve its oil sorption capacity (OSC in an oil-water mixture. The characteristics of the hydrolyzed and acetylated fibers were comparatively investigated by FT-IR, CP-MAS 13C-NMR, SEM and TGA. The optimum conditions of the hydrothermal treatment and acetylation were obtained at170 °C for 1 h and 120 °C for 2 h, respectively. The maximum OSC of the hydrolyzed fiber (16.78 g/g was slightly lower than that of the acetylated fiber (21.57 g/g, but they were both higher than the maximum OSC of the unmodified fiber (3.94 g/g. In addition, acetylation after hydrothermal treatment for the Populus fiber was unnecessary as the increment of the maximum OSC was only 3.53 g/g. The hydrolyzed and the acetylated Populus fibers both displayed a lumen orifice enabling a high oil entrapment. The thermal stability of the modified fibers was shown to be increased in comparison with that of the raw fiber. The hydrothermal treatment offers a new approach to prepare lignocellulosic oil sorbent.

  19. Diversity of cuticular wax among Salix species and Populus species hybrids.

    Science.gov (United States)

    Cameron, Kimberly D; Teece, Mark A; Bevilacqua, Eddie; Smart, Lawrence B

    2002-08-01

    The leaf cuticular waxes of three Salix species and two Populus species hybrids, selected for their ability to produce high amounts of biomass, were characterized. Samples were extracted in CH(2)Cl(2) three times over the growing season. Low kV SEM was utilized to observe differences in the ultrastructure of leaf surfaces from each clone. Homologous series of wax components were classified into organic groups, and the variation in wax components due to clone, sample time, and their interaction was identified. All Salix species and Populus species hybrids showed differences in total wax load at each sampling period, whereas the pattern of wax deposition over time differed only between the Salix species. A strong positive relationship was identified between the entire homologous series of alcohols and total wax load in all clones. Similarly strong relationships were observed between fatty acids and total wax load as well as fatty acids and alcohols in two Salix species and one Populus species hybrid. One Salix species, S. dasyclados, also displayed a strong positive relationship between alcohols and alkanes. These data indicate that species grown under the same environmental conditions produce measurably different cuticular waxes and that regulation of wax production appears to be different in each species. The important roles cuticular waxes play in drought tolerance, pest, and pathogen resistance, as well as the ease of wax extraction and analysis, strongly suggest that the characteristics of the cuticular wax may prove to be useful selectable traits in a breeding program.

  20. Genetic basis of aboveground productivity in two native Populus species and their hybrids.

    Science.gov (United States)

    Lojewski, Nathan R; Fischer, Dylan G; Bailey, Joseph K; Schweitzer, Jennifer A; Whitham, Thomas G; Hart, Stephen C

    2009-09-01

    Demonstration of genetic control over riparian tree productivity has major implications for responses of riparian systems to shifting environmental conditions and effects of genetics on ecosystems in general. We used field studies and common gardens, applying both molecular and quantitative techniques, to compare plot-level tree aboveground net primary productivity (ANPP(tree)) and individual tree growth rate constants in relation to plant genetic identity in two naturally occurring Populus tree species and their hybrids. In field comparisons of four cross types (Populus fremontii S. Wats., Populus angustifolia James, F(1) hybrids and backcross hybrids) across 11 natural stands, productivity was greatest for P. fremontii trees, followed by hybrids and lowest in P. angustifolia. A similar pattern was observed in four common gardens across a 290 m elevation and 100 km environmental gradient. Despite a doubling in productivity across the common gardens, the relative differences among the cross types remained constant. Using clonal replicates in a common garden, we found ANPP(tree) to be a heritable plant trait (i.e., broad-sense heritability), such that plant genetic factors explained between 38% and 82% of the variation in ANPP(tree). Furthermore, analysis of the genetic composition among individual tree genotypes using restriction fragment length polymorphism molecular markers showed that genetically similar trees also exhibited similar ANPP(tree). These findings indicate strong genetic contributions to natural variation in ANPP with important ecological implications.

  1. Cadmium accumulation and growth responses of a poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil

    International Nuclear Information System (INIS)

    Wu Fuzhong; Yang Wanqin; Zhang Jian; Zhou Liqiang

    2010-01-01

    To characterize the phytoextraction efficiency of a hybrid poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil, a pot experiment in field was carried out in Sichuan basin, western China. After one growing period, the poplar accumulated the highest of 541.98 ± 19.22 and 576.75 ± 40.55 μg cadmium per plant with 110.77 ± 12.68 and 202.54 ± 19.12 g dry mass in these contaminated purple soil and alluvial soil, respectively. Higher phytoextraction efficiency with higher cadmium concentration in tissues was observed in poplar growing in purple soil than that in alluvial soil at relative lower soil cadmium concentration. The poplar growing in alluvial soil had relative higher tolerance ability with lower reduction rates of morphological and growth characters than that in purple soil, suggesting that the poplar growing in alluvial soil might display the higher phytoextraction ability when cadmium contamination level increased. Even so, the poplars exhibited obvious cadmium transport from root to shoot in both soils regardless of cadmium contamination levels. It implies that this examined poplar can extract more cadmium than some hyperaccumulators. The results indicated that metal phytoextraction using the poplar can be applied to clean up soils moderately contaminated by cadmium in these purple soil and alluvial soil.

  2. Cadmium accumulation and growth responses of a poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil

    Energy Technology Data Exchange (ETDEWEB)

    Wu Fuzhong [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China); Yang Wanqin, E-mail: scyangwq@163.com [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China); Zhang Jian; Zhou Liqiang [Faculty of Forestry, Sichuan Agricultural University, 625014, Ya' an (China)

    2010-05-15

    To characterize the phytoextraction efficiency of a hybrid poplar (Populus deltoids x Populus nigra) in cadmium contaminated purple soil and alluvial soil, a pot experiment in field was carried out in Sichuan basin, western China. After one growing period, the poplar accumulated the highest of 541.98 {+-} 19.22 and 576.75 {+-} 40.55 {mu}g cadmium per plant with 110.77 {+-} 12.68 and 202.54 {+-} 19.12 g dry mass in these contaminated purple soil and alluvial soil, respectively. Higher phytoextraction efficiency with higher cadmium concentration in tissues was observed in poplar growing in purple soil than that in alluvial soil at relative lower soil cadmium concentration. The poplar growing in alluvial soil had relative higher tolerance ability with lower reduction rates of morphological and growth characters than that in purple soil, suggesting that the poplar growing in alluvial soil might display the higher phytoextraction ability when cadmium contamination level increased. Even so, the poplars exhibited obvious cadmium transport from root to shoot in both soils regardless of cadmium contamination levels. It implies that this examined poplar can extract more cadmium than some hyperaccumulators. The results indicated that metal phytoextraction using the poplar can be applied to clean up soils moderately contaminated by cadmium in these purple soil and alluvial soil.

  3. Genetic Modification of Lignin in Hybrid Poplar (Populus alba × Populus tremula) Does Not Substantially Alter Plant Defense or Arthropod Communities.

    Science.gov (United States)

    Buhl, Christine; Meilan, Richard; Lindroth, Richard L

    2017-05-01

    Lignin impedes access to cellulose during biofuel production and pulping but trees can be genetically modified to improve processing efficiency. Modification of lignin may have nontarget effects on mechanical and chemical resistance and subsequent arthropod community responses with respect to pest susceptibility and arthropod biodiversity. We quantified foliar mechanical and chemical resistance traits in lignin-modified and wild-type (WT) poplar (Populus alba × Populus tremula) grown in a plantation and censused arthropods present on these trees to determine total abundance, as well as species richness, diversity and community composition. Our results indicate that mechanical resistance was not affected by lignin modification and only one genetic construct resulted in a (modest) change in chemical resistance. Arthropod abundance and community composition were consistent across modified and WT trees, but transgenics produced using one construct exhibited higher species richness and diversity relative to the WT. Our findings indicate that modification of lignin in poplar does not negatively affect herbivore resistance traits or arthropod community response, and may even result in a source of increased genetic diversity in trees and arthropod communities. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  4. Soils and late-Quaternary landscape evolution in the Cottonwood River basin, east-central Kansas: Implications for archaeological research

    Science.gov (United States)

    Beeton, J.M.; Mandel, R.D.

    2011-01-01

    Temporal and spatial patterns of landscape evolution strongly influence the temporal and spatial patterns of the archaeological record in drainage systems. In this geoarchaeological investigation we took a basin-wide approach in assessing the soil stratigraphy, lithostratigraphy, and geochronology of alluvial deposits and associated buried soils in the Cottonwood River basin of east-central Kansas. Patterns of landscape evolution emerge when stratigraphic sequences and radiocarbon chronologies are compared by stream size and landform type. In the valleys of high-order streams (???4th order) the Younger Dryas Chronozone (ca. 11,000-10,000 14C yr B.P.) was characterized by slow aggradation accompanied by pedogenesis, resulting in the development of organic-rich cumulic soils. Between ca. 10,000 and 4900 14C yr B.P., aggradation punctuated by soil formation was the dominant process in those valleys. Alluvial fans formed on the margins of high-order stream valleys during the early and middle Holocene (ca. 9000-5000 14C yr B.P.) and continued to develop slowly until ca. 3000-2000 14C yr B.P. The late-Holocene record of high-order streams is characterized by episodes of entrenchment, rapid aggradation, and slow aggradation punctuated by soil development. By contrast, the early and middle Holocene (ca. 10,000-5000 14C yr B.P.) was a period of net erosion in the valleys of low-order streams. However, during the late Holocene small valleys became zones of net sediment storage. Consideration of the effects of these patterns of landscape evolution on the archaeological record is crucial for accurately interpreting that record and searching for buried archaeological deposits dating to specific cultural periods. ?? 2011 Wiley Periodicals, Inc. ?? 2011 Wiley Periodicals, Inc..

  5. Kinetic modeling of batch fermentation for Populus hydrolysate tolerant mutant and wild type strains of Clostridium thermocellum.

    Science.gov (United States)

    Linville, Jessica L; Rodriguez, Miguel; Mielenz, Jonathan R; Cox, Chris D

    2013-11-01

    The extent of inhibition of two strains of Clostridium thermocellum by a Populus hydrolysate was investigated. A Monod-based model of wild type (WT) and Populus hydrolysate tolerant mutant (PM) strains of the cellulolytic bacterium C. thermocellum was developed to quantify growth kinetics in standard media and the extent of inhibition to a Populus hydrolysate. The PM was characterized by a higher growth rate (μmax=1.223 vs. 0.571 h(-1)) and less inhibition (KI,gen=0.991 vs. 0.757) in 10% v/v Populus hydrolysate compared to the WT. In 17.5% v/v Populus hydrolysate inhibition of PM increased slightly (KI,gen=0.888), whereas the WT was strongly inhibited and did not grow in a reproducible manner. Of the individual inhibitors tested, 4-hydroxybenzoic acid was the most inhibitory, followed by galacturonic acid. The PM did not have a greater ability to detoxify the hydrolysate than the WT. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Twenty-one genome sequences from Pseudomonas species and 19 genome sequences from diverse bacteria isolated from the rhizosphere and endosphere of Populus deltoides.

    Science.gov (United States)

    Brown, Steven D; Utturkar, Sagar M; Klingeman, Dawn M; Johnson, Courtney M; Martin, Stanton L; Land, Miriam L; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A

    2012-11-01

    To aid in the investigation of the Populus deltoides microbiome, we generated draft genome sequences for 21 Pseudomonas strains and 19 other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium, and Variovorax were generated.

  7. Twenty-One Genome Sequences from Pseudomonas Species and 19 Genome Sequences from Diverse Bacteria Isolated from the Rhizosphere and Endosphere of Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Steven D [ORNL; Utturkar, Sagar M [ORNL; Klingeman, Dawn Marie [ORNL; Johnson, Courtney M [ORNL; Martin, Stanton [ORNL; Land, Miriam L [ORNL; Lu, Tse-Yuan [ORNL; Schadt, Christopher Warren [ORNL; Doktycz, Mitchel John [ORNL; Pelletier, Dale A [ORNL

    2012-01-01

    To aid in the investigation of the Populus deltoides microbiome we generated draft genome sequences for twenty one Pseudomonas and twenty one other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Burkholderia, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium and Variovorax were generated.

  8. Elevated atmospheric CO2 concentration leads to increased whole-plant isoprene emission in hybrid aspen (Populus tremula × Populus tremuloides).

    Science.gov (United States)

    Sun, Zhihong; Niinemets, Ülo; Hüve, Katja; Rasulov, Bahtijor; Noe, Steffen M

    2013-05-01

    Effects of elevated atmospheric [CO2] on plant isoprene emissions are controversial. Relying on leaf-scale measurements, most models simulating isoprene emissions in future higher [CO2] atmospheres suggest reduced emission fluxes. However, combined effects of elevated [CO2] on leaf area growth, net assimilation and isoprene emission rates have rarely been studied on the canopy scale, but stimulation of leaf area growth may largely compensate for possible [CO2] inhibition reported at the leaf scale. This study tests the hypothesis that stimulated leaf area growth leads to increased canopy isoprene emission rates. We studied the dynamics of canopy growth, and net assimilation and isoprene emission rates in hybrid aspen (Populus tremula × Populus tremuloides) grown under 380 and 780 μmol mol(-1) [CO2]. A theoretical framework based on the Chapman-Richards function to model canopy growth and numerically compare the growth dynamics among ambient and elevated atmospheric [CO2]-grown plants was developed. Plants grown under elevated [CO2] had higher C : N ratio, and greater total leaf area, and canopy net assimilation and isoprene emission rates. During ontogeny, these key canopy characteristics developed faster and stabilized earlier under elevated [CO2]. However, on a leaf area basis, foliage physiological traits remained in a transient state over the whole experiment. These results demonstrate that canopy-scale dynamics importantly complements the leaf-scale processes, and that isoprene emissions may actually increase under higher [CO2] as a result of enhanced leaf area production. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  9. Diversification and expression of the PIN, AUX/LAX and ABCB families of putative auxin transporters in Populus

    Directory of Open Access Journals (Sweden)

    Nicola eCarraro

    2012-02-01

    Full Text Available Intercellular transport of the plant hormone auxin is mediated by three families of membrane-bound protein carriers, with the PIN and ABCB families coding primarily for efflux proteins and the AUX/LAX family coding for influx proteins. In the last decade our understanding of gene and protein function for these transporters in Arabidopsis has expanded rapidly but very little is known about their role in woody plant development. Here we present a comprehensive account of all three families in the model woody species Populus, including chromosome distribution, protein structure, quantitative gene expression, and evolutionary relationships. The PIN and AUX/LAX gene families in Populus comprise 16 and 8 members respectively, and show evidence for the retention of paralogs following a relatively recent whole genome duplication. There is also evidence for differential expression across tissues within many gene pairs. The ABCB family is previously undescribed in Populus and includes 20 members, showing a much deeper evolutionary history including both tandem and whole genome duplication as well as probable loss. A striking number of these transporters are expressed in developing Populus stems and we suggest that evolutionary and structural relationships with known auxin transporters in Arabidopsis can point toward candidate genes for further study in Populus. This is especially important for the ABCBs, which is a large family and includes members in Arabidopsis that are able to transport other substrates in addition to auxin. Protein modeling, sequence alignment and expression data all point to ABCB1.1 as a likely auxin transport protein in Populus. Given that basipetal auxin flow through the cambial zone shapes the development of woody stems, it is important that we identify the full complement of proteins involved in this process. This work should lay the foundation for studies targeting specific proteins for functional characterization and in situ

  10. Deserts in the Deluge: TerraPopulus and Big Human-Environment Data.

    Science.gov (United States)

    Manson, S M; Kugler, T A; Haynes, D

    2016-01-01

    Terra Populus, or TerraPop, is a cyberinfrastructure project that integrates, preserves, and disseminates massive data collections describing characteristics of the human population and environment over the last six decades. TerraPop has made a number of GIScience advances in the handling of big spatial data to make information interoperable between formats and across scientific communities. In this paper, we describe challenges of these data, or 'deserts in the deluge' of data, that are common to spatial big data more broadly, and explore computational solutions specific to microdata, raster, and vector data models.

  11. Generalized allometric regression to estimate biomass of Populus in short-rotation coppice

    Energy Technology Data Exchange (ETDEWEB)

    Ben Brahim, Mohammed; Gavaland, Andre; Cabanettes, Alain [INRA Centre de Toulouse, Castanet-Tolosane Cedex (France). Unite Agroforesterie et Foret Paysanne

    2000-07-01

    Data from four different stands were combined to establish a single generalized allometric equation to estimate above-ground biomass of individual Populus trees grown on short-rotation coppice. The generalized model was performed using diameter at breast height, the mean diameter and the mean height of each site as dependent variables and then compared with the stand-specific regressions using F-test. Results showed that this single regression estimates tree biomass well at each stand and does not introduce bias with increasing diameter.

  12. Chloride and sodium uptake potential over an entire rotation of Populus irrigated with landfill leachate.

    Science.gov (United States)

    Zalesny, Jill A; Zalesny, Ronald S

    2009-07-01

    There is a need for information about the response of Populus genotypes to repeated application of high-salinity water and nutrient sources throughout an entire rotation. We have combined establishment biomass and uptake data with mid- and full-rotation growth data to project potential chloride (Cl-) and sodium (Na+) uptake for 2- to 11-year-old Populus in the north central United States. Our objectives were to identify potential levels of uptake as the trees developed and stages of plantation development that are conducive to variable application rates of high-salinity irrigation. The projected cumulative uptake of Cl- and Na+ during mid-rotation plantation development was stable 2 to 3 years after planting but increased steadily from year 3 to 6. Year six cumulative uptake ranged from 22 to 175 kg Cl- ha(-1) and 8 to 74 kg Na+ ha(-1), while annual uptake ranged from 8 to 54 kg Cl- ha(-1) yr(-1) and 3 to 23 kg Na+ ha(-1) yr(-1). Full-rotation uptake was greatest from 4 to 9 years (Cl-) and 4 to 8 years (Na+), with maximum levels of Cl- (32 kg ha(-1) yr(-1)) and Na+ (13 kg ha(-1) yr(-1)) occurring in year six. The relative uptake potential of Cl- and Na+ at peak accumulation (year six) was 2.7 times greater than at the end of the rotation.

  13. Ex situ growth and biomass of Populus bioenergy crops irrigated and fertilized with landfill leachate

    International Nuclear Information System (INIS)

    Zalesny, Ronald S.; Wiese, Adam H.; Bauer, Edmund O.; Riemenschneider, Donald E.

    2009-01-01

    Merging traditional intensive forestry with waste management offers dual goals of fiber and bioenergy production, along with environmental benefits such as soil/water remediation and carbon sequestration. As part of an ongoing effort to acquire data about initial genotypic performance, we evaluated: (1) the early aboveground growth of trees belonging to currently utilized Populus genotypes subjected to irrigation with municipal solid waste landfill leachate or non-fertilized well water (control), and (2) the above- and below-ground biomass of the trees after 70 days of growth. We determined height, diameter, and number of leaves at 28, 42, 56, and 70 days after planting (DAP), along with stem, leaf, and root dry mass by testing six Populus clones (DN34, DN5, I4551, NC14104, NM2, NM6) grown in a greenhouse in a split-split plot, repeated measures design with two blocks, two treatments (whole-plots), six clones (sub-plots), and four sampling dates (sub-sub-plots, repeated measure). Treatments (leachate, water) were applied every other day beginning 42 DAP. The leachate-treated trees exhibited greater height, diameter, and number of leaves at 56 and 70 DAP (P 0.05). Overall, genotypic responses to the leachate treatment were clone-specific for all traits

  14. Transport and use of CO2 in the xylem sap of Populus deltoides

    International Nuclear Information System (INIS)

    Stringer, J.W.; Kimmerer, T.W.

    1990-01-01

    Results of recent experiments indicate an internal cycling of respiratory CO 2 in woody plants. The CO 2 concentration of xylem sap expressed from the twigs of field grown Populus deltoides ranged from .14 to .50 mM. The pH of the xylem sap was 5.7 to 6.7, providing a significant bicarbonate concentration in many samples. Total dissolved inorganic carbon (DIC = CO 2 + H 2 CO 3 + HCO 3 - ) was 0.5 mM to 1.3 mM. Results from the analysis of xylem sap of 10 other species of woody plants were similar. To determine the fate of DIC delivered to the leaves of Populus deltoides, excised leaves were fed 1mM NaHCO 3 (2 μCi NaH 14 CO 3 ml -1 ). Less than 0.4% of the label escaped from the leaves, and ≥93% was fixed. Of the carbon fixed 56% of the 14 C was found in the petiole and midrib, and 14% was in the major veins, with the remaining 30% in the minor veins and lamina. Shading of the peptiole and midrib of leaves decreased the amount of fixed carbon in these tissues to 38% and increased the amount in the lamina to 55%

  15. DNA damage in Populus tremuloides clones exposed to elevated O3

    International Nuclear Information System (INIS)

    Tai, Helen H.; Percy, Kevin E.; Karnosky, David F.

    2010-01-01

    The effects of elevated concentrations of atmospheric tropospheric ozone (O 3 ) on DNA damage in five trembling aspen (Populus tremuloides Michx.) clones growing in a free-air enrichment experiment in the presence and absence of elevated concentrations of carbon dioxide (CO 2 ) were examined. Growing season mean hourly O 3 concentrations were 36.3 and 47.3 ppb for ambient and elevated O 3 plots, respectively. The 4th highest daily maximum 8-h ambient and elevated O 3 concentrations were 79 and 89 ppb, respectively. Elevated CO 2 averaged 524 ppm (+150 ppm) over the growing season. Exposure to O 3 and CO 2 in combination with O 3 increased DNA damage levels above background as measured by the comet assay. Ozone-tolerant clones 271 and 8L showed the highest levels of DNA damage under elevated O 3 compared with ambient air; whereas less tolerant clone 216 and sensitive clones 42E and 259 had comparably lower levels of DNA damage with no significant differences between elevated O 3 and ambient air. Clone 8L was demonstrated to have the highest level of excision DNA repair. In addition, clone 271 had the highest level of oxidative damage as measured by lipid peroxidation. The results suggest that variation in cellular responses to DNA damage between aspen clones may contribute to O 3 tolerance or sensitivity. - Ozone tolerant clones and sensitive Populus tremuloides clones show differences in DNA damage and repair.

  16. Arbuscular mycorrhizal fungi associated with Populus-Salix stands in a semiarid riparian ecosystem

    Science.gov (United States)

    Beauchamp, Vanessa B.; Stromberg, J.C.; Stutz, J.C.

    2006-01-01

    ??? This study examined the activity, species richness, and species composition of the arbuscular mycorrhizal fungal (AMF) community of Populus-Salix stands on the Verde River (Arizona, USA), quantified patterns of AMF richness and colonization along complex floodplain gradients, and identified environmental variables responsible for structuring the AMF community. ??? Samples from 61 Populus-Salix stands were analyzed for AMF and herbaceous composition, AMF colonization, gravimetric soil moisture, soil texture, per cent organic matter, pH, and concentrations of nitrate, bicarbonate phosphorus and exchangeable potassium. ??? AMF species richness declined with stand age and distance from and elevation above the channel and was positively related to perennial species cover and richness and gravimetric soil moisture. Distance from and elevation above the active channel, forest age, annual species cover, perennial species richness, and exchangeable potassium concentration all played a role in structuring the AMF community in this riparian area. ??? Most AMF species were found across a wide range of soil conditions, but a subset of species tended to occur more often in hydric areas. This group of riparian affiliate AMF species includes several not previously encountered in the surrounding Sonoran desert. ?? New Phytologist (2006).

  17. Salt stress induces the formation of a novel type of 'pressure wood' in two Populus species.

    Science.gov (United States)

    Janz, Dennis; Lautner, Silke; Wildhagen, Henning; Behnke, Katja; Schnitzler, Jörg-Peter; Rennenberg, Heinz; Fromm, Jörg; Polle, Andrea

    2012-04-01

    • Salinity causes osmotic stress and limits biomass production of plants. The goal of this study was to investigate mechanisms underlying hydraulic adaptation to salinity. • Anatomical, ecophysiological and transcriptional responses to salinity were investigated in the xylem of a salt-sensitive (Populus × canescens) and a salt-tolerant species (Populus euphratica). • Moderate salt stress, which suppressed but did not abolish photosynthesis and radial growth in P. × canescens, resulted in hydraulic adaptation by increased vessel frequencies and decreased vessel lumina. Transcript abundances of a suite of genes (FLA, COB-like, BAM, XET, etc.) previously shown to be activated during tension wood formation, were collectively suppressed in developing xylem, whereas those for stress and defense-related genes increased. A subset of cell wall-related genes was also suppressed in salt-exposed P. euphratica, although this species largely excluded sodium and showed no anatomical alterations. Salt exposure influenced cell wall composition involving increases in the lignin : carbohydrate ratio in both species. • In conclusion, hydraulic stress adaptation involves cell wall modifications reciprocal to tension wood formation that result in the formation of a novel type of reaction wood in upright stems named 'pressure wood'. Our data suggest that transcriptional co-regulation of a core set of genes determines reaction wood composition. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  18. Formation of wood secondary cell wall may involve two type cellulose synthase complexes in Populus.

    Science.gov (United States)

    Xi, Wang; Song, Dongliang; Sun, Jiayan; Shen, Junhui; Li, Laigeng

    2017-03-01

    Cellulose biosynthesis is mediated by cellulose synthases (CesAs), which constitute into rosette-like cellulose synthase complexe (CSC) on the plasma membrane. Two types of CSCs in Arabidopsis are believed to be involved in cellulose synthesis in the primary cell wall and secondary cell walls, respectively. In this work, we found that the two type CSCs participated cellulose biosynthesis in differentiating xylem cells undergoing secondary cell wall thickening in Populus. During the cell wall thickening process, expression of one type CSC genes increased while expression of the other type CSC genes decreased. Suppression of different type CSC genes both affected the wall-thickening and disrupted the multilaminar structure of the secondary cell walls. When CesA7A was suppressed, crystalline cellulose content was reduced, which, however, showed an increase when CesA3D was suppressed. The CesA suppression also affected cellulose digestibility of the wood cell walls. The results suggest that two type CSCs are involved in coordinating the cellulose biosynthesis in formation of the multilaminar structure in Populus wood secondary cell walls.

  19. Macro- and micro-nutrient concentration in leaf, woody, and root tissue of Populus irrigated with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Bart T. Sexton; Richard B. Hall

    2007-01-01

    Landfill leachate offers an opportunity to supply water and plant nutritional benefits at a lower cost than traditional sources. Information about nutrient uptake and distribution into tissues of Populus irrigated with landfill leachate helps increase biomass production along with evaluating the impacts of leachate chemistry on tree health.

  20. Constitutively Elevated Salicylic Acid Levels Alter Photosynthesis and Oxidative State but Not Growth in Transgenic Populus[C][W

    Science.gov (United States)

    Xue, Liang-Jiao; Guo, Wenbing; Yuan, Yinan; Anino, Edward O.; Nyamdari, Batbayar; Wilson, Mark C.; Frost, Christopher J.; Chen, Han-Yi; Babst, Benjamin A.; Harding, Scott A.; Tsai, Chung-Jui

    2013-01-01

    Salicylic acid (SA) has long been implicated in plant responses to oxidative stress. SA overproduction in Arabidopsis thaliana leads to dwarfism, making in planta assessment of SA effects difficult in this model system. We report that transgenic Populus tremula × alba expressing a bacterial SA synthase hyperaccumulated SA and SA conjugates without negative growth consequences. In the absence of stress, endogenously elevated SA elicited widespread metabolic and transcriptional changes that resembled those of wild-type plants exposed to oxidative stress-promoting heat treatments. Potential signaling and oxidative stress markers azelaic and gluconic acids as well as antioxidant chlorogenic acids were strongly coregulated with SA, while soluble sugars and other phenylpropanoids were inversely correlated. Photosynthetic responses to heat were attenuated in SA-overproducing plants. Network analysis identified potential drivers of SA-mediated transcriptome rewiring, including receptor-like kinases and WRKY transcription factors. Orthologs of Arabidopsis SA signaling components NON-EXPRESSOR OF PATHOGENESIS-RELATED GENES1 and thioredoxins were not represented. However, all members of the expanded Populus nucleoredoxin-1 family exhibited increased expression and increased network connectivity in SA-overproducing Populus, suggesting a previously undescribed role in SA-mediated redox regulation. The SA response in Populus involved a reprogramming of carbon uptake and partitioning during stress that is compatible with constitutive chemical defense and sustained growth, contrasting with the SA response in Arabidopsis, which is transient and compromises growth if sustained. PMID:23903318

  1. Field performance of Populus in short-rotation intensive culture plantations in the north-central U.S.

    Science.gov (United States)

    Edward A. Hansen; Michael E. Ostry; Wendell D. Johnson; David N. Tolsted; Daniel A. Netzer; William E. Berguson; Richard B. Hall

    1994-01-01

    Describes a network of short-rotation, Populus research and demonstration plantations that has been established across a 5-state region in the north-central U.S. to identify suitable hybrid poplar clones for large-scale biomass plantations in the region. Reports 6-year results.

  2. Comparative physiology of allopatric Populus species: geographic clines in photosynthesis, height growth, and carbon isotope discrimination in common gardens.

    Science.gov (United States)

    Soolanayakanahally, Raju Y; Guy, Robert D; Street, Nathaniel R; Robinson, Kathryn M; Silim, Salim N; Albrectsen, Benedicte R; Jansson, Stefan

    2015-01-01

    Populus species with wide geographic ranges display strong adaptation to local environments. We studied the clinal patterns in phenology and ecophysiology in allopatric Populus species adapted to similar environments on different continents under common garden settings. As a result of climatic adaptation, both Populus tremula L. and Populus balsamifera L. display latitudinal clines in photosynthetic rates (A), whereby high-latitude trees of P. tremula had higher A compared to low-latitude trees and nearly so in P. balsamifera (p = 0.06). Stomatal conductance (g s) and chlorophyll content index (CCI) follow similar latitudinal trends. However, foliar nitrogen was positively correlated with latitude in P. balsamifera and negatively correlated in P. tremula. No significant trends in carbon isotope composition of the leaf tissue (δ(13)C) were observed for both species; but, intrinsic water-use efficiency (WUEi) was negatively correlated with the latitude of origin in P. balsamifera. In spite of intrinsically higher A, high-latitude trees in both common gardens accomplished less height gain as a result of early bud set. Thus, shoot biomass was determined by height elongation duration (HED), which was well approximated by the number of days available for free growth between bud flush and bud set. We highlight the shortcoming of unreplicated outdoor common gardens for tree improvement and the crucial role of photoperiod in limiting height growth, further complicating interpretation of other secondary effects.

  3. Biomass traits and candidate genes for bioenergy revealed through association genetics in coppiced European Populus nigra (L.)

    NARCIS (Netherlands)

    Allwright, Mike Robert; Payne, Adrienne; Emiliani, Giovanni; Milner, Suzanne; Viger, Maud; Rouse, Franchesca; Keurentjes, Joost J.B.; Bérard, Aurélie; Wildhagen, Henning; Faivre-Rampant, Patricia; Polle, Andrea; Morgante, Michele; Taylor, Gail

    2016-01-01

    Background: Second generation (2G) bioenergy from lignocellulosic feedstocks has the potential to develop as a sustainable source of renewable energy; however, significant hurdles still remain for large-scale commercialisation. Populus is considered as a promising 2G feedstock and understanding

  4. Date of shoot collection, genotype, and original shoot position affect early rooting of dormant hardwood cuttings of Populus

    Science.gov (United States)

    R. S., Jr. Zalesny; A.H. Wiese

    2006-01-01

    Identifying superior combinations among date of dormant- season shoot collection, genotype, and original shoot position can increase the rooting potential of Populus cuttings. Thus, the objectives of our study were to: 1) evaluate variation among clones in early rooting from hardwood cuttings processed every three weeks from shoots collected...

  5. Spatial Pattern of Populus euphratica Forest Change as Affected by Water Conveyance in the Lower Tarim River

    Directory of Open Access Journals (Sweden)

    Shuhong Peng

    2014-01-01

    Full Text Available To restore declining species, including Populus euphratica and other riparian communities, in the river ecosystem of the lower Tarim River, the ecological water conveyance project (EWCP, as a part of an integrated water resource management plan, was implemented in 2000. The EWCP aims to schedule and manage the water resources in the upper reaches and transfer water to the lower reaches by a series of intermittent water deliveries. The delivered water flows along a modified river channel and nourishes riparian communities by river overflow flooding. Since it began, it has caused a fierce debate over the response of riparian vegetation to the water conveyance scheme. This study focuses on the lower Tarim River, where Populus euphratica forests have undergone watering, due to the EWCP. Twelve Landsat sensor images and one IKONOS satellite imagery acquired between 1999 and 2009 were used to monitor the change in Populus euphratica forests. Bi-temporal change detection and temporal trajectory analysis were employed to represent the spatial pattern of the forest change. Field investigations were used to analyze the driving forces behind forest change from the perspectives of anthropogenic activities and natural forces. The results showed that Populus euphratica forest have been declining in area, which implies that ecological risks have been increased during the watering process. However, forests areas have increased in the regions where the water supply is abundant, and vice versa.

  6. Earthworms, arthropods and plant litter decomposition in aspen (Populus tremuloides) and lodgepole pine(Pinus contorta) forests in Colorado, USA

    Science.gov (United States)

    Grizelle Gonzalez; Timothy R. Seastedt; Zugeily Donato

    2003-01-01

    We compared the abundance and community composition of earthworms, soil macroarthropods, and litter microarthropods to test faunal effects on plant litter decomposition rates in two forests in the subalpine in Colorado, USA. Litterbags containing recently senesced litter of Populus tremuloides (aspen) and Pinus contorta (lodgepole pine) were placed in aspen and pine...

  7. Xylem anatomy correlates with gas exchange, water-use efficiency and growth performance under contrasting water regimes: evidence from Populus deltoides x Populus nigra hybrids.

    Science.gov (United States)

    Fichot, Régis; Laurans, Françoise; Monclus, Romain; Moreau, Alain; Pilate, Gilles; Brignolas, Franck

    2009-12-01

    Six Populus deltoides Bartr. ex Marsh. x P. nigra L. genotypes were selected to investigate whether stem xylem anatomy correlated with gas exchange rates, water-use efficiency (WUE) and growth performance. Clonal copies of the genotypes were grown in a two-plot common garden test under contrasting water regimes, with one plot maintained irrigated and the other one subjected to moderate summer water deficit. The six genotypes displayed a large range of xylem anatomy, mean vessel and fibre diameter varying from about 40 to 60 microm and from 7.5 to 10.5 microm, respectively. Decreased water availability resulted in a reduced cell size and an important rise in vessel density, but the extent of xylem plasticity was both genotype and trait dependent. Vessel diameter and theoretical xylem-specific hydraulic conductivity correlated positively with stomatal conductance, carbon isotope discrimination and growth performance-related traits and negatively with intrinsic WUE, especially under water deficit conditions. Vessel diameter and vessel density measured under water deficit conditions correlated with the relative losses in biomass production in response to water deprivation; this resulted from the fact that a more plastic xylem structure was generally accompanied by a larger loss in biomass production.

  8. Epiphytic vegetation of Populus balsamifera and its significance as an air pollution indicator in Sudbury, Ontario

    Energy Technology Data Exchange (ETDEWEB)

    Leblanc, F; Rao, D N; Comeau, G

    1972-01-01

    Indices of atmospheric purity (IAP) of 31 sites, selected in the SO/sub 2/-polluted as well as in the nonpolluted areas around Sudbury were determined on the basis of number, frequency-coverage, and resistance factor of the epiphytes of Populus balsamifera. Based on these indices, arranged into convenient ranges, the investigated area was delimited into five different IAP zones. These zones were then compared with SO/sub 2/ pollution zones based on the ground-level average concentration of the gas prevailing in the area. From this comparison it is clear that the biological method provides a valid, quick, and economical way for assessing and mapping the long-range effect of pollution of a given area.

  9. Climate, migration, and the local food security context: Introducing Terra Populus

    Science.gov (United States)

    Schlak, Allison M.; Kugler, Tracy A.

    2016-01-01

    Studies investigating the connection between environmental factors and migration are difficult to execute because they require the integration of microdata and spatial information. In this article, we introduce the novel, publically available data extraction system Terra Populus (TerraPop), which was designed to facilitate population-environment studies. We showcase the use of TerraPop by exploring variations in the climate-migration association in Burkina Faso and Senegal based on differences in the local food security context. Food security was approximated using anthropometric indicators of child stunting and wasting derived from Demographic and Health Surveys (DHS) and linked to the TerraPop extract of climate and migration information. We find that an increase in heat waves was associated with a decrease in international migration from Burkina Faso, while excessive precipitation increased international moves from Senegal. Significant interactions reveal that the adverse effects of heat waves and droughts are strongly amplified in highly food insecure Senegalese departments. PMID:27974863

  10. The use of the white poplar (Populus alba L.) biomass as fuel

    Institute of Scientific and Technical Information of China (English)

    Tatiana Griu; Aurel Lunguleasa

    2016-01-01

    We determined the calorific value of white poplar (Populus alba L.) woody biomass to use it as fire-wood. The value of 19.133 MJ kg-1 obtained experimen-tally shows that the white poplar can be quite successfully used as firewood. Being of a lower quality in comparison with usual beech firewood, the white poplar has similar calorific value. The white poplar has a calorific density of 30.7%lower than that of current firewood. That is why the price of this firewood from white poplar is lower accord-ingly. Also, the prognosis of calorific value on the basis of the main chemical elements, being very close to the experimental value (?2.6%), indicates an appropriate value can be achieved to be used for investigation with the chemical element analysis.

  11. Near-ambient ozone concentrations reduce the vigor of Betula and Populus species in Finland.

    Science.gov (United States)

    Oksanen, Elina; Manninen, Sirkku; Vapaavuori, Elina; Holopainen, Toini

    2009-12-01

    In this review the main growth responses of Finnish birch (Betula pendula, B. pubescens) and aspen species (Populus tremula and P. tremuloides x P. tremula) are correlated with ozone exposure, indicated as the AOT40 value. Data are derived from 23 different laboratory, open-top chamber, and free-air fumigation experiments. Our results indicate that these tree species are sensitive to increasing ozone concentrations, though high intraspecific variation exists. The roots are the most vulnerable targets in both genera. These growth reductions, determined from trees grown under optimal nutrient and water supply, were generally accompanied by increased visible foliar injuries, carbon allocation toward defensive compounds, reduced carbohydrate contents of leaves, impaired photosynthesis processes, disturbances in stomatal function, and earlier autumn senescence. Because both genera have shown complex ozone defense and response mechanisms, which are modified by variable environmental conditions, a mechanistically based approach is necessary for accurate ozone risk assessment.

  12. Significance of stigma receptivity in intergeneric cross-pollination of Salix × Populus

    Directory of Open Access Journals (Sweden)

    Elżbieta Zenkteler

    2016-09-01

    Full Text Available The pollen–stigma interaction plays an important role in reproductive process and has been continuously studied in many interspecific and intergeneric crossing experiments. The aim of this study was to investigate stigma receptivity (SR of willow in order to determine the most suitable period for its pollination with poplar pollen and improve the effectiveness of Salix × Populus crosses. Tissue samples were examined histologically using light, epifluorescent, scanning, and transmission electron microscopy. Willow SR was determined by stigma morphological traits, test of pollen germination rate, Peroxtesmo test of peroxidase and esterase activity on stigma surface as well as papilla ultrastructure at anthesis. We have ascertained that the SR duration in willow is short, lasting from 1 to 2 DA. The poplar pollen germination rate on willow stigmas on 1 DA ranged from 26.3 to 11.2%.

  13. Scale dependence of disease impacts on quaking aspen (Populus tremuloides) mortality in the southwestern United States

    Science.gov (United States)

    Bell, David M.; Bradford, John B.; Lauenroth, William K.

    2015-01-01

    Depending on how disease impacts tree exposure to risk, both the prevalence of disease and disease effects on survival may contribute to patterns of mortality risk across a species' range. Disease may accelerate tree species' declines in response to global change factors, such as drought, biotic interactions, such as competition, or functional traits, such as allometry. To assess the role of disease in mediating mortality risk in quaking aspen (Populus tremuloides), we developed hierarchical Bayesian models for both disease prevalence in live aspen stems and the resulting survival rates of healthy and diseased aspen near the species' southern range limit using 5088 individual trees on 281 United States Forest Service Forest Inventory and Analysis plots in the southwestern United States.

  14. Variation of leaf margin serration in Populus nigra of industrial dumps

    Directory of Open Access Journals (Sweden)

    Yu. A. Shtirs

    2017-07-01

    Full Text Available The variability of leaf margin serration of Populus nigra L. in conditions of industrial dumps (coal mines dumps and overburden dumps and city park is estimated. The value of this indicator is in the range from 1.25 to 1.76 and significantly increases along the gradient: coal mines dumps – overburden dumps – city park. From the number of selected gradations of P. nigra leaf blades, the gradation with values of 1.45-1.55 is most pronounced according to the analyzed index for industrial dumps, for the park – with the values of 1.55-1.65. The degree of serration of edge leaf blade is characterized by low values of variation – coefficient of variation is less than 10.0%. We registered the significant positive correlation between the average values of leaf margin serration and the length of P. nigra leaf blade.

  15. Early Events in Populus Hybrid and Fagus sylvatica Leaves Exposed to Ozone

    Directory of Open Access Journals (Sweden)

    R. Desotgiu

    2010-01-01

    Full Text Available This paper aims to investigate early responses to ozone in leaves of Fagus sylvatica (beech and Populus maximowiczii x Populus berolinensis (poplar. The experimental setup consisted of four open-air (OA plots, four charcoal-filtered (CF open-top chambers (OTCs, and four nonfiltered (NF OTCs. Qualitative and quantitative analyses were carried out on nonsymptomatic (CF and symptomatic (NF and OA leaves of both species. Qualitative analyses were performed applying microscopic techniques: Evans blue staining for detection of cell viability, CeCl3 staining of transmission electron microscope (TEM samples to detect the accumulation of H2O2, and multispectral fluorescence microimaging and microspectrofluorometry to investigate the accumulation of fluorescent phenolic compounds in the walls of the damaged cells. Quantitative analyses consisted of the analysis of the chlorophyll a fluorescence transients (fast kinetics. The early responses to ozone were demonstrated by the Evans blue and CeCl3 staining techniques that provided evidence of plant responses in both species 1 month before foliar symptoms became visible. The fluorescence transients analysis, too, demonstrated the breakdown of the oxygen evolving system and the inactivation of the end receptors of electrons at a very early stage, both in poplar and in beech. The accumulation of phenolic compounds in the cell walls, on the other hand, was a species-specific response detected in poplar, but not in beech. Evans blue and CeCl3 staining, as well as the multispectral fluorescence microimaging and microspectrofluorometry, can be used to support the field diagnosis of ozone injury, whereas the fast kinetics of chlorophyll fluorescence provides evidence of early physiological responses.

  16. Identification and allelic dissection uncover roles of lncRNAs in secondary growth of Populus tomentosa.

    Science.gov (United States)

    Zhou, Daling; Du, Qingzhang; Chen, Jinhui; Wang, Qingshi; Zhang, Deqiang

    2017-10-01

    Long non-coding RNAs (lncRNAs) function in various biological processes. However, their roles in secondary growth of plants remain poorly understood. Here, 15,691 lncRNAs were identified from vascular cambium, developing xylem, and mature xylem of Populus tomentosa with high and low biomass using RNA-seq, including 1,994 lncRNAs that were differentially expressed (DE) among the six libraries. 3,569 cis-regulated and 3,297 trans-regulated protein-coding genes were predicted as potential target genes (PTGs) of the DE lncRNAs to participate in biological regulation. Then, 476 and 28 lncRNAs were identified as putative targets and endogenous target mimics (eTMs) of Populus known microRNAs (miRNAs), respectively. Genome re-sequencing of 435 individuals from a natural population of P. tomentosa found 34,015 single nucleotide polymorphisms (SNPs) within 178 lncRNA loci and 522 PTGs. Single-SNP associations analysis detected 2,993 associations with 10 growth and wood-property traits under additive and dominance model. Epistasis analysis identified 17,656 epistatic SNP pairs, providing evidence for potential regulatory interactions between lncRNAs and their PTGs. Furthermore, a reconstructed epistatic network, representing interactions of 8 lncRNAs and 15 PTGs, might enrich regulation roles of genes in the phenylpropanoid pathway. These findings may enhance our understanding of non-coding genes in plants. © The Author 2017. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  17. Influence of irrigation and fertilization on transpiration and hydraulic properties of Populus deltoides.

    Energy Technology Data Exchange (ETDEWEB)

    Samuelson, Lisa, J.; Stokes, Thomas, A.; Coleman, Mark, D.

    2007-02-01

    Summary Long-term hydraulic acclimation to resource availability was explored in 3-year-bld Populus deltoides Bartr. ex Marsh. clones by examining transpiration. leaf-specific hydraulic conductance (GL), canopy stomatal conductance (Gs) and leaf to sapwood area ratio (AL:Asi)n response to imgation (13 and 551 mm year in addition to ambient precipitation) and fertilization (0 and 120 kg N ha-' year-'). Sap flow was measured continuously over one growing season with thermal dissipation probes. Fertilization had a greater effect on growth and hydraulic properties than imgation, and fertilization effects were independent of irrigation treatment. Transpiration on a ground area basis (E) ranged between 0.3 and 1.8 mm day-', and increased 66% and 90% in response to imgation and fertilization, respectively. Increases in GL, Gs at a reference vapor pressure deficit of 1 kPa, and transpiration per unit leaf areain response to increases in resource availability were associated with reductions in AL:As and consequently a minimal change in the water potential gradient from soil to leaf. Imgation and fertilization increased leaf area index similarly, from an average 1.16 in control stands to 1.45, but sapwood area was increased from 4.0 to 6.3 m ha-' by irrigation and from 3.7 to 6.7 m2 ha-' by fertilization. The balance between leaf area and sapwood area was important in understanding long-term hydraulic acclimation to resource availability and mechanisms controlling maximum productivity in Populus deltoides.

  18. Trade-offs between xylem hydraulic properties, wood anatomy and yield in Populus.

    Science.gov (United States)

    Hajek, Peter; Leuschner, Christoph; Hertel, Dietrich; Delzon, Sylvain; Schuldt, Bernhard

    2014-07-01

    Trees face the dilemma that achieving high plant productivity is accompanied by a risk of drought-induced hydraulic failure due to a trade-off in the trees' vascular system between hydraulic efficiency and safety. By investigating the xylem anatomy of branches and coarse roots, and measuring branch axial hydraulic conductivity and vulnerability to cavitation in 4-year-old field-grown aspen plants of five demes (Populus tremula L. and Populus tremuloides Michx.) differing in growth rate, we tested the hypotheses that (i) demes differ in wood anatomical and hydraulic properties, (ii) hydraulic efficiency and safety are related to xylem anatomical traits, and (iii) aboveground productivity and hydraulic efficiency are negatively correlated to cavitation resistance. Significant deme differences existed in seven of the nine investigated branch-related anatomical and hydraulic traits but only in one of the four coarse-root-related anatomical traits; this likely is a consequence of high intra-plant variation in root morphology and the occurrence of a few 'high-conductivity roots'. Growth rate was positively related to branch hydraulic efficiency (xylem-specific conductivity) but not to cavitation resistance; this indicates that no marked trade-off exists between cavitation resistance and growth. Both branch hydraulic safety and hydraulic efficiency significantly depended on vessel size and were related to the genetic distance between the demes, while the xylem pressure causing 88% loss of hydraulic conductivity (P88 value) was more closely related to hydraulic efficiency than the commonly used P50 value. Deme-specific variation in the pit membrane structure may explain why vessel size was not directly linked to growth rate. We conclude that branch hydraulic efficiency is an important growth-influencing trait in aspen, while the assumed trade-off between productivity and hydraulic safety is weak. © The Author 2014. Published by Oxford University Press. All rights reserved

  19. November 06, 2016 Prof. Appa Rao Podile FASc, FNASc, FNAAS ...

    Indian Academy of Sciences (India)

    User

    2016-11-06

    Nov 6, 2016 ... Isolated as a root endophyte from Populus trichocarpa. Promotes ... Domain architecture. Chitin. Hydrolysis. TG Chitobiase Chitosan hydrolysis ... Only increased hydrolysis. Group II. Catalytic groove. Phe - 64. Trp. More TG ...

  20. Development of a channel classification to evaluate potential for cottonwood restoration, lower segments of the Middle Missouri River, South Dakota and Nebraska

    Science.gov (United States)

    Jacobson, Robert B.; Elliott, Caroline M.; Huhmann, Brittany L.

    2010-01-01

    This report documents development of a spatially explicit river and flood-plain classification to evaluate potential for cottonwood restoration along the Sharpe and Fort Randall segments of the Middle Missouri River. This project involved evaluating existing topographic, water-surface elevation, and soils data to determine if they were sufficient to create a classification similar to the Land Capability Potential Index (LCPI) developed by Jacobson and others (U.S. Geological Survey Scientific Investigations Report 2007–5256) and developing a geomorphically based classification to apply to evaluating restoration potential.Existing topographic, water-surface elevation, and soils data for the Middle Missouri River were not sufficient to replicate the LCPI. The 1/3-arc-second National Elevation Dataset delineated most of the topographic complexity and produced cumulative frequency distributions similar to a high-resolution 5-meter topographic dataset developed for the Lower Missouri River. However, lack of bathymetry in the National Elevation Dataset produces a potentially critical bias in evaluation of frequently flooded surfaces close to the river. High-resolution soils data alone were insufficient to replace the information content of the LCPI. In test reaches in the Lower Missouri River, soil drainage classes from the Soil Survey Geographic Database database correctly classified 0.8–98.9 percent of the flood-plain area at or below the 5-year return interval flood stage depending on state of channel incision; on average for river miles 423–811, soil drainage class correctly classified only 30.2 percent of the flood-plain area at or below the 5-year return interval flood stage. Lack of congruence between soil characteristics and present-day hydrology results from relatively rapid incision and aggradation of segments of the Missouri River resulting from impoundments and engineering. The most sparsely available data in the Middle Missouri River were water

  1. Sex-specific responses to winter flooding, spring waterlogging and post-flooding recovery in Populus deltoides

    OpenAIRE

    Ling-Feng Miao; Fan Yang; Chun-Yu Han; Yu-Jin Pu; Yang Ding; Li-Jia Zhang

    2017-01-01

    Winter flooding events are common in some rivers and streams due to dam constructions, and flooding and waterlogging inhibit the growth of trees in riparian zones. This study investigated sex-specific morphological, physiological and ultrastructural responses to various durations of winter flooding and spring waterlogging stresses, and post-flooding recovery characteristics in Populus deltoides. There were no significant differences in the morphological, ultrastructural and the majority of ph...

  2. Eighteen microsatellite loci in Salix arbutifolia (Salicaceae) and cross-species amplification in Salix and Populus species.

    Science.gov (United States)

    Hoshikawa, Takeshi; Kikuchi, Satoshi; Nagamitsu, Teruyoshi; Tomaru, Nobuhiro

    2009-07-01

    Salix arbutifolia is a riparian dioecious tree species that is of conservation concern in Japan because of its highly restricted distribution. Eighteen polymorphic loci of dinucleotide microsatellites were isolated and characterized. Among these, estimates of the expected heterozygosity ranged from 0.350 to 0.879. Cross-species amplification was successful at 9-13 loci among six Salix species and at three loci in one Populus species. © 2009 Blackwell Publishing Ltd.

  3. Genetic origin and composition of a natural hybrid poplar Populus???jrtyschensis from two distantly related species

    OpenAIRE

    Jiang, Dechun; Feng, Jianju; Dong, Miao; Wu, Guili; Mao, Kangshan; Liu, Jianquan

    2016-01-01

    Background The factors that contribute to and maintain hybrid zones between distinct species are highly variable, depending on hybrid origins, frequencies and fitness. In this study, we aimed to examine genetic origins, compositions and possible maintenance of Populus???jrtyschensis, an assumed natural hybrid between two distantly related species. This hybrid poplar occurs mainly on the floodplains along the river valleys between the overlapping distributions of the two putative parents. Resu...

  4. RNA sequencing of Populus x canadensis roots identifies key molecular mechanisms underlying physiological adaption to excess zinc.

    Directory of Open Access Journals (Sweden)

    Andrea Ariani

    Full Text Available Populus x canadensis clone I-214 exhibits a general indicator phenotype in response to excess Zn, and a higher metal uptake in roots than in shoots with a reduced translocation to aerial parts under hydroponic conditions. This physiological adaptation seems mainly regulated by roots, although the molecular mechanisms that underlie these processes are still poorly understood. Here, differential expression analysis using RNA-sequencing technology was used to identify the molecular mechanisms involved in the response to excess Zn in root. In order to maximize specificity of detection of differentially expressed (DE genes, we consider the intersection of genes identified by three distinct statistical approaches (61 up- and 19 down-regulated and validate them by RT-qPCR, yielding an agreement of 93% between the two experimental techniques. Gene Ontology (GO terms related to oxidation-reduction processes, transport and cellular iron ion homeostasis were enriched among DE genes, highlighting the importance of metal homeostasis in adaptation to excess Zn by P. x canadensis clone I-214. We identified the up-regulation of two Populus metal transporters (ZIP2 and NRAMP1 probably involved in metal uptake, and the down-regulation of a NAS4 gene involved in metal translocation. We identified also four Fe-homeostasis transcription factors (two bHLH38 genes, FIT and BTS that were differentially expressed, probably for reducing Zn-induced Fe-deficiency. In particular, we suggest that the down-regulation of FIT transcription factor could be a mechanism to cope with Zn-induced Fe-deficiency in Populus. These results provide insight into the molecular mechanisms involved in adaption to excess Zn in Populus spp., but could also constitute a starting point for the identification and characterization of molecular markers or biotechnological targets for possible improvement of phytoremediation performances of poplar trees.

  5. Sodium and chloride accumulation in leaf, woody, and root tissue of Populus after irrigation with landfill leachate

    International Nuclear Information System (INIS)

    Zalesny, Jill A.; Zalesny, Ronald S.; Wiese, Adam H.; Sexton, Bart; Hall, Richard B.

    2008-01-01

    The response of Populus to irrigation sources containing elevated levels of sodium (Na + ) and chloride (Cl - ) is poorly understood. We irrigated eight Populus clones with fertilized well water (control) (N, P, K) or municipal solid waste landfill leachate weekly during 2005 and 2006 in Rhinelander, Wisconsin, USA (45.6 deg. N, 89.4 deg. W). During August 2006, we tested for differences in total Na + and Cl - concentration in preplanting and harvest soils, and in leaf, woody (stems + branches), and root tissue. The leachate-irrigated soils at harvest had the greatest Na + and Cl - levels. Genotypes exhibited elevated total tree Cl - concentration and increased biomass (clones NC14104, NM2, NM6), elevated Cl - and decreased biomass (NC14018, NC14106, DM115), or mid levels of Cl - and biomass (NC13460, DN5). Leachate tissue concentrations were 17 (Na + ) and four (Cl - ) times greater than water. Sodium and Cl - levels were greatest in roots and leaves, respectively. - Sodium and chloride supplied via landfill leachate irrigation is accumulated at high concentrations in tissues of Populus

  6. Thidiazuron: A potent cytokinin for efficient plant regeneration in Himalayan poplar (Populus ciliata Wall. using leaf explants

    Directory of Open Access Journals (Sweden)

    Gaurav Aggarwal

    2012-11-01

    Full Text Available Populus species are important resource for certain branches of industry and have special roles for scientific study on biological and agricultural systems. The present investigation was undertaken with an objective of enhancing the frequency of plant regeneration in Himalayan poplar (Populus ciliata Wall.. The effect of Thiadizuron (TDZ alone and in combination with adenine and α-Naphthalene acetic acid (NAA were studied on the regeneration potential of leaf explants. A high efficiency of shoot regeneration was observed in leaf (80.00% explants on MS basal medium supplemented with 0.024 mg/l TDZ and 79.7 mg/l adenine. Elongation and multiplication of shoots were obtained on Murashige and Skoog (MS basal medium, containing 0.5 mg/l 6. Benzyl aminopurine (BAP + 0.2mg/l Indole 3-acetic acid (IAA + 0.3 mg/l Gibberellic acid (GA3. High frequency root regeneration from in vitro developed shoots was observed on MS basal medium supplemented with 0.10 mg/l Indole 3-butyric acid(IBA. Maximum of the in vitro rooted plantlets were well accomplished to the mixture of sand: soil (1:1 and exhibited similar morphology with the field plants. A high efficiency plant regeneration protocol has been developedfrom leaf explants in Himalayan poplar (Populus ciliata Wall..

  7. Effects of summer and winter harvesting on element phytoextraction efficiency of Salix and Populus clones planted on contaminated soil.

    Science.gov (United States)

    Kubátová, Pavla; Száková, Jiřina; Břendová, Kateřina; Kroulíková-Vondráčková, Stanislava; Mercl, Filip; Tlustoš, Pavel

    2018-04-16

    The clones of fast-growing trees (FGTs) were investigated for phytoextraction of soil contaminated with risk elements (REs), especially Cd, Pb, and Zn. As a main experimental factor, the potential effect of biomass harvesting time was assessed. The field experiment with two Salix clones (S1 - (Salix schwerinii × Salix viminalis) × S. viminalis, S2 - S. × smithiana) and two Populus clones (P1 - Populus maximowiczii × Populus nigra, P2 - P. nigra) was established in April 2009. Shoots of all clones were first harvested in February 2012. After two further growing seasons, the first half of the trees was harvested in September 2013 before leaf fall (summer harvest) and the second half in February 2014 (winter harvest). Remediation factors (RFs) for all clones and all REs (except Pb for clone S1) were higher in the summer harvest. The highest annual RFs for Cd and for Zn (1.34 and 0.67%, respectively) were found for clone S2 and were significantly higher than other clones. Although no increased mortality of trees harvested in the summer was detected in the following season, the effect of summer harvesting on the phytoextraction potential of FGTs clones should be investigated in long-term studies.

  8. Comparative physiology of allopatric Populus species: Geographic clines in photosynthesis, height growth and carbon isotope discrimination in common gardens

    Directory of Open Access Journals (Sweden)

    Raju Yaranna Soolanayakanahally

    2015-07-01

    Full Text Available Populus species with wide geographic ranges display strong adaptation to local environments. We studied the clinal patterns in phenology and ecophysiology in allopatric Populus species adapted to similar environments on different continents under common garden settings. As a result of climatic adaptation, both P. tremula L. and Populus balsamifera L. display latitudinal clines in photosynthetic rates (A, whereby high-latitude trees of P. tremula had higher A compared to low-latitude trees and nearly so in P. balsamifera (p = 0.06. Stomatal conductance (gs and chlorophyll content index (CCI follow similar latitudinal trends. However, foliar nitrogen was positively correlated with latitude in P. balsamifera and negatively correlated in P. tremula. No significant trends in carbon isotope composition of the leaf tissue (δ13C were observed for both species; but, intrinsic water-use efficiency (WUEi was negatively correlated with the latitude of origin in P. balsamifera. In spite of intrinsically higher A, high-latitude trees in both common gardens accomplished less height gain as a result of early bud set. Thus, shoot biomass was determined by height elongation duration (HED, which was well approximated by the number of days available for free growth between bud flush and bud set. In doing so, we highlight the shortcoming of unreplicated outdoor common gardens for tree improvement and the crucial role of photoperiod in limiting height growth, further complicating interpretation of other secondary effects.

  9. Incremento volumétrico de un ensayo con híbridos de Populus spp.

    Directory of Open Access Journals (Sweden)

    Oscar Vallejos-Barra

    2015-09-01

    Full Text Available El aumento de los requerimientos energéticos demandados por la sociedad ha impulsado el interés por establecer ensayos para seleccionar especies o híbridos que en el menor tiempo posible generen la mayor cantidad de volumen o biomasa. En esta investigación, se determinó el incremento medio anual del volumen de un ensayo con híbridos de Populus con la finalidad de dar a conocer la potencialidad de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca. De este catálogo se escogieron los seis híbridos más promisorios y se compararon con seis híbridos comerciales. El ensayo se estableció a 10 km al norte de la ciudad de Talca, en la estación experimental Panguilemo de la Universidad de Talca. En terreno se midió el diámetro basal y la altura por tres años a las seis plantas centrales de cada parcela, con cuatro repeticiones por híbrido para ambas densidades de plantación (5.000 y 10.000 plantas por hectárea. El volumen se calculó utilizando el exponente mórfico de un Paracono. El incremento volumétrico varió entre 5,306 y 15,828 m3 ha-1 año-1, detectando diferencias significativas entre los híbridos. El grupo de mayor productividad estuvo compuesto por cinco híbridos todos del catálogo del CTA. Este resultado demuestra que si se desea una mayor productividad en plantaciones dendroenergéticas que utilicen híbridos de Populus se deberían considerar algunos de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca.

  10. Extensive transcriptome changes during natural onset and release of vegetative bud dormancy in Populus

    Directory of Open Access Journals (Sweden)

    Glenn Thomas Howe

    2015-12-01

    Full Text Available To survive winter, many perennial plants become endodormant, a state of suspended growth maintained even in favorable growing environments. To understand vegetative bud endodormancy, we collected paradormant, endodormant, and ecodormant axillary buds from Populus trees growing under natural conditions. Of 44,441 Populus gene models analyzed using NimbleGen microarrays, we found that 1,362 (3.1% were differentially expressed among the three dormancy states, and another 429 (1.0% were differentially expressed during only one of the two dormancy transitions (false discovery rate p-value < 0.05. Of all differentially expressed genes, 69% were down-regulated from paradormancy to endodormancy, which was expected given the lower metabolic activity associated with endodormancy. Dormancy transitions were accompanied by changes in multiple genes associated with DNA methylation (via RNA-directed DNA methylation and histone modifications (via Polycomb Repressive Complex 2, confirming and extending knowledge of chromatin modification as major features of dormancy transitions. Among the chromatin-associated genes, we found two genes similar to SPT (SUPPRESSOR OF TY that were strongly up-regulated during endodormancy. Transcription factor genes and gene sets that were atypically up-regulated during endodormancy include a gene that seems to encode a trihelix transcription factor and genes associated with proteins involved in responses to ethylene, cold, and other abiotic stresses. These latter transcription factors include ETHYLENE INSENSITIVE 3 (EIN3, ETHYLENE-RESPONSIVE ELEMENT BINDING PROTEIN (EBP, ETHYLENE RESPONSE FACTOR (ERF, ZINC FINGER PROTEIN 10 (ZAT10, ZAT12, and WRKY DNA-binding domain proteins. Analyses of phytohormone-associated genes suggest important changes in responses to ethylene, auxin, and brassinosteroids occur during endodormancy. We found weaker evidence for changes in genes associated with salicylic acid and jasmonic acid, and little

  11. The applications of populus fiber in removal of Cr{sup (VI)} from aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Lyu, Aichao; Liu, Yuanfa, E-mail: morning309@126.com; Zhang, Hong, E-mail: zhang_hong1234@sina.com

    2016-10-15

    Highlights: • A sorbent for heavy metal ions based on populus fibers is prepared by a green way. • The chromium adsorption on the sorbent accords with the pseudo-second-order kinetics. • The proposed adsorption involves static attraction and chelation by the sorbent on chromium. • The sorbent is expected to be applied in universal conditions. - Abstract: The surface modification of natural materials to be applied in removal of Cr{sup (VI)} from aqueous solutions has attracted much attention. A natural sorbent for Cr{sup (VI)} based on natural populus fibers (PF) is prepared by transforming the cyano groups (AN) in polyacrylonitriles (PAN) grafted from PF into amidoxime groups (AO), which has strong ability to attract and chelate heavy metal ions. The prepared sorbent is characterized by Fourier Transform Infrared Spectra (FT-IR), thermogravimetric analysis (TGA), solid-state nuclear magnetic resonance ({sup 13}C NMR) and scanning electron microscope (SEM). As potassium dichromate solution (K{sub 2}Cr{sub 2}O{sub 7}) is used as a target solution for detecting adsorption capacity of the sorbent, the adsorption kinetics of the sorbent for chromiun is consistent with the pseudo-second-order kinetic model by analyzing the adsorption amount as a function of the sorbent dispersed duration in solution at pH = 2. The expected adsorption mechanism is that the Cr{sup (VI)} in anionic ions Cr{sub 2}O{sub 7}{sup 2−} and HCrO{sub 4}{sup −} are adsorbed through electrostatic attraction but when Cr{sup (VI)} is reduced to Cr{sup (III)} by AO, the electronegative nitrogen and oxygen in AO chelate it through coordination bond. The as-prepared PF derivant with high adsorption efficiency of chromium 180.5 mg/g (3.47 mmol/g), low cost, reusability and greenly preparation process suggests that the development of natural PF as a sorbent in removal of Cr{sup (VI)} from aqueous solutions is a destined significant approach.

  12. Shifting dominance of riparian Populus and Tamarix along gradients of flow alteration in western North American rivers.

    Science.gov (United States)

    Merritt, David M; Poff, N LeRoy

    2010-01-01

    Tamarix ramosissima is a naturalized, nonnative plant species which has become widespread along riparian corridors throughout the western United States. We test the hypothesis that the distribution and success of Tamarix result from human modification of river-flow regimes. We conducted a natural experiment in eight ecoregions in arid and semiarid portions of the western United States, measuring Tamarix and native Populus recruitment and abundance at 64 sites along 13 perennial rivers spanning a range of altered flow regimes. We quantified biologically relevant attributes of flow alteration as an integrated measure (the index of flow modification, IFM), which was then used to explain between-site variation in abundance and recruitment of native and nonnative riparian plant species. We found the likelihood of successful recruitment of Tamarix to be highest along unregulated river reaches and to remain high across a gradient of regulated flows. Recruitment probability for Populus, in contrast, was highest under free-flowing conditions and declined abruptly under even slight flow modification (IFM > 0.1). Adult Tamarix was most abundant at intermediate levels of IFM. Populus abundance declined sharply with modest flow regulation (IFM > 0.2) and was not present at the most flow-regulated sites. Dominance of Tamarix was highest along rivers with the most altered flow regimes. At the 16 least regulated sites, Tamarix and Populus were equally abundant. Given observed patterns of Tamarix recruitment and abundance, we infer that Tamarix would likely have naturalized, spread, and established widely in riparian communities in the absence of dam construction, diversions, and flow regulation in western North America. However, Tamarix dominance over native species would likely be less extensive in the absence of human alteration of river-flow regimes. Restoration that combines active mechanical removal of established stands of Tamarix with a program of flow releases conducive to

  13. Proteome analysis reveals an energy-dependent central process for Populus×canadensis seed germination.

    Science.gov (United States)

    Zhang, Hong; Zhou, Ke-Xin; Wang, Wei-Qing; Liu, Shu-Jun; Song, Song-Quan

    2017-06-01

    Poplar (Populus×canadensis) seeds rapidly germinated in darkness at 10, 15, and 20°C and reached 50% seed germination after about 22, 4.5, and 3.5h, respectively. Germination of poplar seeds was markedly inhibited by abscisic acid (ABA) at 50μM and cycloheximide (CHX) at 100μM, and these inhibitive roles were temperature-dependent. In the present study, mature poplar seeds were used to investigate the differentially changed proteome of seeds germinating in water, ABA, and CHX. A total of 130 protein spots showed a significant change (1.5-fold increase/decrease, Pgermination of poplar seeds is closely related with the increase in those proteins involved in amino acid and lipid metabolism, the tricarboxylic acid cycle and pentose phosphate pathway, protein synthesis and destination, cell defense and rescue, and degradation of storage proteins. ABA and CHX inhibit the germination of poplar seeds by decreasing the protein abundance associated with protein proteolysis, protein folding, and storage proteins. We conclude that poplar seed germination is an energy-dependent active process, and is accompanied by increasing amino acid activation, protein synthesis and destination, as well as cell defense and rescue, and degradation of storage proteins. Copyright © 2017 Elsevier GmbH. All rights reserved.

  14. Microstructural and Topochemical Characterization of Thermally Modified Poplar (Populus cathayaha Cell Wall

    Directory of Open Access Journals (Sweden)

    Zhe Ling

    2015-11-01

    Full Text Available Although many studies have been conducted on the wood property and chemical changes caused by thermal modification, little has been reported on the microstructural and topochemical changes occurring in the cell wall during heat treatment. In this study, poplar (Populus cathayaha was treated within a temperature range from 180 to 220 °C for 4 h. Chemical analyses by Fourier transform infrared spectroscopy (FTIR and nuclear magnetic resonance (NMR indicated that heat treatment resulted in deacetylation of hemicelluloses and cleavage of lignin chains, thus generating new carbonyl and phenolic linkages. Transformation of matrix substances contributed to microstructural changes that appeared in clearly distorted and collapsed fiber and vessel walls along with the delamination of compound middle lamella (CML and secondary walls (S, which showed a reduced capability to resist deformation. It was also observed by fluorescence microscopy (FM and scanning electron microscope coupled with energy dispersive X-ray analysis (SEM-EDXA that the concentration of lignin increased, probably because of the degradation of hemicelluloses and the generation of new carbonyl groups. These results on cell wall microstructure and topochemistry can help explain the altered wood properties revealed by dynamic mechanical analysis (DMA and equilibrium moisture content (EMC testing after heat treatment.

  15. In-situ reduced silver nanoparticles on populus fiber and the catalytic application

    Energy Technology Data Exchange (ETDEWEB)

    Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Wang, Wenheng; Xu, Guangpeng; Liu, Yuanfa; Guo, Jing, E-mail: guojing8161@163.com

    2017-02-01

    Highlights: • A composite involved in in-situ chelating AgNPs on natural cellulose was prepared. • Polyamidoxime grafted from the cellulose adsorbed Ag+ which was reduced to AgNPs. • The composite exhibits excellent catalytic activity in reducing 4-nitrophenol. - Abstract: One kind of composites involved in silver nanoparticles (AgNPs) loading in-situ on natural populus fiber (PF) matrix was prepared by polyamidoxime (PAO) functionalized the cellulose fiber. In which PAO worked as trapping and stabilizing agents chelating silver ions and made it reduced in-situ to obtain AgNPs by borohydride at room temperature. The synthesized composites were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), thermogravimetric analysis (TGA) and scanning electron microscopy (SEM). Moreover, the composites showed significant catalytic activity 1.87 s{sup −1} g{sup −1} and repeated usability more than 7 cycles in reducing 4-nitrophenol (4-NP) into 4-aminophenol (4-AP) detected by UV–vis spectrophotometer in aqueous solution due to the surface-enhanced immobility and large amount of AgNPs. The natural cellulose fiber provides a green platform to react and support other noble metals for wide catalytic reactions.

  16. Comparative physiological and proteomic analyses of poplar (Populus yunnanensis plantlets exposed to high temperature and drought.

    Directory of Open Access Journals (Sweden)

    Xiong Li

    Full Text Available Plantlets of Populus yunnanensis Dode were examined in a greenhouse for 48 h to analyze their physiological and proteomic responses to sustained heat, drought, and combined heat and drought. Compared with the application of a single stress, simultaneous treatment with both stresses damaged the plantlets more heavily. The plantlets experienced two apparent response stages under sustained heat and drought. During the first stage, malondialdehyde and reactive oxygen species (ROS contents were induced by heat, but many protective substances, including antioxidant enzymes, proline, abscisic acid (ABA, dehydrin, and small heat shock proteins (sHSPs, were also stimulated. The plants thus actively defended themselves against stress and exhibited few pathological morphological features, most likely because a new cellular homeostasis was established through the collaborative operation of physiological and proteomic responses. During the second stage, ROS homeostasis was overwhelmed by substantial ROS production and a sharp decline in antioxidant enzyme activities, while the synthesis of some protective elements, such as proline and ABA, was suppressed. As a result, photosynthetic levels in P. yunnanensis decreased sharply and buds began to die, despite continued accumulation of sHSPs and dehydrin. This study supplies important information about the effects of extreme abiotic environments on woody plants.

  17. Pectin methyl esterase inhibits intrusive and symplastic cell growth in developing wood cells of Populus.

    Science.gov (United States)

    Siedlecka, Anna; Wiklund, Susanne; Péronne, Marie-Amélie; Micheli, Fabienne; Lesniewska, Joanna; Sethson, Ingmar; Edlund, Ulf; Richard, Luc; Sundberg, Björn; Mellerowicz, Ewa J

    2008-02-01

    Wood cells, unlike most other cells in plants, grow by a unique combination of intrusive and symplastic growth. Fibers grow in diameter by diffuse symplastic growth, but they elongate solely by intrusive apical growth penetrating the pectin-rich middle lamella that cements neighboring cells together. In contrast, vessel elements grow in diameter by a combination of intrusive and symplastic growth. We demonstrate that an abundant pectin methyl esterase (PME; EC 3.1.1.11) from wood-forming tissues of hybrid aspen (Populus tremula x tremuloides) acts as a negative regulator of both symplastic and intrusive growth of developing wood cells. When PttPME1 expression was up- and down-regulated in transgenic aspen trees, the PME activity in wood-forming tissues was correspondingly altered. PME removes methyl ester groups from homogalacturonan (HG) and transgenic trees had modified HG methylesterification patterns, as demonstrated by two-dimensional nuclear magnetic resonance and immunostaining using PAM1 and LM7 antibodies. In situ distributions of PAM1 and LM7 epitopes revealed changes in pectin methylesterification in transgenic trees that were specifically localized in expanding wood cells. The results show that en block deesterification of HG by PttPME1 inhibits both symplastic growth and intrusive growth. PttPME1 is therefore involved in mechanisms determining fiber width and length in the wood of aspen trees.

  18. Evaluation of Populus and Salix continuously irrigated with landfill leachate II. soils and early tree development.

    Science.gov (United States)

    Zalesny, Ronald S; Bauer, Edmund O

    2007-01-01

    Soil contaminant levels and early tree growth data are helpful for assessing phytoremediation systems. Populus (DN17, DN182, DN34, NM2, and NM6) and Salix (94003, 94012, S287, S566, and SX61) genotypes were irrigated with landfill leachate or municipal water and tested for differences in (1) element concentrations (P, K, Ca, Mg, S, Zn, B, Mn, Fe, Cu, Al, and Na) of a topsoil layer and a layer of sand in tanks with a cover crop of trees or no trees and (2) height, diameter, volume, and dry mass of leaves, stems, and roots. Trees were irrigated with leachate or water during the final 12 wk of the 18-wk study. Differences in most soil element concentrations were negligible (P > 0.05) for irrigation treatments and cover main effects. Phosphorous, K, Mg, S, Zn, Mn, Fe, and Al concentrations were greater in topsoil than sand (P = 0.0011 for Mg; P tree yield. From a practical standpoint, these results may be used as a baseline for the development of future remediation systems.

  19. Identification and characterization of nuclear genes involved in photosynthesis in Populus

    Science.gov (United States)

    2014-01-01

    Background The gap between the real and potential photosynthetic rate under field conditions suggests that photosynthesis could potentially be improved. Nuclear genes provide possible targets for improving photosynthetic efficiency. Hence, genome-wide identification and characterization of the nuclear genes affecting photosynthetic traits in woody plants would provide key insights on genetic regulation of photosynthesis and identify candidate processes for improvement of photosynthesis. Results Using microarray and bulked segregant analysis strategies, we identified differentially expressed nuclear genes for photosynthesis traits in a segregating population of poplar. We identified 515 differentially expressed genes in this population (FC ≥ 2 or FC ≤ 0.5, P photosynthesis by the nuclear genome mainly involves transport, metabolism and response to stimulus functions. Conclusions This study provides new genome-scale strategies for the discovery of potential candidate genes affecting photosynthesis in Populus, and for identification of the functions of genes involved in regulation of photosynthesis. This work also suggests that improving photosynthetic efficiency under field conditions will require the consideration of multiple factors, such as stress responses. PMID:24673936

  20. Dying piece by piece: carbohydrate dynamics in aspen (Populus tremuloides) seedlings under severe carbon stress.

    Science.gov (United States)

    Wiley, Erin; Hoch, Günter; Landhäusser, Simon M

    2017-11-02

    Carbon starvation as a mechanism of tree mortality is poorly understood. We exposed seedlings of aspen (Populus tremuloides) to complete darkness at 20 or 28 °C to identify minimum non-structural carbohydrate (NSC) concentrations at which trees die and to see if these levels vary between organs or with environmental conditions. We also first grew seedlings under different shade levels to determine if size affects survival time under darkness due to changes in initial NSC concentration and pool size and/or respiration rates. Darkness treatments caused a gradual dieback of tissues. Even after half the stem had died, substantial starch reserves were still present in the roots (1.3-3% dry weight), indicating limitations to carbohydrate remobilization and/or transport during starvation in the absence of water stress. Survival time decreased with increased temperature and with increasing initial shade level, which was associated with smaller biomass, higher respiration rates, and initially smaller NSC pool size. Dead tissues generally contained no starch, but sugar concentrations were substantially above zero and differed between organs (~2% in stems up to ~7.5% in leaves) and, at times, between temperature treatments and initial, pre-darkness shade treatments. Minimum root NSC concentrations were difficult to determine because dead roots quickly began to decompose, but we identify 5-6% sugar as a potential threshold for living roots. This variability may complicate efforts to identify critical NSC thresholds below which trees starve. © Society for Experimental Biology 2017.

  1. Metabolic functions of Pseudomonas fluorescens strains from Populus deltoides depend on rhizosphere or endosphere isolation compartment

    Directory of Open Access Journals (Sweden)

    Collin M Timm

    2015-10-01

    Full Text Available The bacterial microbiota of plants is diverse, with 1,000s of operational taxonomic units (OTUs associated with any individual plant. In this work we investigate the differences between 19 sequenced Pseudomonas fluorescens strains, isolated from Populus deltoides rhizosphere and endosphere and which represent a single OTU, using phenotypic analysis, comparative genomics, and metabolic models. While no traits were exclusive to either endosphere or rhizosphere P. fluorescens isolates, multiple pathways relevant for plant-bacterial interactions are enriched in endosphere isolate genomes. Further, growth phenotypes such as phosphate solubilization, protease activity, denitrification and root growth promotion are biased towards endosphere isolates. Endosphere isolates have significantly more metabolic pathways for plant signaling compounds and an increased metabolic range that includes utilization of energy rich nucleotides and sugars, consistent with endosphere colonization. Rhizosphere P. fluorescens have fewer pathways representative of plant-bacterial interactions but show metabolic bias towards chemical substrates often found in root exudates. This work reveals the diverse functions that may contribute to colonization of the endosphere by bacteria and are enriched among closely related isolates.

  2. Boron accumulation and toxicity in hybrid poplar (Populus nigra × euramericana).

    Science.gov (United States)

    Rees, Rainer; Robinson, Brett H; Menon, Manoj; Lehmann, Eberhard; Günthardt-Goerg, Madeleine S; Schulin, Rainer

    2011-12-15

    Poplars accumulate high B concentrations and are thus used for the phytomanagement of B contaminated soils. Here, we performed pot experiments in which Populus nigra × euramericana were grown on a substrate with B concentrations ranging from 13 to 280 mg kg(-1) as H(3)BO(3). Salix viminalis, Brassica juncea, and Lupinus albus were grown under some growing conditions for comparison. Poplar growth was unaffected at soil B treatment levels up to 93 mg kg(-1). Growth was progressively reduced at levels of 168 and 280 mg kg(-1). None of the other species survived at these substrate B levels. At leaf B concentrations toxicity. Neutron radiography revealed that chlorotic leaf tissues had B concentrations of 1000-2000 mg kg(-1), while necrotic tissues had >2000 mg kg(-1). Average B concentrations of up to 3500 mg kg(-1) were found in leaves, while spots within leaves had concentrations >7000 mg kg(-1), showing that B accumulation in leaf tissue continued even after the onset of necrosis. The B accumulation ability of P. nigra × euramericana is associated with B hypertolerance in the living tissue and storage of B in dead leaf tissue.

  3. Differential transcriptome analysis between Populus and its synthesized allotriploids driven by second-division restitution.

    Science.gov (United States)

    Cheng, Shiping; Huang, Zhen; Li, Yun; Liao, Ting; Suo, Yujing; Zhang, Pingdong; Wang, Jun; Kang, Xiangyang

    2015-12-01

    In this report, we compared transcriptomic differences between a synthetic Populus section Tacamahaca triploid driven by second-division restitution and its parents using a high-throughput RNA-seq method. A total of 4,080 genes were differentially expressed between the high-growth vigor allotriploids (SDR-H) and their parents, and 719 genes were non-additively expressed in SDR-H. Differences in gene expression between the allotriploid and male parent were more significant than those between the allotriploid and female parent, which may be caused by maternal effects. We observed 3,559 differentially expressed genes (DEGs) between the SDR-H and male parent. Notably, the genes were mainly involved in metabolic process, cell proliferation, DNA methylation, cell division, and meristem and developmental growth. Among the 1,056 DEGs between SDR-H and female parent, many genes were associated with metabolic process and carbon utilization. In addition, 1,789 DEGs between high- and low-growth vigor allotriploid were mainly associated with metabolic process, auxin poplar transport, and regulation of meristem growth. Our results indicated that the higher poplar ploidy level can generate extensive transcriptomic diversity compared with its parents. Overall, these results increased our understanding of the driving force for phenotypic variation and adaptation in allopolyploids driven by second-division restitution. © 2015 Institute of Botany, Chinese Academy of Sciences.

  4. Changes in lignocellulosic supramolecular and ultrastructure during dilute acid pretreatment of Populus and switchgrass

    International Nuclear Information System (INIS)

    Foston, Marcus; Ragauskas, Art J.

    2010-01-01

    Dilute acid pretreatment (DAP) is commonly employed prior to enzymatic deconstruction of cellulose to increase overall sugar and subsequent ethanol yields from downstream bioconversion processes. Typically optimization of pretreatment is evaluated by determining hemicellulose removal, subsequent reactivity towards enzymatic deconstruction, and recoverable polysaccharide yields. In this study, the affect of DAP on the supramolecular and ultrastructure of lignocellulosic biomass was evaluated. A series of dilute acidic pretreatments, employing ∼0.10-0.20 mol/m 3 H 2 SO 4 at ∼160-180 o C, for varying residence times were conducted on both Populus and switchgrass samples. The untreated and pretreated biomass samples were characterized by carbohydrate and lignin analysis, gel permeation chromatography (GPC) and 13 C cross polarization magic angle spinning (CPMAS) NMR spectroscopy. GPC analysis shows a reduction in the molecular weight of cellulose and change in its polydispersity index (PDI) with increasing residence time, indicating that pretreatment is actually degrading the cellulose chains. 13 C CPMAS and non-linear line-fitting of the C 4 region in the carbon spectrum of the isolated cellulose not only showed that the crystallinity index increases with residence time, but that the lateral fibril dimension (LFD) and lateral fibril aggregate dimension (LFAD) increase as well.

  5. Thermo-mechanical Densification of Populus tomentosa var. tomentosa with Low Moisture Content

    Directory of Open Access Journals (Sweden)

    Dengyun Tu

    2014-05-01

    Full Text Available This study used thermo-mechanical densification technology to compress low-moisture content (3~5% rapid-growth Populus tomentosa var. tomentosa trees to produce specimens with a low-compression ratio (small volume loss and a uniform density profile and desirable properties. Furthermore, the densified specimens were subjected to post-heat treatment at 180, 190, and 200 °C for 2, 3, and 4 h, respectively. Microscopic examination was performed to observe the changes that occurred in the wood vessels after densification. To determine the influence of post-heat treatment on the set recovery, the specimens were subjected to eight cycles of soaking and drying in 20 °C water and two cycles in boiling water. The density profile tendencies of the densified specimens were in accord with undensified specimens. Microscopic observation revealed that the deformations present in the densified wood resulted from the viscous buckling of cell walls without fracture. The volume of the void areas in the specimens decreased uniformly. Post-heat treatment can decrease compressive deformation, especially when applied at 200 °C for 4 h. After two boiling water cycles of soaking and drying, the densified wood still had a certain set recovery. Therefore, densified wood should be used sparingly in high temperature and high humidity environments.

  6. Structural and kinetic basis for substrate selectivity in Populus tremuloides sinapyl alcohol dehydrogenase.

    Science.gov (United States)

    Bomati, Erin K; Noel, Joseph P

    2005-05-01

    We describe the three-dimensional structure of sinapyl alcohol dehydrogenase (SAD) from Populus tremuloides (aspen), a member of the NADP(H)-dependent dehydrogenase family that catalyzes the last reductive step in the formation of monolignols. The active site topology revealed by the crystal structure substantiates kinetic results indicating that SAD maintains highest specificity for the substrate sinapaldehyde. We also report substantial substrate inhibition kinetics for the SAD-catalyzed reduction of hydroxycinnamaldehydes. Although SAD and classical cinnamyl alcohol dehydrogenases (CADs) catalyze the same reaction and share some sequence identity, the active site topology of SAD is strikingly different from that predicted for classical CADs. Kinetic analyses of wild-type SAD and several active site mutants demonstrate the complexity of defining determinants of substrate specificity in these enzymes. These results, along with a phylogenetic analysis, support the inclusion of SAD in a plant alcohol dehydrogenase subfamily that includes cinnamaldehyde and benzaldehyde dehydrogenases. We used the SAD three-dimensional structure to model several of these SAD-like enzymes, and although their active site topologies largely mirror that of SAD, we describe a correlation between substrate specificity and amino acid substitution patterns in their active sites. The SAD structure thus provides a framework for understanding substrate specificity in this family of enzymes and for engineering new enzyme specificities.

  7. TLC determination of some flavanones in the buds of different genus Populus species and hybrids

    Directory of Open Access Journals (Sweden)

    Pobłocka-Olech Loretta

    2018-06-01

    Full Text Available Flavonoids in the buds of eight Populus species and hybrids were detected and compared with the aid of an optimized TLC method. Separation of 17 flavonoid aglycones belonging to different groups, namely, flavones, flavonols, flavanones and flavanonols, previously described as constituents of poplar buds, was performed on silica gel plates using a hexane/ethyl acetate/formic acid (60:40:1.3, V/V/V mixture as the mobile phase. Pinocembrin and pinostrobin were found in the majority of analyzed poplar buds. For quantitative analysis of both compounds, two TLC evaluation modes, densitometric and videodensitometric, were compared and the established methods were validated. Concentrations of flavanones in some extracts differed slightly or significantly due to the analyzed plant matrix complexity and the TLC evaluation mode applied. Poplar buds rich in flavanones originated from P. × canadensis ‘Robusta’ (1.82 and 2.23 g per 100 g, resp. and P. balsamifera (1.17 and 2.24 g per 100 g, resp..

  8. The yield of natural trembling aspen (populus tremula L.) stands (northern and eastern anatolia)

    International Nuclear Information System (INIS)

    Misir, M.; Misir, N.

    2013-01-01

    Trembling aspen (Populus tremula L.) is one of the most resistant to cold natural species in Turkey. In spite of its importance, there is no research on the yield. Hence, site productivity was determined and yield Table for undisturbed natural trembling aspen stands in Turkey was developed. Data were obtained from a total of 46 plots ranging in age from 17 to 82 years. Yield Table indicates that trembling aspen is very slow growing in young and middle age and Current Annual Increment (CAI) and Mean Annual Increment (MAI) values do not reach its maximum value, even at age 70. This is a proof that trembling aspen is not a fast growing species as expected. The reason for its slow growth is attributed to very short period of growth at very high altitudes. However, in the event of 50 years rotation age, mean annual volume increments of 8.0, 3.6 and 1.1 m3 are estimated for trembling aspen for site classes I, II and III, respectively. At extended rotations, trees of pole sizes could be obtained on all site classes. (author)

  9. Lead tolerance of Populus nigra in symbiosis with arbuscular mycorrhizal fungi in relation to physiological parameters

    International Nuclear Information System (INIS)

    Salehi, A.; Tabari, M.; Mohammadi Goltapeh, E.; Shirvani, A.

    2016-01-01

    With the aim to examine lead tolerance of Populus nigra (clone 62/154) in symbiosis witharbuscular mycorrhizal fungi, a greenhouse experiment was carried out in a factorial randomized complete scheme with two factors 1) fungal inoculation in 4 levels (control, inoculation with Glomus mosseae, inoculation with G. intraradices and inoculation with G. mosseae+G. intraradices) and 2) lead in 4 levels (0, 100, 500 and 1000 mg kg-1 soil). Mycorrhizal colonization and physiological parameters of plants were measured at the end of growth season. Results showed that at all Pb levels, the percentage of root mycorrhizal colonization in fungal treatments was significantly higher than that in control treatment (without fungal inoculation), however without significant differences between 3 fungal treatments. Pb treatments had no significant effect on root mycorrhizal colonization of P. nigra plants. Also, photosynthesis, stomatal conductance, transpiration, intercellular CO2 concentration and water use efficiency of P. nigra plants had no significant inhibitory effects versus the control found under Pb and fungal treatments or their interaction.The results of present study demonstrated that fungal treatments had no significant effects on physiological parameters and Pb tolerance of P. nigraplants. While, in relation to mycorrhizal colonization and physiological parameters, P. nigra clone 62/154 showeda good tolerance to Pb stress. So, in further investigations of phytoremediation of lead-contaminated soils, this clone can be considered as a proposed species.

  10. Cytospora species from Populus and Salix in China with C. davidiana sp. nov.

    Science.gov (United States)

    Wang, Yan-Li; Lu, Quan; Decock, Cony; Li, Yong-Xia; Zhang, Xing-Yao

    2015-05-01

    Poplar and willow plantations have become widespread in China, in order to meet national economic and environmental needs. The emergence of several pathogens is enhanced by climatic change and associated human factors. Species of Cytospora are well-known pathogens on poplar and willow, and cause stem cankers and diebacks. In the present study, we conducted a survey of Cytospora species occurring on Populus spp. and Salix spp. in China. We used morphological examination and phylogenetic inferences, based on the DNA sequence data from the internal transcribed spacer regions (ITS1, 5.8S rDNA, and ITS2) and partial β-tubulin gene, to identify six Cytospora species occurring on poplar and willow. Five of these species belonged to known taxa, viz. Cytospora chrysosperma (asexual state of Valsa sordida), Cytospora translucens (asexual state of Leucostoma translucens), Cytospora fugax (asexual state of Valsa salicina), Cytospora atrocirrhata, and Cytospora kantschavelii. Our study yielded a new species, Cytospora davidiana sp. nov., on poplar. The new species is characterized by typical torsellioid conidiomata. An additional Cytospora sp. 1, which formed a distinct clade in the phylogenetic inferences, remains unnamed; the paucity of available materials prevented phenotypical characterization. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  11. Qualitative variation in proanthocyanidin composition of Populus species and hybrids: genetics is the key.

    Science.gov (United States)

    Scioneaux, Ashley N; Schmidt, Michael A; Moore, Melissa A; Lindroth, Richard L; Wooley, Stuart C; Hagerman, Ann E

    2011-01-01

    The literature on proanthocyanidins (tannins) in ecological systems is dominated by quantitative studies. Despite evidence that the qualitative characteristics (subunit type, polymer chain length) of these complex polyphenolics are important determinants of biological activity, little is known about genetic and environmental controls on the type of proanthocyanidins produced by plants. We tested the hypothesis that genetics, season, developmental stage, and environment determine proanthocyanidin qualitative characteristics by using four Populus "cross types" (narrowleaf [P. angustifolia], Fremont [P. fremontii], F1 hybrids, and backcrosses to narrowleaf). We used thiolysis and HPLC analysis to characterize the proanthocyanidins, and found that genetics strongly control composition. The narrowleaf plants accumulate mixed procyanidin/prodelphinidins with average composition epicatechin(11)-epigallocatechin(8)-catechin(2)-catechin((terminal)). Backcross genotypes produce mixed procyanidin/prodelphinidins similar to narrowleaf, while Fremont makes procyanidin dimers, and the F1 plants contain procyanidin heptamers. Less striking effects were noted for genotype × environment, while season and developmental zone had little effect on proanthocyanidin composition or chain length. We discuss the metabolic and ecological consequences of differences in condensed tannin qualitative traits.

  12. Stem respiration of Populus species in the third year of free-air CO2 enrichment.

    Science.gov (United States)

    Gielen, Birgit; Scarascia-Mugnozza, Giuseppe; Ceulemans, Reinhart

    2003-04-01

    Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO2 concentrations. Regarding this question, effects of elevated [CO2] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-11), P. nigra L. (Clone Jean Pourtet), and P. x euramericana (Clone I-214)) was measured in a managed, high-density forest plantation exposed to free-air CO2 enrichment (POPFACE). During the period of measurements, in May of the third year, stem respiration rates were not affected by the FACE treatment. Moreover, FACE did not influence the relationships between respiration rate and both stem temperature and relative growth rate. The results were supported by the reported absence of a FACE-effect on growth and stem wood density.

  13. Degradation of exogenous caffeine by Populus alba and its effects on endogenous caffeine metabolism.

    Science.gov (United States)

    Pierattini, Erika C; Francini, Alessandra; Raffaelli, Andrea; Sebastiani, Luca

    2016-04-01

    This is the first study reporting the presence of endogenous caffeine, theobromine, and theophylline in all organs of poplar plants. Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) was used in order to evaluate the uptake, translocation, and metabolism of caffeine-(trimethyl-(13)C) in Populus alba L. Villafranca clone grown in hydroponic conditions. We investigated the remediation of caffeine since it is one of the most widely consumed drugs and it is frequently detected in wastewater treatment plant effluents, surface water, and groundwater worldwide. Our results demonstrated that poplar can absorb and degrade exogenous caffeine without negative effects on plant health. Data showed that concentrations of all endogenous compounds varied depending on caffeine-(trimethyl-(13)C) treatments. In particular, in control conditions, endogenous caffeine, theobromine, and theophylline were mainly distributed in roots. On the other hand, once caffeine-(trimethyl-(13)C) was provided, this compound and its dimethy-(13)C metabolites are mainly localized at leaf level. In conclusion, our results support the possible use of Villafranca clone in association with other water treatment systems in order to complete the process of caffeine remediation.

  14. Genetic Variation in Functional Traits Influences Arthropod Community Composition in Aspen (Populus tremula L.)

    Science.gov (United States)

    Robinson, Kathryn M.; Ingvarsson, Pär K.; Jansson, Stefan; Albrectsen, Benedicte R.

    2012-01-01

    We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp) collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores. PMID:22662190

  15. Organization and post-transcriptional processing of the psb B operon from chloroplasts of Populus deltoides.

    Science.gov (United States)

    Dixit, R; Trivedi, P K; Nath, P; Sane, P V

    1999-09-01

    Chloroplast genes are typically organized into polycistronic transcription units that give rise to complex sets of mono- and oligo-cistronic overlapping RNAs through a series of processing steps. The psbB operon contains genes for the PSII (psbB, psbT, psbH) and cytochrome b(6)f (petB and petD) complexes which are needed in different amounts during chloroplast biogenesis. The functional significance of gene organization in this polycistronic unit, containing information for two different complexes, is not known and is of interest. To determine the organization and expression of these complexes, studies have been carried out on crop plants by different groups, but not much information is known about trees. We present the nucleotide sequences of PSII genes and RNA profiles of the genes located in the psbB operon from Populus deltoides, a tree species. Although the gene organization of this operon in P. deltoides is similar to that in other species, a few variations have been observed in the processing scheme.

  16. Biochemical and Physiological Studies on the Effects of Senescence Leaves of Populus deltoides on Triticum vulgare

    Directory of Open Access Journals (Sweden)

    Tejinder Pal Khaket

    2014-01-01

    Full Text Available Triticum vulgare (Wheat based products are the major dietary source of food in developing countries. In India, it grows in association with boundary plantations of Populus deltoids (poplar. During winter, poplar enters in dormancy which cause a heavy leaf fall at the time of wheat seed germination. Large number of poplar senescence leaves may adversely affect the wheat. Therefore, the present study was performed to examine the effect of senescence poplar leaves on wheat germ and some other biochemical parameters. Seed’s germination rate was determined by measuring root and shoot lengths, percent germination, germination index, and inhibition percentage. Biochemical parameters, namely, pigment, carbohydrate, protein, and phenol content, were estimated. Activities of catalase and polyphenol oxidase which are stress marker enzymes were also measured. Results revealed that germination and other biochemical parameters of wheat were severely affected by senescence poplar leaves even at very low concentration. So, intercropping of poplar along with wheat may be chosen carefully as wheat is the major dietary staple.

  17. Wood properties of Populus and Betula in long-term exposure to elevated CO₂ and O₃.

    Science.gov (United States)

    Kostiainen, Katri; Saranpää, Pekka; Lundqvist, Sven-Olof; Kubiske, Mark E; Vapaavuori, Elina

    2014-06-01

    We studied the interactive effects of elevated concentrations of CO2 and O3 on radial growth and wood properties of four trembling aspen (Populus tremuloides Michx.) clones and paper birch (Betula papyrifera Marsh.) saplings. The material for the study was collected from the Aspen FACE (free-air CO2 enrichment) experiment in Rhinelander (WI, USA). Trees had been exposed to four treatments [control, elevated CO2 (560 ppm), elevated O3 (1.5 times ambient) and combined CO2 + O3 ] during growing seasons 1998-2008. Most treatment responses were observed in the early phase of experiment. Our results show that the CO2- and O3-exposed aspen trees displayed a differential balance between efficiency and safety of water transport. Under elevated CO2, radial growth was enhanced and the trees had fewer but hydraulically more efficient larger diameter vessels. In contrast, elevated O3 decreased radial growth and the diameters of vessels and fibres. Clone-specific decrease in wood density and cell wall thickness was observed under elevated CO2 . In birch, the treatments had no major impacts on wood anatomy or wood density. Our study indicates that short-term impact studies conducted with young seedlings may not give a realistic view of long-term ecosystem responses. © 2013 John Wiley & Sons Ltd.

  18. Genetic variation in functional traits influences arthropod community composition in aspen (Populus tremula L..

    Directory of Open Access Journals (Sweden)

    Kathryn M Robinson

    Full Text Available We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores.

  19. Genetic, morphological, and spectral characterization of relictual Niobrara River hybrid aspens (Populus × smithii).

    Science.gov (United States)

    Deacon, Nicholas John; Grossman, Jake Joseph; Schweiger, Anna Katharina; Armour, Isabella; Cavender-Bares, Jeannine

    2017-12-01

    Aspen groves along the Niobrara River in Nebraska have long been a biogeographic curiosity due to morphological differences from nearby remnant Populus tremuloides populations. Pleistocene hybridization between P. tremuloides and P. grandidentata has been proposed, but the nearest P. grandidentata populations are currently several hundred kilometers east. We tested the hybrid-origin hypothesis using genetic data and characterized putative hybrids phenotypically. We compared nuclear microsatellite loci and chloroplast sequences of Niobrara River aspens to their putative parental species. Parental species and putative hybrids were also grown in a common garden for phenotypic comparison. On the common garden plants, we measured leaf morphological traits and leaf-level spectral reflectance profiles, from which chemical traits were derived. The genetic composition of the three unique Niobrara aspen genotypes is consistent with the hybridization hypothesis and with maternal chloroplast inheritance from P. grandidentata . Leaf margin dentition and abaxial pubescence differentiated taxa, with the hybrids showing intermediate values. Spectral profiles allowed statistical separation of taxa in short-wave infrared wavelengths, with hybrids showing intermediate values, indicating that traits associated with internal structure of leaves and water absorption may vary among taxa. However, reflectance values in the visible region did not differentiate taxa, indicating that traits related to pigments are not differentiated. Both genetic and phenotypic results support the hypothesis of a hybrid origin for these genetically unique aspens. However, low genetic diversity and ongoing ecological and climatic threats to the hybrid taxon present a challenge for conservation of these relictual boreal communities. © 2017 Botanical Society of America.

  20. Urbanization-related changes in European aspen (Populus tremula L.): Leaf traits and litter decomposition

    International Nuclear Information System (INIS)

    Nikula, Suvi; Vapaavuori, Elina; Manninen, Sirkku

    2010-01-01

    We investigated foliar and litter responses of European aspen (Populus tremula L.) to urbanization, including factors such as increased temperature, moisture stress and nitrogen (N) deposition. Leaf samples were collected in 2006-2008 from three urban and three rural forest stands in the Helsinki Metropolitan Area, southern Finland, and reciprocal litter transplantations were established between urban and rural sites. Urban leaves exhibited a higher amount of epicuticular waxes and N concentration, and a lower C:N ratio than rural ones, but there was no difference in specific leaf area. Urban litter had a slightly higher N concentration, lower concentrations of lignin and total phenolics, and was more palatable to a macrofaunal decomposer. Moreover, litter decay was faster at the urban site and for urban litter. Urbanization thus resulted in foliar acclimatization in terms of increased amount of epicuticular waxes, as well as in accelerated decomposition of the N-richer leaf litter. - Urbanization can modify leaf traits of aspen and accelerate litter decomposition through changes in litter traits as well as in environmental conditions at the decomposition site.

  1. Phylogeny reconstruction and hybrid analysis of populus (Salicaceae) based on nucleotide sequences of multiple single-copy nuclear genes and plastid fragments.

    Science.gov (United States)

    Wang, Zhaoshan; Du, Shuhui; Dayanandan, Selvadurai; Wang, Dongsheng; Zeng, Yanfei; Zhang, Jianguo

    2014-01-01

    Populus (Salicaceae) is one of the most economically and ecologically important genera of forest trees. The complex reticulate evolution and lack of highly variable orthologous single-copy DNA markers have posed difficulties in resolving the phylogeny of this genus. Based on a large data set of nuclear and plastid DNA sequences, we reconstructed robust phylogeny of Populus using parsimony, maximum likelihood and Bayesian inference methods. The resulting phylogenetic trees showed better resolution at both inter- and intra-sectional level than previous studies. The results revealed that (1) the plastid-based phylogenetic tree resulted in two main clades, suggesting an early divergence of the maternal progenitors of Populus; (2) three advanced sections (Populus, Aigeiros and Tacamahaca) are of hybrid origin; (3) species of the section Tacamahaca could be divided into two major groups based on plastid and nuclear DNA data, suggesting a polyphyletic nature of the section; and (4) many species proved to be of hybrid origin based on the incongruence between plastid and nuclear DNA trees. Reticulate evolution may have played a significant role in the evolution history of Populus by facilitating rapid adaptive radiations into different environments.

  2. Phylogeny reconstruction and hybrid analysis of populus (Salicaceae based on nucleotide sequences of multiple single-copy nuclear genes and plastid fragments.

    Directory of Open Access Journals (Sweden)

    Zhaoshan Wang

    Full Text Available Populus (Salicaceae is one of the most economically and ecologically important genera of forest trees. The complex reticulate evolution and lack of highly variable orthologous single-copy DNA markers have posed difficulties in resolving the phylogeny of this genus. Based on a large data set of nuclear and plastid DNA sequences, we reconstructed robust phylogeny of Populus using parsimony, maximum likelihood and Bayesian inference methods. The resulting phylogenetic trees showed better resolution at both inter- and intra-sectional level than previous studies. The results revealed that (1 the plastid-based phylogenetic tree resulted in two main clades, suggesting an early divergence of the maternal progenitors of Populus; (2 three advanced sections (Populus, Aigeiros and Tacamahaca are of hybrid origin; (3 species of the section Tacamahaca could be divided into two major groups based on plastid and nuclear DNA data, suggesting a polyphyletic nature of the section; and (4 many species proved to be of hybrid origin based on the incongruence between plastid and nuclear DNA trees. Reticulate evolution may have played a significant role in the evolution history of Populus by facilitating rapid adaptive radiations into different environments.

  3. Peak discharge, flood frequency, and peak stage of floods on Big Cottonwood Creek at U.S. Highway 50 near Coaldale, Colorado, and Fountain Creek below U.S. Highway 24 in Colorado Springs, Colorado, 2016

    Science.gov (United States)

    Kohn, Michael S.; Stevens, Michael R.; Mommandi, Amanullah; Khan, Aziz R.

    2017-12-14

    The U.S. Geological Survey (USGS), in cooperation with the Colorado Department of Transportation, determined the peak discharge, annual exceedance probability (flood frequency), and peak stage of two floods that took place on Big Cottonwood Creek at U.S. Highway 50 near Coaldale, Colorado (hereafter referred to as “Big Cottonwood Creek site”), on August 23, 2016, and on Fountain Creek below U.S. Highway 24 in Colorado Springs, Colorado (hereafter referred to as “Fountain Creek site”), on August 29, 2016. A one-dimensional hydraulic model was used to estimate the peak discharge. To define the flood frequency of each flood, peak-streamflow regional-regression equations or statistical analyses of USGS streamgage records were used to estimate annual exceedance probability of the peak discharge. A survey of the high-water mark profile was used to determine the peak stage, and the limitations and accuracy of each component also are presented in this report. Collection and computation of flood data, such as peak discharge, annual exceedance probability, and peak stage at structures critical to Colorado’s infrastructure are an important addition to the flood data collected annually by the USGS.The peak discharge of the August 23, 2016, flood at the Big Cottonwood Creek site was 917 cubic feet per second (ft3/s) with a measurement quality of poor (uncertainty plus or minus 25 percent or greater). The peak discharge of the August 29, 2016, flood at the Fountain Creek site was 5,970 ft3/s with a measurement quality of poor (uncertainty plus or minus 25 percent or greater).The August 23, 2016, flood at the Big Cottonwood Creek site had an annual exceedance probability of less than 0.01 (return period greater than the 100-year flood) and had an annual exceedance probability of greater than 0.005 (return period less than the 200-year flood). The August 23, 2016, flood event was caused by a precipitation event having an annual exceedance probability of 1.0 (return

  4. A genomics investigation of partitioning into and among flavonoid-derived condensed tannins for carbon sequestration in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Harding, Scott, A; Tsai, Chung-jui; Lindroth, Richard, L

    2013-03-24

    The project set out to use comparative (genotype and treatment) and transgenic approaches to investigate the determinants of condensed tannin (CT) accrual and chemical variability in Populus. CT type and amount are thought to effect the decomposition of plant detritus in the soil, and thereby the sequestering of carbon in the soil. The stated objectives were: 1. Genome-wide transcriptome profiling (microarrays) to analyze structural gene, transcription factor and metabolite control of CT partitioning; 2. Transcriptomic (microarray) and chemical analysis of ontogenetic effects on CT and PG partitioning; and 3. Transgenic manipulation of flavonoid biosynthetic pathway genes to modify the control of CT composition. Objective 1: A number of approaches for perturbing CT content and chemistry were tested in Objective 1, and those included nitrogen deficit, leaf wounding, drought, and salicylic acid spraying. Drought had little effect on CTs in the genotypes we used. Plants exhibited unpredictability in their response to salicylic acid spraying, leading us to abandon its use. Reduced plant nitrogen status and leaf wounding caused reproducible and magnitudinally striking increases in leaf CT content. Microarray submissions to NCBI from those experiments are the following: GSE ID 14515: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 1979. Public on Jan 04, 2010; Contributor(s) Harding SA, Tsai C GSE ID 14893: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 3200. Public on Feb 19, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16783 Wound-induced gene expression changes in Populus: 1 week; clone RM5. Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16785 Wound-induced gene expression changes in Populus: 90 hours; clone RM5 Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C Although CT amount changed in response to treatments, CT composition was essentially

  5. Geochemical peculiarities of black poplar leaves (Populus nigra L.) in the sites with heavy metals intensive fallouts

    Science.gov (United States)

    Yalaltdinova, Albina; Baranovskaya, Natalya; Rikhvanov, Leonid; Matveenko, Irina

    2013-04-01

    The article deals with the content of 28 chemical elements in the leaves ash of black poplar (Populus nigra L.) growing in Ust-Kamenogorsk city area. It is the major industrial center of Kazakhstan Republic on the territory where the industrial giants of non-ferrous metallurgy and nuclear energy are situated. Comparative analysis with the similar data obtained from leaves ash of Populus nigra L. in Tomsk, Ekibastuz, and Pavlodar cities has revealed that in comparison with other urban areas, leaves ash of black poplar (Populus nigra L.) from Ust-Kamenogorsk city is characterized by elevated concentration rates of Ta, U, Zn, Ag, As, Sb, Br, Sr and Na. Within the city, the sites and areas with abnormal contents of typomorphic pollutants have been revealed. In the central part of the city, in the vicinity of lead-zinc plant and Ulba metallurgical plant, the highest concentrations of Ta, U, Zn, Ag, Au, As, Sb, Cr and Fe were marked. In the northeast, where the titanium-magnesium plant is located, elevated concentrations of Br and Sr were stated. Thus, the impact of major city enterprises which are the main sources of heavy metals is reflected in the element composition. Zn, As, Sb, Ag and Au comes from lead-zinc plant and its refinery plants, while Ulba metallurgical plant can be considered source of Ta and U in the environment, producing tantalum and fuel pellets for nuclear power plants. These companies, due to the current objective circumstances, are located in the central part of the city, have a significant negative effect on the environment and form the risk factors for human health.

  6. A study of polymerization of aspen (Populus) wood lipophilic extractives by SEC and Py-GC/MS

    CSIR Research Space (South Africa)

    Sithole, Bruce

    2013-03-01

    Full Text Available ) Orig inal manuscript received 13 June 2012, revision accepted 31 October 2012 Vol 66 No 1 January - March 2013 1 PEER REVIEWED A study of polymerization of aspen (Populus) wood lipophilic extractives by SEC and Py-GC/MS BRUCE SITHOLE1*, LUC... of polymerized wood resin that will be difficult to remove if present in pulp and paper products. On the other hand, these problems may be minor compared to using unseasoned wood. KEYWORDS: Aspen, extractives, polymerization, size exclusion chromatography, Py...

  7. parámetros en híbridos de populus

    Directory of Open Access Journals (Sweden)

    O. S. Vallejos-Barra

    2007-01-01

    Full Text Available La variable diámetro a la altura del pecho, medido a 1.3 m desde el suelo (DAP es lognormal si log(DAP-θ se distribuye normalmente. Para simplificar el ajuste de esta función de densidad de probabilidad (fdp se supone que el parámetro de localización (θ es cero en híbridos de Populus; sin embargo, en algunos casos esta simplificación no asegura el mejor ajuste de la fdp, incidiendo en la representación de la estructura horizontal de los híbridos. El objetivo de la investigación fue calcular el parámetro θ que proporcione el mejor ajuste de la fdp lognormal del DAP en los híbridos I-488 e I-63/51. Para este cálculo se utilizó un algoritmo de búsqueda binaria, que minimizó el estadístico Dn de la prueba de Kolmogorov-Smirnov. 38 % de las parcelas presentó un parámetro θ distinto de cero, originando una mejoría del valor de probabilidad (P entre 0.02 y 55.4 %. Se hizo un análisis de varianza no paramétrico de la variable “√n * Dn”, ya que la variable original y múltiples transformaciones no permitieron aceptar los supuestos del análisis paramétrico. El tipo de ajuste presentó diferencias estadísticas altamente significativas con un valor de 17.1 (P0.800 y las edades un valor de 11.2 (P>0.260.

  8. Strong population bottleneck and repeated demographic expansions of Populus adenopoda (Salicaceae) in subtropical China.

    Science.gov (United States)

    Fan, Liqiang; Zheng, Honglei; Milne, Richard I; Zhang, Lei; Mao, Kangshan

    2018-03-14

    Glacial refugia and inter-/postglacial recolonization routes during the Quaternary of tree species in Europe and North America are well understood, but far less is known about those of tree species in subtropical eastern Asia. Thus, we have examined the phylogeographic history of Populus adenopoda (Salicaceae), one of the few poplars that naturally occur in this subtropical area. Genetic variations across the range of the species in subtropical China were surveyed using ten nuclear microsatellite loci and four chloroplast fragments (matK, trnG-psbK, psbK-psbI and ndhC-trnV). Coalescent-based analyses were used to test demographic and migration hypotheses. In addition, species distribution models (SDMs) were constructed to infer past, present and future potential distributions of the species. Thirteen chloroplast haplotypes were detected, and haplotype-rich populations were found in central and southern parts of the species' range. STRUCTURE analyses of nuclear microsatellite loci suggest obvious lineage admixture, especially in peripheral and northern populations. DIYABC analysis suggests that the species might have experienced two independent rounds of demographic expansions and a strong bottleneck in the late Quaternary. SDMs indicate that the species' range contracted during the Last Glacial Maximum (LGM), and contracted northward but expanded eastward during the Last Interglacial (LIG). Chloroplast data and SDMs suggest that P. adenopoda might have survived in multiple glacial refugia in central and southern parts of its range during the LGM. Populations of the Yunnan-Guizhou Plateau in the southern part have high chloroplast DNA diversity, but may have contributed little to the postglacial recolonization of northern and eastern parts. The three major demographic events inferred by DIYABC coincide with the initiation of the LIG, start of the LGM and end of the LGM, respectively. The species may have experienced multiple rounds of range contraction during

  9. Sex-specific responses of Populus yunnanensis exposed to elevated CO{sub 2} and salinity

    Energy Technology Data Exchange (ETDEWEB)

    Ling Li; Yuanbin Zhang; Chunyang Li [Chinese Academy of Sciences. Chengdu Institute of Biology, Chengdu (Switzerland); Jianxun Luo, Sichuan Academy of Forestry, Chengdu (Switzerland)); Korpelainen, H. [Univ. of Helsinki. Dept. of Agricultural Sciences, Helsinki (Finland)

    2013-04-15

    Populus yunnanensis Dode., a native dioecious woody plant in southwestern China, was employed as a model species to study sex-specific morphological, physiological and biochemical responses to elevated CO{sub 2} and salinity. To investigate the effects of elevated CO{sub 2}, salinity and their combination, the cuttings were exposed to two CO{sub 2} regimes (ambient CO{sub 2} and double ambient CO{sub 2}) and two salt treatments in growth chambers. Males exhibited greater downregulation of net photosynthesis rate (A{sub net}) and carboxylation efficiency (CE) than females at elevated CO{sub 2}, whereas these sexual differences were lessened under salt stress. On the other hand, salinity induced a higher decrease in Anet and CE, more growth inhibition and leaf Cl{sup -} accumulation and more damage to cell organelles in females than in males, whereas the sexual differences in photosynthesis and growth were lessened at elevated CO{sub 2}. Moreover, elevated CO{sub 2} exacerbated membrane lipid peroxidation and organelle damage in females but not in males under salt stress. Our results indicated that: (1) females are more sensitive and suffer from greater negative effects than do males under salt stress, and elevated CO{sub 2} lessens the sexual differences in photosynthesis and growth under salt stress; (2) elevated CO{sub 2} tends to aggravate the negative effects of salinity in females; and (3) sex-specific reactions under the combination of elevated CO{sub 2} and salinity are distinct from single-stress responses. Therefore, these results provide evidence for different adaptive responses between plants of different sexes exposed to elevated CO{sub 2} and salinity. (Author)

  10. Energy dynamics in Populus deltoides G{sub 3} Marsh agroforestry systems in eastern India

    Energy Technology Data Exchange (ETDEWEB)

    Chaturvedi, O.P. [National Research Centre for Agroforestry, Jhansi (India); Das, D.K. [Rajendra Agricultural Univ., Dept. of Forestry, Bihar (India)

    2005-08-01

    Energy efficiency of Populus deltoides G{sub 3} Marsh agroforestry of a 3-year-old system with intercropping of maize-wheat in crop I and pigeonpea in crop II and of a 9-year-old system with turmeric, a shade loving crop was studied at Pusa, Bihar in eastern India. Energy fixation, storage, net allocation in agronomic yield and energy released and exit from the 9-year-old system was 1.53, 4.30, 0.43 and 3.37 times in crop I and 1.67, 4.60, 0.53 and 3.30 times in crop II of the 3-year-old agroforestry system. The energy conservation efficiency in the 9-year-old system was higher (1.91%) as compared to crop I (1.24%) and crop II (1.15%) of the 3-year-old agroforestry system. The energy accumulation ratio in the 9-year-old system was 2.82 and 2.77 times higher in crop I and crop II, respectively, of the 3-year-old agroforestry system. The 3-year-old agroforestry system showed lower energy accumulation ratio resulting from less energy accumulation in perennial turnover in the form of leaf of tree and agricultural crops. The crop II system of the 3-year-old poplar agroforestry was more efficient system of management due to higher quanta of energy and higher cash return but one has to opt for shade loving intercrop turmeric with increase in age of the poplar plantation and more canopy closure. (Author)

  11. Energy dynamics in Populus deltoides G3 Marsh agroforestry systems in eastern India

    International Nuclear Information System (INIS)

    Chaturvedi, O.P.; Das, D.K.

    2005-01-01

    Energy efficiency of Populus deltoides G 3 Marsh agroforestry of a 3-year-old system with intercropping of maize-wheat in crop I and pigeonpea in crop II and of a 9-year-old system with turmeric, a shade loving crop was studied at Pusa, Bihar in eastern India. Energy fixation, storage, net allocation in agronomic yield and energy released and exit from the 9-year-old system was 1.53, 4.30, 0.43 and 3.37 times in crop I and 1.67, 4.60, 0.53 and 3.30 times in crop II of the 3-year-old agroforestry system. The energy conservation efficiency in the 9-year-old system was higher (1.91%) as compared to crop I (1.24%) and crop II (1.15%) of the 3-year-old agroforestry system. The energy accumulation ratio in the 9-year-old system was 2.82 and 2.77 times higher in crop I and crop II, respectively, of the 3-year-old agroforestry system. The 3-year-old agroforestry system showed lower energy accumulation ratio resulting from less energy accumulation in perennial turnover in the from of leaf of tree and agricultural crops. The crop II system of the 3-year-old poplar agroforestry was more efficient system of management due to higher quanta of energy and higher cash return but one has to opt for shade loving intercrop turmeric with increase in age of the poplar plantation and more canopy closure

  12. Physiological and morphological responses of Tamarix ramosissima and Populus euphratica to altered groundwater availability.

    Science.gov (United States)

    Li, J; Yu, B; Zhao, C; Nowak, Robert S; Zhao, Z; Sheng, Y; Li, J

    2013-01-01

    Riparian plants in arid areas are subject to frequent hydrological fluctuations induced through natural flow variation and water use by humans. Although many studies have focused on the success of Tamarix ramosissima Ledeb. in its invaded ranges, its major competitor in its home range, Populus euphratica Oliv., historically has dominated riparian forests where both species occur naturally. Thus, identifying ecophysiological differences between T. ramosissima and its co-evolved competitor under varying hydrological conditions may help us understand how flow regimes affect dominance in its home range and promote invasion in new ranges. We examined ecophysiological responses of T. ramosissima and P. euphratica, which are both native to the Tarim River Basin, northwest China, to experimental alterations in groundwater. Seedlings of both species were grown in lysimeters, first under well-watered conditions and then exposed to different groundwater treatments: inundation, drought, and relatively shallow, moderate and deep groundwater. Under inundation, T. ramosissima showed little growth whereas P. euphratica died after ~45 days. Droughted seedlings of both species suffered from considerable water stress evidenced by slow growth, decreased total leaf area and specific leaf area, and decreased xylem water potential (ψ), maximum photosynthetic rate and carboxylation efficiency. Both species had better ecophysiological performances under shallow and moderate groundwater conditions. When groundwater declined below rooting depth, seedlings of both species initially experienced decreased ψ, but ψ of T. ramosissima recovered late in the experiment whereas P. euphratica maintained decreased ψ. This ability of T. ramosissima to recover from water deficit might result from its rapid root elongation and subsequent ability to acquire groundwater, which in turn likely provides ecophysiological advantages over P. euphratica. Our results suggest that recent groundwater declines

  13. Modelling the growth of Populus species using Ecosystem Demography (ED) model

    Science.gov (United States)

    Wang, D.; Lebauer, D. S.; Feng, X.; Dietze, M. C.

    2010-12-01

    Hybrid poplar plantations are an important source being evaluated for biomass production. Effective management of such plantations requires adequate growth and yield models. The Ecosystem Demography model (ED) makes predictions about the large scales of interest in above- and belowground ecosystem structure and the fluxes of carbon and water from a description of the fine-scale physiological processes. In this study, we used a workflow management tool, the Predictive Ecophysiological Carbon flux Analyzer (PECAn), to integrate literature data, field measurement and the ED model to provide predictions of ecosystem functioning. Parameters for the ED ensemble runs were sampled from the posterior distribution of ecophysiological traits of Populus species compiled from the literature using a Bayesian meta-analysis approach. Sensitivity analysis was performed to identify the parameters which contribute the most to the uncertainties of the ED model output. Model emulation techniques were used to update parameter posterior distributions using field-observed data in northern Wisconsin hybrid poplar plantations. Model results were evaluated with 5-year field-observed data in a hybrid poplar plantation at New Franklin, MO. ED was then used to predict the spatial variability of poplar yield in the coterminous United States (United States minus Alaska and Hawaii). Sensitivity analysis showed that root respiration, dark respiration, growth respiration, stomatal slope and specific leaf area contribute the most to the uncertainty, which suggests that our field measurements and data collection should focus on these parameters. The ED model successfully captured the inter-annual and spatial variability of the yield of poplar. Analyses in progress with the ED model focus on evaluating the ecosystem services of short-rotation woody plantations, such as impacts on soil carbon storage, water use, and nutrient retention.

  14. Nitrogen nutrient status induces sexual differences in responses to cadmium in Populus yunnanensis.

    Science.gov (United States)

    Chen, Lianghua; Han, Ying; Jiang, Hao; Korpelainen, Helena; Li, Chunyang

    2011-10-01

    Populus yunnanensis was employed as a model species to detect sexual differences in growth, physiological, biochemical, and ultrastructural responses to cadmium (Cd) stress, nitrogen (N) deposition, and their combination. Compared with the control conditions, Cd decreased plant biomass, damaged the photosynthetic apparatus, visible as a decreased maximum efficiency of photosystem II (PSII; F(v)/F(m)) and effective quantum yield of PSII (Yield), depressed gas exchange capacity, and induced oxidative stress, visible as the disruption of antioxidative enzymes and accumulation of reactive oxygen species (ROS), in both sexes. On the other hand, Cd toxicity was mitigated by the recovery of gas exchange capacity, a decrease in ROS, and improvement of the redox imbalance in both sexes when N deposition was applied. However, males showed a higher gas exchange capacity, lower enzyme inhibition and ROS accumulation, stronger abilities to maintain cellular redox homeostasis, and a better maintenance of chloroplast ultrastructure than did females when exposed to Cd stress alone. Although males exhibited a higher Cd content in leaves than did females, males also accumulated higher levels of non-protein thiols (NP-SHs) and free amino acids (FAAs) for detoxification than did females. Sexual differences induced by Cd, visible, for example, in F(v)/F(m), Yield, net photosynthesis rate (A), and stomatal conductance (g(s)), decreased under N deposition, as no significant differences between the sexes existed in these parameters under the combined treatment. The results indicated that females are more sensitive to Cd stress and suffer more injuries than do males. Moreover, N deposition can mitigate Cd toxicity and decrease sexual differences in Cd sensitivity.

  15. Phytoextraction potential of poplar (Populus alba L. var. pyramidalis Bunge) from calcareous agricultural soils contaminated by cadmium.

    Science.gov (United States)

    Hu, Yahu; Nan, Zhongren; Jin, Cheng; Wang, Ning; Luo, Huanzhang

    2014-01-01

    To investigate the phytoextraction potential of Populus alba L. var. pyramidalis Bunge for cadmium (Cd) contaminated calcareous soils, a concentration gradient experiment and a field sampling experiment (involving poplars of different ages) were conducted. The translocation factors for all experiments and treatments were greater than 1. The bioconcentration factor decreased from 2.37 to 0.25 with increasing soil Cd concentration in the concentration gradient experiment and generally decreased with stand age under field conditions. The Cd concentrations in P. pyramidalis organs decreased in the order of leaves > stems > roots. The shoot biomass production in the concentration gradient experiment was not significantly reduced with soil Cd concentrations up to or slightly over 50 mg kg(-1). The results show that the phytoextraction efficiency of P. pyramidalis depends on both the soil Cd concentration and the tree age. Populus pyramidalis is most suitable for remediation of slightly Cd contaminated calcareous soils through the combined harvest of stems and leaves under actual field conditions.

  16. Changes in photosynthesis, mesophyll conductance to CO2, and isoprenoid emissions in Populus nigra plants exposed to excess nickel

    International Nuclear Information System (INIS)

    Velikova, Violeta; Tsonev, Tsonko; Loreto, Francesco; Centritto, Mauro

    2011-01-01

    Poplar (Populus nigra) plants were grown hydroponically with 30 and 200 μM Ni (Ni 30 and Ni 200 ). Photosynthesis limitations and isoprenoid emissions were investigated in two leaf types (mature and developing). Ni stress significantly decreased photosynthesis, and this effect depended on the leaf Ni content, which was lower in mature than in developing leaves. The main limitations to photosynthesis were attributed to mesophyll conductance and metabolism impairment. In Ni-stressed developing leaves, isoprene emission was significantly stimulated. We attribute such stimulation to the lower chloroplastic [CO 2 ] than in control leaves. However chloroplastic [CO 2 ] did not control isoprene emission in mature leaves. Ni stress induced the emission of cis-β-ocimene in mature leaves, and of linalool in both leaf types. Induced biosynthesis and emission of isoprenoids reveal the onset of antioxidant processes that may also contribute to reduce Ni stress, especially in mature poplar leaves. - Graphical abstract: Visible damage caused by Ni treatment. 1 - Ni 0 (control plants); 2 - Ni 200 ; M = mature and D = developing Populus nigra leaves. Display Omitted Highlights: → We study the effect of Ni pollution on photosynthesis and isoprenoid emissions. → Ni stress significantly decreases photosynthesis. The main limitations are attributed to mesophyll conductance and metabolism impairment. → Constitutive isoprene emission was significantly stimulated in Ni-stressed leaves. Exposure to enhanced Ni concentration induces cis-beta-ocimene and linalool emissions. - The study reveals consequences of Ni stress on plant physiology, namely increasing diffusional limitation to photosynthesis and isoprenoid emissions.

  17. Expression Patterns of ERF Genes Underlying Abiotic Stresses in Di-Haploid Populus simonii × P. nigra

    Directory of Open Access Journals (Sweden)

    Shengji Wang

    2014-01-01

    Full Text Available 176 ERF genes from Populus were identified by bioinformatics analysis, 13 of these in di-haploid Populus simonii × P. nigra were investigate by real-time RT-PCR, the results demonstrated that 13 ERF genes were highly responsive to salt stress, drought stress and ABA treatment, and all were expressed in root, stem, and leaf tissues, whereas their expression levels were markedly different in the various tissues. In roots, PthERF99, 110, 119, and 168 were primarily downregulated under drought and ABA treatment but were specifically upregulated under high salt condition. Interestingly, in poplar stems, all ERF genes showed the similar trends in expression in response to NaCl stress, drought stress, and ABA treatment, indicating that they may not play either specific or unique roles in stems in abiotic stress responses. In poplar leaves, PthERF168 was highly induced by ABA treatment, but was suppressed by high salinity and drought stresses, implying that PthERF168 participated in the ABA signaling pathway. The results of this study indicated that ERF genes could play essential but distinct roles in various plant tissues in response to different environment cues and hormonal treatment.

  18. Effects of hybridization and evolutionary constraints on secondary metabolites: the genetic architecture of phenylpropanoids in European populus species.

    Science.gov (United States)

    Caseys, Celine; Stritt, Christoph; Glauser, Gaetan; Blanchard, Thierry; Lexer, Christian

    2015-01-01

    The mechanisms responsible for the origin, maintenance and evolution of plant secondary metabolite diversity remain largely unknown. Decades of phenotypic studies suggest hybridization as a key player in generating chemical diversity in plants. Knowledge of the genetic architecture and selective constraints of phytochemical traits is key to understanding the effects of hybridization on plant chemical diversity and ecological interactions. Using the European Populus species P. alba (White poplar) and P. tremula (European aspen) and their hybrids as a model, we examined levels of inter- and intraspecific variation, heritabilities, phenotypic correlations, and the genetic architecture of 38 compounds of the phenylpropanoid pathway measured by liquid chromatography and mass spectrometry (UHPLC-MS). We detected 41 quantitative trait loci (QTL) for chlorogenic acids, salicinoids and flavonoids by genetic mapping in natural hybrid crosses. We show that these three branches of the phenylpropanoid pathway exhibit different geographic patterns of variation, heritabilities, and genetic architectures, and that they are affected differently by hybridization and evolutionary constraints. Flavonoid abundances present high species specificity, clear geographic structure, and strong genetic determination, contrary to salicinoids and chlorogenic acids. Salicinoids, which represent important defence compounds in Salicaceae, exhibited pronounced genetic correlations on the QTL map. Our results suggest that interspecific phytochemical differentiation is concentrated in downstream sections of the phenylpropanoid pathway. In particular, our data point to glycosyltransferase enzymes as likely targets of rapid evolution and interspecific differentiation in the 'model forest tree' Populus.

  19. Effects of hybridization and evolutionary constraints on secondary metabolites: the genetic architecture of phenylpropanoids in European populus species.

    Directory of Open Access Journals (Sweden)

    Celine Caseys

    Full Text Available The mechanisms responsible for the origin, maintenance and evolution of plant secondary metabolite diversity remain largely unknown. Decades of phenotypic studies suggest hybridization as a key player in generating chemical diversity in plants. Knowledge of the genetic architecture and selective constraints of phytochemical traits is key to understanding the effects of hybridization on plant chemical diversity and ecological interactions. Using the European Populus species P. alba (White poplar and P. tremula (European aspen and their hybrids as a model, we examined levels of inter- and intraspecific variation, heritabilities, phenotypic correlations, and the genetic architecture of 38 compounds of the phenylpropanoid pathway measured by liquid chromatography and mass spectrometry (UHPLC-MS. We detected 41 quantitative trait loci (QTL for chlorogenic acids, salicinoids and flavonoids by genetic mapping in natural hybrid crosses. We show that these three branches of the phenylpropanoid pathway exhibit different geographic patterns of variation, heritabilities, and genetic architectures, and that they are affected differently by hybridization and evolutionary constraints. Flavonoid abundances present high species specificity, clear geographic structure, and strong genetic determination, contrary to salicinoids and chlorogenic acids. Salicinoids, which represent important defence compounds in Salicaceae, exhibited pronounced genetic correlations on the QTL map. Our results suggest that interspecific phytochemical differentiation is concentrated in downstream sections of the phenylpropanoid pathway. In particular, our data point to glycosyltransferase enzymes as likely targets of rapid evolution and interspecific differentiation in the 'model forest tree' Populus.

  20. Analysis of a Farquhar-von Caemmerer-Berry leaf-level photosynthetic rate model for Populus tremuloides in the context of modeling and measurement limitations

    Science.gov (United States)

    K.E. Lenz; G.E. Host; K. Roskoski; A. Noormets; A. Sober; D.F. Karnosky

    2010-01-01

    The balance of mechanistic detail with mathematical simplicity contributes to the broad use of the Farquhar, von Caemmerer and Berry (FvCB) photosynthetic rate model. Here the FvCB model was coupled with a stomatal conductance model to form an [A,gs] model, and parameterized for mature Populus tremuloides leaves under varying CO2...

  1. Elimination behaviour and soil mineral nitrogen load in an organic system with lactating sows – comparing pasture based systems with and without access to poplar (Populus sp.) trees

    DEFF Research Database (Denmark)

    Jakobsen, Malene; Hermansen, John Erik; Andersen, Heidi Mai-Lis

    2017-01-01

    There is an urgent need to introduce innovative strategies in the current free-range pig production to improve the environmental performance. Based on previous experiences, inclusion of a zone with poplar (Populus sp.) trees in individual sow paddocks was hypothesized to improve the system’s nitr...

  2. Natural hybridization between Populus nigra L. and P. x canadensis Moench. Hybrid offspring competes for niches along the Rhine river in the Netherlands

    NARCIS (Netherlands)

    Smulders, M.J.M.; Beringen, R.; Volosyanchuk, R.; Vanden Broeck, A.; Schoot, van der J.; Arens, P.F.P.; Vosman, B.

    2008-01-01

    Black poplar (Populus nigra L.) is a major species for European riparian forests but its abundance has decreased over the decades due to human influences. For restoration of floodplain woodlands, the remaining black poplar stands may act as source population. A potential problem is that P. nigra and

  3. Stem wood properties of Populus tremuloides, Betula papyrifera and Acer saccharum saplings after three years of treatments to elevated carbon dioxide and ozone

    Science.gov (United States)

    Seija Kaakinen; Katri Kostiainen; Fredrik Ek; Pekka Saranpaa; Mark E. Kubiske; Jaak Sober; David F. Karnosky; Elina Vapaavuori

    2004-01-01

    The aim of this study was to examine the effects of elevated carbon dioxide [CO2] and ozone [O3] and their interaction on wood chemistry and anatomy of five clones of 3-year-old trembling aspen (Populus tremuloides Michx.). Wood chemistry was studied also on paper birch (Betula papyrifera...

  4. Relations between continuous real-time turbidity data and discrete suspended-sediment concentration samples in the Neosho and Cottonwood Rivers, east-central Kansas, 2009-2012

    Science.gov (United States)

    Foster, Guy M.

    2014-01-01

    The Neosho River and its primary tributary, the Cottonwood River, are the primary sources of inflow to the John Redmond Reservoir in east-central Kansas. Sedimentation rate in the John Redmond Reservoir was estimated as 743 acre-feet per year for 1964–2006. This estimated sedimentation rate is more than 80 percent larger than the projected design sedimentation rate of 404 acre-feet per year, and resulted in a loss of 40 percent of the conservation pool since its construction in 1964. To reduce sediment input into the reservoir, the Kansas Water Office implemented stream bank stabilization techniques along an 8.3 mile reach of the Neosho River during 2010 through 2011. The U.S. Geological Survey, in cooperation with the Kansas Water Office and funded in part through the Kansas State Water Plan Fund, operated continuous real-time water-quality monitors upstream and downstream from stream bank stabilization efforts before, during, and after construction. Continuously measured water-quality properties include streamflow, specific conductance, water temperature, and turbidity. Discrete sediment samples were collected from June 2009 through September 2012 and analyzed for suspended-sediment concentration (SSC), percentage of sediments less than 63 micrometers (sand-fine break), and loss of material on ignition (analogous to amount of organic matter). Regression models were developed to establish relations between discretely measured SSC samples, and turbidity or streamflow to estimate continuously SSC. Continuous water-quality monitors represented between 96 and 99 percent of the cross-sectional variability for turbidity, and had slopes between 0.91 and 0.98. Because consistent bias was not observed, values from continuous water-quality monitors were considered representative of stream conditions. On average, turbidity-based SSC models explained 96 percent of the variance in SSC. Streamflow-based regressions explained 53 to 60 percent of the variance. Mean squared

  5. The Relationship between Insect Resistance and Tree Age of Transgenic Triploid Populus tomentosa Plants.

    Science.gov (United States)

    Ren, Yachao; Zhang, Jun; Wang, Guiying; Liu, Xiaojie; Li, Li; Wang, Jinmao; Yang, Minsheng

    2018-01-01

    To explore the stability of insect resistance during the development of transgenic insect-resistant trees, this study investigated how insect resistance changes as transgenic trees age. We selected 19 transgenic insect-resistant triploid Populus tomentosa lines as plant material. The presence of exogenous genes and Cry1Ac protein expression were verified using polymerase chain reaction (PCR) and enzyme-linked immunosorbent assay (ELISA) analyses. The toxicity for Clostera anachoreta and Lymantria dispar was evaluated by feeding fresh leaves to first instar larvae after the trees were planted in the field for 2 years and after the sixth year. Results of PCR showed that the exogenous genes had a long-term presence in the poplar genome. ELISA analyses showed significant differences existed on the 6-year-old transgenic lines. The insect-feeding experiment demonstrated significant differences in the mortality rates of C. anachoreta and L. dispar among different transgenic lines. The average corrected mortality rates of C. anachoreta and L. dispar ranged from 5.6-98.7% to 35.4-7.2% respectively. The larval mortality rates differed significantly between the lines at different ages. Up to 52.6% of 1-year-old transgenic lines and 42.1% of 2-year-old transgenic lines caused C. anachoreta larval mortality rates to exceed 80%, whereas only 26.3% of the 6-year-old transgenic lines. The mortality rates of L. dispar exhibited the same trend: 89.5% of 1-year-old transgenic lines and 84.2% of 2-year-old transgenic lines caused L. dispar larval mortality rates to exceed 80%; this number decreased to 63.2% for the 6-year-old plants. The proportion of 6-year-old trees with over 80% larval mortality rates was clearly lower than that of the younger trees. The death distribution of C. anachoreta in different developmental stages also showed the larvae that fed on the leaves of 1-year-old trees were killed mostly during L 1 and L 2 stages, whereas the proportion of larvae that died in L 3

  6. Elevated Rocky Mountain elk numbers prevent positive effects of fire on quaking aspen (Populus tremuloides) recruitment

    Science.gov (United States)

    Smith, David Solance; Fettig, Stephen M.; Bowker, Matthew A.

    2016-01-01

    Quaking aspen (Populus tremuloides) is the most widespread tree species in North America and has supported a unique ecosystem for tens of thousands of years, yet is currently threatened by dramatic loss and possible local extinctions. While multiple factors such as climate change and fire suppression are thought to contribute to aspen’s decline, increased browsing by elk (Cervus elaphus), which have experienced dramatic population increases in the last ∼80 years, may severely inhibit aspen growth and regeneration. Fires are known to favor aspen recovery, but in the last several decades the spatial scale and intensity of wildfires has greatly increased, with poorly understood ramifications for aspen growth. Here, focusing on the 2000 Cerro Grande fire in central New Mexico – one of the earliest fires described as a “mega-fire” - we use three methods to examine the impact of elk browsing on aspen regeneration after a mega-fire. First, we use an exclosure experiment to show that aspen growing in the absence of elk were 3× taller than trees growing in the presence of elk. Further, aspen that were both protected from elk and experienced burning were 8.5× taller than unburned trees growing in the presence of elk, suggesting that the combination of release from herbivores and stimulation from fire creates the largest aspen growth rates. Second, using surveys at the landscape level, we found a correlation between elk browsing intensity and aspen height, such that where elk browsing was highest, aspen were shortest. This relationship between elk browsing intensity and aspen height was stronger in burned (r = −0.53) compared to unburned (r = −0.24) areas. Third, in conjunction with the landscape-level surveys, we identified possible natural refugia, microsites containing downed logs, shrubs etc. that may inhibit elk browsing by physically blocking aspen from elk or by impeding elk’s ability to move through the forest patch. We did not find any

  7. Transcriptome responses to aluminum stress in roots of aspen (Populus tremula

    Directory of Open Access Journals (Sweden)

    Grisel Nadine

    2010-08-01

    Full Text Available Abstract Background Ionic aluminum (mainly Al3+ is rhizotoxic and can be present in acid soils at concentrations high enough to inhibit root growth. Many forest tree species grow naturally in acid soils and often tolerate high concentrations of Al. Previously, we have shown that aspen (Populus tremula releases citrate and oxalate from roots in response to Al exposure. To obtain further insights into the root responses of aspen to Al, we investigated root gene expression at Al conditions that inhibit root growth. Results Treatment of the aspen roots with 500 μM Al induced a strong inhibition of root growth within 6 h of exposure time. The root growth subsequently recovered, reaching growth rates comparable to that of control plants. Changes in gene expression were determined after 6 h, 2 d, and 10 d of Al exposure. Replicated transcriptome analyses using the Affymetrix poplar genome array revealed a total of 175 significantly up-regulated and 69 down-regulated genes, of which 70% could be annotated based on Arabidopsis genome resources. Between 6 h and 2 d, the number of responsive genes strongly decreased from 202 to 26, and then the number of changes remained low. The responses after 6 h were characterized by genes involved in cell wall modification, ion transport, and oxidative stress. Two genes with prolonged induction were closely related to the Arabidopsis Al tolerance genes ALS3 (for Al sensitive 3 and MATE (for multidrug and toxin efflux protein, mediating citrate efflux. Patterns of expression in different plant organs and in response to Al indicated that the two aspen genes are homologs of the Arabidopsis ALS3 and MATE. Conclusion Exposure of aspen roots to Al results in a rapid inhibition of root growth and a large change in root gene expression. The subsequent root growth recovery and the concomitant reduction in the number of responsive genes presumably reflect the success of the roots in activating Al tolerance mechanisms. The

  8. Molecular cloning and functional analysis of nine cinnamyl alcohol dehydrogenase family members in Populus tomentosa.

    Science.gov (United States)

    Chao, Nan; Liu, Shu-Xin; Liu, Bing-Mei; Li, Ning; Jiang, Xiang-Ning; Gai, Ying

    2014-11-01

    Nine CAD/CAD-like genes in P. tomentosa were classified into four classes based on expression patterns, phylogenetic analysis and biochemical properties with modification for the previous claim of SAD. Cinnamyl alcohol dehydrogenase (CAD) functions in monolignol biosynthesis and plays a critical role in wood development and defense. In this study, we isolated and cloned nine CAD/CAD-like genes in the Populus tomentosa genome. We investigated differential expression using microarray chips and found that PtoCAD1 was highly expressed in bud, root and vascular tissues (xylem and phloem) with the greatest expression in the root. Differential expression in tissues was demonstrated for PtoCAD3, PtoCAD6 and PtoCAD9. Biochemical analysis of purified PtoCADs in vitro indicated PtoCAD1, PtoCAD2 and PtoCAD8 had detectable activity against both coniferaldehyde and sinapaldehyde. PtoCAD1 used both substrates with high efficiency. PtoCAD2 showed no specific requirement for sinapaldehyde in spite of its high identity with so-called PtrSAD (sinapyl alcohol dehydrogenase). In addition, the enzymatic activity of PtoCAD1 and PtoCAD2 was affected by temperature. We classified these nine CAD/CAD-like genes into four classes: class I included PtoCAD1, which was a bone fide CAD with the highest activity; class II included PtoCAD2, -5, -7, -8, which might function in monolignol biosynthesis and defense; class III genes included PtoCAD3, -6, -9, which have a distinct expression pattern; class IV included PtoCAD12, which has a distinct structure. These data suggest divergence of the PtoCADs and its homologs, related to their functions. We propose genes in class II are a subset of CAD genes that evolved before angiosperms appeared. These results suggest CAD/CAD-like genes in classes I and II play a role in monolignol biosynthesis and contribute to our knowledge of lignin biosynthesis in P. tomentosa.

  9. Xylem diameter changes during osmotic stress, desiccation and freezing in Pinus sylvestris and Populus tremula.

    Science.gov (United States)

    Lintunen, Anna; Lindfors, Lauri; Nikinmaa, Eero; Hölttä, Teemu

    2017-04-01

    Trees experience low apoplastic water potential frequently in most environments. Low apoplastic water potential increases the risk of embolism formation in xylem conduits and creates dehydration stress for the living cells. We studied the magnitude and rate of xylem diameter change in response to decreasing apoplastic water potential and the role of living parenchyma cells in it to better understand xylem diameter changes in different environmental conditions. We compared responses of control and heat-injured xylem of Pinus sylvestris (L.) and Populus tremula (L.) branches to decreasing apoplastic water potential created by osmotic stress, desiccation and freezing. It was shown that xylem in control branches shrank more in response to decreasing apoplastic water potential in comparison with the samples that were preheated to damage living xylem parenchyma. By manipulating the osmotic pressure of the xylem sap, we observed xylem shrinkage due to decreasing apoplastic water potential even in the absence of water tension within the conduits. These results indicate that decreasing apoplastic water potential led to withdrawal of intracellular water from the xylem parenchyma, causing tissue shrinkage. The amount of xylem shrinkage per decrease in apoplastic water potential was higher during osmotic stress or desiccation compared with freezing. During desiccation, xylem diameter shrinkage involved both dehydration-related shrinkage of xylem parenchyma and water tension-induced shrinkage of conduits, whereas dehydration-related shrinkage of xylem parenchyma was accompanied by swelling of apoplastic ice during freezing. It was also shown that the exchange of water between symplast and apoplast within xylem is clearly faster than previously reported between the phloem and the xylem. Time constant of xylem shrinkage was 40 and 2 times higher during osmotic stress than during freezing stress in P. sylvestris and P. tremula, respectively. Finally, it was concluded that the

  10. The UDP-glucuronate decarboxylase gene family in Populus: structure, expression, and association genetics.

    Directory of Open Access Journals (Sweden)

    Qingzhang Du

    Full Text Available In woody crop plants, the oligosaccharide components of the cell wall are essential for important traits such as bioenergy content, growth, and structural wood properties. UDP-glucuronate decarboxylase (UXS is a key enzyme in the synthesis of UDP-xylose for the formation of xylans during cell wall biosynthesis. Here, we isolated a multigene family of seven members (PtUXS1-7 encoding UXS from Populus tomentosa, the first investigation of UXSs in a tree species. Analysis of gene structure and phylogeny showed that the PtUXS family could be divided into three groups (PtUXS1/4, PtUXS2/5, and PtUXS3/6/7, consistent with the tissue-specific expression patterns of each PtUXS. We further evaluated the functional consequences of nucleotide polymorphisms in PtUXS1. In total, 243 single-nucleotide polymorphisms (SNPs were identified, with a high frequency of SNPs (1/18 bp and nucleotide diversity (πT = 0.01033, θw = 0.01280. Linkage disequilibrium (LD analysis showed that LD did not extend over the entire gene (r (2<0.1, P<0.001, within 700 bp. SNP- and haplotype-based association analysis showed that nine SNPs (Q <0.10 and 12 haplotypes (P<0.05 were significantly associated with growth and wood property traits in the association population (426 individuals, with 2.70% to 12.37% of the phenotypic variation explained. Four significant single-marker associations (Q <0.10 were validated in a linkage mapping population of 1200 individuals. Also, RNA transcript accumulation varies among genotypic classes of SNP10 was further confirmed in the association population. This is the first comprehensive study of the UXS gene family in woody plants, and lays the foundation for genetic improvements of wood properties and growth in trees using genetic engineering or marker-assisted breeding.

  11. Expression and molecular evolution of two DREB1 genes in black poplar (Populus nigra.

    Directory of Open Access Journals (Sweden)

    Yanguang Chu

    Full Text Available Environmental stresses such as low temperature, drought, and high salinity significantly affect plant growth and yield. As selective forces, these adverse factors play essential roles in shaping phenotypic variation in plant populations. Black poplar (Populus nigra is an economically and ecologically important forest tree species with widely distributed populations and is thus suitable for experiments detecting evolutionary footprints left by stress. Here, we performed expression and evolutionary analysis of two duplicated DREB A1-subgroup (DREB1 genes, PnDREB68 and PnDREB69, encoding transcription factors that are involved in stress responses. The two genes showed partially overlapping but distinct expression patterns in response to stresses. These genes were strongly and rapidly induced by cold stress in leaves, stems, and roots. In leaf tissue, dehydration stress induced the expression of PnDREB68 but not PnDREB69. PnDREB69 displayed more rapid responses and longer expression durations than PnDREB68 under salt and ABA stress, respectively. Based on single nucleotide polymorphism (SNP analysis, we found significant population genetic differentiation, with a greater FST value (0.09189 for PnDREB69 than for PnDREB68 (0.07743. Nucleotide diversity analysis revealed a two-fold higher πT for PnDREB68 than for PnDREB69 (0.00563 vs. 0.00243, reflecting strong purifying selection acting on the former. The results suggest that positive selection acted on PnDREB69, as evidenced by neutral testing using Tajima's D statistic. The distinct selective forces to which each of the genes was subjected may be associated with expression divergence. Linkage disequilibrium (LD was low for the sequenced region, with a higher level for PnDREB68 than for PnDREB69. Additionally, analysis of the relationship among carbon isotope ratios, SNP classes and gene expression, together with motif and domain analysis, suggested that 14 polymorphisms within the two genes may be

  12. Environmental Assessment for the Aeromedical Evacuation Formal Training Unit, Wright-Patterson Air Force Base

    Science.gov (United States)

    2012-05-01

    pennsylvanica), White Ash (Fraxinus americana), Shingle Oak (Quercus imbricaria), Northern Red Oak (Quercus rubra), Slippery Elm (Ulmus rubra...American Elm (Ulmus americana), Eastern Cottonwood (Populus deltoides), Silver Maple (Acer saccharinum), Sassafras (Sassafras albidum), Post Oak (Quercus

  13. [A review of the genomic and gene cloning studies in trees].

    Science.gov (United States)

    Yin, Tong-Ming

    2010-07-01

    Supported by the Department of Energy (DOE) of U.S., the first tree genome, black cottonwood (Populus trichocarpa), has been completely sequenced and publicly release. This is the milestone that indicates the beginning of post-genome era for forest trees. Identification and cloning genes underlying important traits are one of the main tasks for the post-genome-era tree genomic studies. Recently, great achievements have been made in cloning genes coordinating important domestication traits in some crops, such as rice, tomato, maize and so on. Molecular breeding has been applied in the practical breeding programs for many crops. By contrast, molecular studies in trees are lagging behind. Trees possess some characteristics that make them as difficult organisms for studying on locating and cloning of genes. With the advances in techniques, given also the fast growth of tree genomic resources, great achievements are desirable in cloning unknown genes from trees, which will facilitate tree improvement programs by means of molecular breeding. In this paper, the author reviewed the progress in tree genomic and gene cloning studies, and prospected the future achievements in order to provide a useful reference for researchers working in this area.

  14. Black poplar-tree (Populus nigra L.) bark as an alternative indicator of urban air pollution by chemical elements

    International Nuclear Information System (INIS)

    Berlizov, A.N.; Malyuk, I.A.; Tryshyn, V.V.

    2008-01-01

    Capabilities of black poplar-tree (Populus nigra L.) bark as a biomonitor of atmospheric air pollution by chemical elements were tested against epiphytic lichens Xanthoria parietina (L.) and Physcia adscendens (Fr.). Concentrations of 40 macro and trace elements were determined using epicadmium and instrumental NAA. The data obtained were processed using non-parametric tests. A good correlation was found between concentrations of majority of elements in bark and lichens. On the accumulation capability bark turned out to be competitive with both lichens examined. The main inorganic components of black poplar-tree bark were revealed. A substrate influence on the concentrations of some elements in epiphytic lichens was established. An optimized procedure of bark pre-irradiation treatment was suggested. (author)

  15. Association of Pinus banksiana Lamb. and Populus tremuloides Michx. seedling fine roots with Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina).

    Science.gov (United States)

    Potvin, Lynette R; Richter, Dana L; Jurgensen, Martin F; Dumroese, R Kasten

    2012-11-01

    Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina, Hydanaceae), commonly regarded as a wood decay fungus, was consistently isolated from bareroot nursery Pinus banksiana Lamb. seedlings. S. brinkmannii was found in ectomycorrhizae formed by Thelephora terrestris Ehrh., Laccaria laccata (Scop.) Cooke, and Suillus luteus (L.) Roussel. In pure culture combinations with sterile P. banksiana and Populus tremuloides Michx. seedlings, S. brinkmannii colonized root cortical cells while not killing seedlings. Colonization by S. brinkmannii appeared to be intracellular but typical endo- or ectomycorrhizae were not formed. The fungus did not decay roots, although it was shown to produce cellulase in enzyme tests. Results suggest a unique association between S. brinkmannii and seedling roots that is neither mycorrhizal nor detrimental; its exact function remains to be elucidated.

  16. Evaluation of Internal Cracks and Collapse in Poplar Wood (Populus nigra during a Conventional Drying Process with Ultrasonic Inspection

    Directory of Open Access Journals (Sweden)

    Saeid ESHAGHI

    2012-05-01

    Full Text Available In this research, internal cracks and collapse of wood, formed during drying process, were measured using ultrasonic inspection. For this purpose, seven poplar (Populus nigra small blocks were dried, according to a time-based schedule. Ultrasonic waves� propagation velocity was measured at both parallel and perpendicular to grain directions, using Sylvatest ultrasound device, during kiln drying process. Results showed that in all dried blocks, waves� propagation velocity in the parallel direction was higher than in the perpendicular direction to grain. Ultrasonic waves� propagation test for non-destructive identification of internal cracks, which occurs in wood during drying process in the parallel direction, was more successful compared to the perpendicular direction. Using ultrasonic waves� propagation test for detection of collapse that occurs in wood during drying process was not useful.

  17. Evaluation of Internal Cracks and Collapse in Poplar Wood (Populus nigra during a Conventional Drying Process with Ultrasonic Inspection

    Directory of Open Access Journals (Sweden)

    Saeid ESHAGHI

    2012-05-01

    Full Text Available In this research, internal cracks and collapse of wood, formed during drying process, were measured using ultrasonic inspection. For this purpose, seven poplar (Populus nigra small blocks were dried, according to a time-based schedule. Ultrasonic waves propagation velocity was measured at both parallel and perpendicular to grain directions, using Sylvatest ultrasound device, during kiln drying process. Results showed that in all dried blocks, waves propagation velocity in the parallel direction was higher than in the perpendicular direction to grain. Ultrasonic waves propagation test for non-destructive identification of internal cracks, which occurs in wood during drying process in the parallel direction, was more successful compared to the perpendicular direction. Using ultrasonic waves propagation test for detection of collapse that occurs in wood during drying process was not useful.

  18. Stem anatomy variation in cottonwood

    Science.gov (United States)

    A.N. Foulger; J. Hacskaylo

    1968-01-01

    Investigations of mineral nutrient-tree growth relationships have dealt mainly with associations involving foliage composition, root formation, or volume production of wood. Few studies have been concerned with changes in wood anatomy associated with element deficiency. In 1949 Davis reported that calcium deficiency was accompanied by a reduction of primary tissue and...

  19. Structure and diversity of ground mesofauna inUlmus and Populus consortia in the industrial areas of mining and smelting complex of krivyi rig basin

    Directory of Open Access Journals (Sweden)

    V. V. Kachinskaya

    2010-05-01

    Full Text Available The structure and biological diversity of ground mesofauna on a consortium level of organisation of ecosystems are considered. Indicators of structural organisation and biodiversity of ground mesofauna were analised in Ulmus and Populus consortia in the conditions of industrial territories of mining and smelting complex of Krivyi Rig Basin. It is established that taxonomical structure of ground mesofauna is characterised by insignificant number and quantity of taxonomical groups. Prevalence of hortobionts and herpetobionts in morpho-ecological structure of the community testifies to their attachment to consortium’s determinants and influence of steppe climate on its structure. Dominance of phytophages and polyphages in trophic structure is caused by a combination of consortium determinants specificity and «a zone source» of the fauna formations. The structural organisation of ground mesofauna in consortia of Ulmus and Populus in the conditions of industrial sites is characterised by simplified taxonomical structure with low biodiversity at all levels.

  20. Examination of correlation between histidine and nickel absorption by Morus L., Robinia pseudoacacia L. and Populus nigra L. using HPLC-MS and ICP-MS.

    Science.gov (United States)

    Ozen, Sukran Akkus; Yaman, Mehmet

    2016-08-02

    In this study, HPLC-MS and ICP-MS methods were used for the determination of histidine and nickel in Morus L., Robinia pseudoacacia L., and Populus nigra L. leaves taken from industrial areas including Gaziantep and Bursa cities. In the determination of histidine by HPLC-MS, all of the system parameters such as flow rate of mobile phase, fragmentor potential, injection volume and column temperature were optimized and found to be 0.2 mL min(-1), 70 V, 15 µL, and 20°C, respectively. Under the optimum conditions, histidine was extracted from plant sample by distilled water at 90°C for 30 min. Concentrations of histidine as mg kg(-1) were found to be between 2-9 for Morus L., 6-13 for Robinia pseudoacacia L., and 2-10 for Populus nigra L. Concentrations of nickel were in the ranges of 5-10 mg kg(-1) for Morus L., 3-10 mg kg(-1) for Robinia pseudoacacia L., and 0.6-4 mg kg(-1) for Populus nigra L. A significant linear correlation (r = 0.78) between histidine and Ni was observed for Populus nigra L., whereas insignificant linear correlation for Robinia pseudoacacia L. (r = 0.22) were seen. Limits of detection (LOD) and quantitation (LOQ) were found to be 0.025 mg Ni L(-1) and 0.075 mg Ni L(-1), respectively.

  1. IAA oxidase activity in relation to adventitious root formation on stem cuttings of some forest tree species. [Salix tetrasperma, Populus Robusta, Hibiscus rosa-sinensis, Eucalyptus citriodora

    Energy Technology Data Exchange (ETDEWEB)

    Bansal, M.P.; Nanda, K.K.

    1981-01-01

    In rooting tests with stem cuttings, IAA oxidase activity was found to be very high in Salix tetrasperma and Populus 'Robusta' both of which rooted profusely, less in Hibiscus rosa-sinensis which rooted but weakly and insignificant in Eucalyptus citriodora, which did not root at all. Proteins extracted from the stem cuttings of E. citriodora inhibited IAA oxidase activity, and also root formation on hypocotyl cuttings of Phaseolus mungo.

  2. Group Self-Definitions and Religious Collectivities in the 16th Book of the Theodosian Code. Notes on the Term coetus (with a Preliminary Analysis of populus

    Directory of Open Access Journals (Sweden)

    Alessandro Saggioro

    2015-06-01

    Full Text Available This essay starts from the well-known definition of populus as well as it appears in some Cicero’s works and aims at analyze the religious significance of coetus, a term strictly connected with the first, at least focusing on the 16th book of the Theodosian Code. This article intends to cast light some transformations and representations of religious groups between Constantinian and Post-Constantinian ages.

  3. The differential response of photosynthesis to high temperature for a boreal and temperate Populus species relates to differences in Rubisco activation and Rubisco activase properties.

    Science.gov (United States)

    Hozain, Moh'd I; Salvucci, Michael E; Fokar, Mohamed; Holaday, A Scott

    2010-01-01

    Significant inhibition of photosynthesis occurs at temperatures only a few degrees (Populus species adapted to contrasting thermal environments for determining the factors that constrain photosynthetic assimilation (A) under moderate heat stress in tree species. Consistent with its native range in temperate regions, Populus deltoides Bartr. ex Marsh. exhibited a significantly higher temperature optimum for A than did Populus balsamifera L., a boreal species. The higher A exhibited by P. deltoides at 33-40 degrees C compared to that for P. balsamifera was associated with a higher activation state of Rubisco and correlated with a higher ATPase activity of Rubisco activase. The temperature response of minimal chlorophyll a fluorescence for darkened leaves was similar for both species and was not consistent with a thylakoid lipid phase change contributing to the decline in A in the range of 30-40 degrees C. Taken together, these data support the idea that the differences in the temperature response of A for the two Populus species could be attributed to the differences in the response of Rubisco activation and ultimately to the thermal properties of Rubisco activase. That the primary sequence of Rubisco activase differed between the species, especially in regions associated with ATPase activity and Rubisco recognition, indicates that the genotypic differences in Rubisco activase might underlie the differences in the heat sensitivity of Rubisco activase and photosynthesis at moderately high temperatures.

  4. Growth CO{sub 2} concentration modifies the transpiration response of Populus deltoides to drought and vapor pressure deficit

    Energy Technology Data Exchange (ETDEWEB)

    Engel, V. C. [South Florida Natural Resources Center, Everglades National Park, Homestead, FL (United States); Griffin, K. L. [Columbia University, Lamont-Doherty Earth Observatory, Palisades, NY (United States); Murthy, R.; Patterson, L.; Klimas, C. [Columbia University, Biosphere 2 Center, Oracle, AZ (United States); Potosnak, M. [National Center for Atmospheric Research, Boulder, CO (United States)

    2004-10-01

    To gain a better understanding of the hydraulic constraints on transpiration, altered canopy water relations in response to elevated carbon dioxide was evaluated in a morphological context. It was expected that by integrating the information gained into predictive models of canopy water balance in elevated carbon dioxide, our understanding of leaf-level responses to drought stresses and evaporative demand will also improve. To achieve these objectives, transpiration rates and leaf-to-sapwood area ratios in clonal stands of cottonwoods grown in near-ambient and elevated carbon dioxide were measured at the Biosphere 2 facility near Oracle, Arizona. Results were interpreted in terms of physical controls versus the direct and indirect effects of growth mediated by morphological changes on transpiration fluxes during periods of drought and high evaporative demand. Leaf-level transpiration rates were found to be nearly equivalent across carbon dioxide treatments when soil water was not limited. However, during drought stress, canopy-level transpiration was roughly equivalent across carbon dioxide treatments, but leaf-level fluxes were reduced in elevated carbon dioxide by a factor equal to the leaf area ratio of the canopies. This shift from equivalent leaf-level transpiration to equivalent canopy-level transpiration with increasing drought stress is taken to mean that maximum water use rates are controlled by atmospheric demand at high soil water content and by soil water availability at low soil water content. Changes in vapor pressure deficits had less pronounced effect on transpiration than changes in soil water content. 37 refs., 3 tabs., 5 figs.

  5. Growth CO2 concentration modifies the transpiration response of Populus deltoides to drought and vapor pressure deficit

    International Nuclear Information System (INIS)

    Engel, V. C.; Griffin, K. L.; Murthy, R.; Patterson, L.; Klimas, C.; Potosnak, M.

    2004-01-01

    To gain a better understanding of the hydraulic constraints on transpiration, altered canopy water relations in response to elevated carbon dioxide was evaluated in a morphological context. It was expected that by integrating the information gained into predictive models of canopy water balance in elevated carbon dioxide, our understanding of leaf-level responses to drought stresses and evaporative demand will also improve. To achieve these objectives, transpiration rates and leaf-to-sapwood area ratios in clonal stands of cottonwoods grown in near-ambient and elevated carbon dioxide were measured at the Biosphere 2 facility near Oracle, Arizona. Results were interpreted in terms of physical controls versus the direct and indirect effects of growth mediated by morphological changes on transpiration fluxes during periods of drought and high evaporative demand. Leaf-level transpiration rates were found to be nearly equivalent across carbon dioxide treatments when soil water was not limited. However, during drought stress, canopy-level transpiration was roughly equivalent across carbon dioxide treatments, but leaf-level fluxes were reduced in elevated carbon dioxide by a factor equal to the leaf area ratio of the canopies. This shift from equivalent leaf-level transpiration to equivalent canopy-level transpiration with increasing drought stress is taken to mean that maximum water use rates are controlled by atmospheric demand at high soil water content and by soil water availability at low soil water content. Changes in vapor pressure deficits had less pronounced effect on transpiration than changes in soil water content. 37 refs., 3 tabs., 5 figs

  6. Transpirational water loss in invaded and restored semiarid riparian forests

    Science.gov (United States)

    Georgianne W. Moore; M. Keith Owens

    2011-01-01

    The invasive tree, Tamarix sp., was introduced to the United States in the 1800s to stabilize stream banks. The riparian ecosystem adjacent to the middle Rio Grande River in central NewMexico consists of mature cottonwood (Populus fremontii ) gallery forests with a dense Tamarix understory. We hypothesized that Populus would compensate for reduced competition by...

  7. Cloning of the cryptochrome-encoding PeCRY1 gene from Populus euphratica and functional analysis in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Ke Mao

    Full Text Available Cryptochromes are photolyase-like blue/UV-A light receptors that evolved from photolyases. In plants, cryptochromes regulate various aspects of plant growth and development. Despite of their involvement in the control of important plant traits, however, most studies on cryptochromes have focused on lower plants and herbaceous crops, and no data on cryptochrome function are available for forest trees. In this study, we isolated a cryptochrome gene, PeCRY1, from Euphrates poplar (Populus euphratica, and analyzed its structure and function in detail. The deduced PeCRY1 amino acid sequence contained a conserved N-terminal photolyase-homologous region (PHR domain as well as a C-terminal DQXVP-acidic-STAES (DAS domain. Secondary and tertiary structure analysis showed that PeCRY1 shares high similarity with AtCRY1 from Arabidopsis thaliana. PeCRY1 expression was upregulated at the mRNA level by light. Using heterologous expression in Arabidopsis, we showed that PeCRY1 overexpression rescued the cry1 mutant phenotype. In addition, PeCRY1 overexpression inhibited hypocotyl elongation, promoted root growth, and enhanced anthocyanin accumulation in wild-type background seedlings grown under blue light. Furthermore, we examined the interaction between PeCRY1 and AtCOP1 using a bimolecular fluorescence complementation (BiFc assay. Our data provide evidence for the involvement of PeCRY1 in the control of photomorphogenesis in poplar.

  8. [Hydraulic limitation on photosynthetic rate of old Populus simonii trees in sandy soil of north Shaanxi Province].

    Science.gov (United States)

    Zuo, Li-Xiang; Li, Yang-Yang; Chen, Jia-Cun

    2014-06-01

    'Old and dwarf trees' on the loess plateau region mainly occurred among mature trees rather than among small trees. To elucidate the mechanism of tree age on 'old and dwarf trees' formation, taking Populus simonii, a tree species that accounted for the largest portion of 'old and dwarf trees' on the loess plateau, as an example, the growth, photosynthesis and hydraulic traits of P. simonii trees with different ages (young: 13-15 years, mid-aged: 31-34 years, and old: 49-54 years) were measured. The results showed that the dieback length increased, and net photosynthetic rate, stomatal conductance, transpiration rate, and whole plant hydraulic conductance decreased significantly with the increasing tree age. Both net photosynthetic rate and stomatal conductance measured at different dates were significantly and positively related to the whole plant hydraulic conductance, suggesting that the decreasing photosynthetic rate of old trees was possibly caused by the declined hydraulic conductance. Although the resistance to cavitation in stems and leaves was stronger in old trees than in young and mid-aged trees, there were no differences in midday native stem embolization degree and leaf hydraulic conductance based on the vulnerability curve estimation, suggesting that the increased hydraulic resistance of the soil-root system is probably the most important reason for decreasing the whole plant hydraulic conductance of old trees.

  9. Rooting of hybrid clones of Populus tremula L. x P. tremuloides Michx. by stem cuttings derived from micropropagated plants

    Energy Technology Data Exchange (ETDEWEB)

    Qibin Yu [Univ. of Helsinki (Finland). Dept. of Plant Biology; Maentylae, N. [Univ. of Turku (Finland). Dept. of Biology, Plant Physiology and Molecular Biology; Salonen, M. [Finnish Forest Research Inst., Laeyliaeinen (Finland). Haapastensyrjae Breeding Station

    2001-07-01

    Propagation costs could be cut by replacing part of the micropropagation process with steps involving more traditional techniques. This study explored possibilities for improving existing vegetative propagation techniques for aspen using stem cuttings obtained from micropropagated plants. Vegetative propagation through stem cuttings was studied in 10 micropropagated hybrid aspen clones (Populus tremula L. x P. tremuloides Michx). Cuttings containing one axillary bud were harvested from the same donor plants twice during the growing season: the first harvest in May and the second harvest in July. Rooting percentage was correlated positively with root length, number of roots and height of cutting plant but negatively with length of rooting. The average rooting percentage was 53% in the first harvest and 27% in second harvest. Indole-3-butyric acid treatments (1.2 mM) significantly improved rooting in the second harvest, but not in the first harvest, suggesting different endogenous auxin levels in the cuttings. A significant variation for most traits related to rooting ability was found among the clones, indicating that clonal effects play an important role in the propagation of aspen. Thus, clones with a good response in shoot growth and rooting could be exploited in large-scale propagation using stem cuttings.

  10. Identifying gene coexpression networks underlying the dynamic regulation of wood-forming tissues in Populus under diverse environmental conditions.

    Science.gov (United States)

    Zinkgraf, Matthew; Liu, Lijun; Groover, Andrew; Filkov, Vladimir

    2017-06-01

    Trees modify wood formation through integration of environmental and developmental signals in complex but poorly defined transcriptional networks, allowing trees to produce woody tissues appropriate to diverse environmental conditions. In order to identify relationships among genes expressed during wood formation, we integrated data from new and publically available datasets in Populus. These datasets were generated from woody tissue and include transcriptome profiling, transcription factor binding, DNA accessibility and genome-wide association mapping experiments. Coexpression modules were calculated, each of which contains genes showing similar expression patterns across experimental conditions, genotypes and treatments. Conserved gene coexpression modules (four modules totaling 8398 genes) were identified that were highly preserved across diverse environmental conditions and genetic backgrounds. Functional annotations as well as correlations with specific experimental treatments associated individual conserved modules with distinct biological processes underlying wood formation, such as cell-wall biosynthesis, meristem development and epigenetic pathways. Module genes were also enriched for DNase I hypersensitivity footprints and binding from four transcription factors associated with wood formation. The conserved modules are excellent candidates for modeling core developmental pathways common to wood formation in diverse environments and genotypes, and serve as testbeds for hypothesis generation and testing for future studies. No claim to original US government works. New Phytologist © 2017 New Phytologist Trust.

  11. Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf,Stem and Root Dark Respiration of Populus tremuloides

    Institute of Scientific and Technical Information of China (English)

    X.Z.WANG; P.S.CURTIS; 等

    2001-01-01

    An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston,Michigan,USA,to study the effects of soil fertility and CO2 on leaf,sdtem and root dark respiration (Rd) of Populus tremuloides.Overall,area-based daytime leaf Rd(Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil,but not in low-fertility soil.Mass-based leaf Rd(Rdm) was overall greater for high-than for low-fertility soil grown trees at elevated,but not at ambient CO2 .Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2,nor was stem Rda ,which ranged from 1.0 to 1.4μmol m-2s-1 in the spring and 3.5 to 4.5μmol m-2s-1 in the summer.Root Rda was significantly higher in high-than in low-fertiliy soil,but was unaffected by CO2.Since biomass production of P.tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged,we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2.Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

  12. Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf, Stem and Root Dark Respiration of Populus tremuloides

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston, Michigan, USA, to study the effects of soil fertility and CO2 on leaf, stem and root dark respiration (Rd) of Populus tremuloides. Overall, area-based daytime leaf Rd (Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil, but not in low-fertility soil. Mass-based leaf Rd (Rdm) was overall greater for high- than for low-fertility soil grown trees at elevated, but not at ambient CO2. Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2, nor was stem Rda, which ranged from 1.0 to 1.4 μmol m-2 s-1 in the spring and 3.5 to 4.5 μmol m-2 s-1 in the summer. Root Rda was significantly higher in high- than in low-fertility soil, but was unaffected by CO2. Since biomass production of P. tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged, we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2. Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

  13. Ethylene and jasmonic acid act as negative modulators during mutualistic symbiosis between Laccaria bicolor and Populus roots.

    Science.gov (United States)

    Plett, Jonathan M; Khachane, Amit; Ouassou, Malika; Sundberg, Björn; Kohler, Annegret; Martin, Francis

    2014-04-01

    The plant hormones ethylene, jasmonic acid and salicylic acid have interconnecting roles during the response of plant tissues to mutualistic and pathogenic symbionts. We used morphological studies of transgenic- or hormone-treated Populus roots as well as whole-genome oligoarrays to examine how these hormones affect root colonization by the mutualistic ectomycorrhizal fungus Laccaria bicolor S238N. We found that genes regulated by ethylene, jasmonic acid and salicylic acid were regulated in the late stages of the interaction between L. bicolor and poplar. Both ethylene and jasmonic acid treatments were found to impede fungal colonization of roots, and this effect was correlated to an increase in the expression of certain transcription factors (e.g. ETHYLENE RESPONSE FACTOR1) and a decrease in the expression of genes associated with microbial perception and cell wall modification. Further, we found that ethylene and jasmonic acid showed extensive transcriptional cross-talk, cross-talk that was opposed by salicylic acid signaling. We conclude that ethylene and jasmonic acid pathways are induced late in the colonization of root tissues in order to limit fungal growth within roots. This induction is probably an adaptive response by the plant such that its growth and vigor are not compromised by the fungus. © 2013 The Authors New Phytologist © 2013 New Phytologist Trust.

  14. Alfa analysis of genetic diversity in populus cathayana rehd originating from south eastern Qinghai-Tibetan plateau of China

    International Nuclear Information System (INIS)

    Chen, K.; Peng, Y.

    2010-01-01

    The wide geographical and climatic distribution of Populus cathayana Rehd indicates that there is a large amount of genetic diversity available, which can be exploited for conservation, breeding programs and afforestation schemes. In our study, genetic diversity was evaluated in the natural populations of P. cathayana originating from southern and eastern areas of the Qinghai-Tibetan Plateau of China by means of AFLP markers. For four primer combinations, a total of 175 bands were obtained of which 173 (98.9%) were polymorphic. Six natural populations of P. cathayana possessed different levels of genetic diversity, high level of genetic differentiation existed among the populations (G/sub st) =0.489) of P. cathayana. Individuals cluster and PCO analysis based on Jaccards's similarity coefficient also showed evident population genetic structure with high level of population genetic differentiation. The long evolutionary process coupled with genetic drift within populations, rather than contemporary gene flow, are the major forces shaping genetic structure of P. cathayana populations. Moreover, there was no correspondence between geographical and genetic distances in the populations of P. cathayana, seldom gene exchange among the populations and different selection pressures may be the causes. Our findings of different levels of genetic diversity within populations and high level of genetic differentiation among the populations provided promising condition for further breeding and conservation programs. (author)

  15. Sex-specific responses to winter flooding, spring waterlogging and post-flooding recovery in Populus deltoides.

    Science.gov (United States)

    Miao, Ling-Feng; Yang, Fan; Han, Chun-Yu; Pu, Yu-Jin; Ding, Yang; Zhang, Li-Jia

    2017-05-31

    Winter flooding events are common in some rivers and streams due to dam constructions, and flooding and waterlogging inhibit the growth of trees in riparian zones. This study investigated sex-specific morphological, physiological and ultrastructural responses to various durations of winter flooding and spring waterlogging stresses, and post-flooding recovery characteristics in Populus deltoides. There were no significant differences in the morphological, ultrastructural and the majority of physiological traits in trees subjected to medium and severe winter flooding stresses, suggesting that males and females of P. deltoides were winter flooding tolerant, and insensitive to winter flooding duration. Males were more tolerant to winter flooding stress in terms of photosynthesis and chlorophyll fluorescence than females. Females displayed greater oxidative damage due to flooding stress than males. Males developed more efficient antioxidant enzymatic systems to control reactive oxygen species. Both sexes had similarly strong post-flooding recovery capabilities in terms of plant growth, and physiological and ultrastructural parameters. However, Males had better recovery capabilities in terms of pigment content. These results increase the understanding of poplars's adaptation to winter flooding stress. They also elucidate sex-specific differences in response to flooding stress during the dormant season, and during post-flooding recovery periods.

  16. [Spatiotemporal variation of Populus euphratica's radial increment at lower reaches of Tarim River after ecological water transfer].

    Science.gov (United States)

    An, Hong-Yan; Xu, Hai-Liang; Ye, Mao; Yu, Pu-Ji; Gong, Jun-Jun

    2011-01-01

    Taking the Populus euphratica at lower reaches of Tarim River as test object, and by the methods of tree dendrohydrology, this paper studied the spatiotemporal variation of P. euphratic' s branch radial increment after ecological water transfer. There was a significant difference in the mean radial increment before and after ecological water transfer. The radial increment after the eco-water transfer was increased by 125%, compared with that before the water transfer. During the period of ecological water transfer, the radial increment was increased with increasing water transfer quantity, and there was a positive correlation between the annual radial increment and the total water transfer quantity (R2 = 0.394), suggesting that the radial increment of P. euphratica could be taken as the performance indicator of ecological water transfer. After the ecological water transfer, the radial increment changed greatly with the distance to the River, i.e. , decreased significantly along with the increasing distance to the River (P = 0.007). The P. euphratic' s branch radial increment also differed with stream segment (P = 0.017 ), i.e. , the closer to the head-water point (Daxihaizi Reservoir), the greater the branch radial increment. It was considered that the limited effect of the current ecological water transfer could scarcely change the continually deteriorating situation of the lower reaches of Tarim River.

  17. The genetic architecture of shoot-root covariation during seedling emergence of a desert tree, Populus euphratica.

    Science.gov (United States)

    Zhang, Miaomiao; Bo, Wenhao; Xu, Fang; Li, Huan; Ye, Meixia; Jiang, Libo; Shi, Chaozhong; Fu, Yaru; Zhao, Guomiao; Huang, Yuejiao; Gosik, Kirk; Liang, Dan; Wu, Rongling

    2017-06-01

    The coordination of shoots and roots is critical for plants to adapt to changing environments by fine-tuning energy production in leaves and the availability of water and nutrients from roots. To understand the genetic architecture of how these two organs covary during developmental ontogeny, we conducted a mapping experiment using Euphrates poplar (Populus euphratica), a so-called hero tree able to grow in the desert. We geminated intraspecific F 1 seeds of Euphrates Poplar individually in a tube to obtain a total of 370 seedlings, whose shoot and taproot lengths were measured repeatedly during the early stage of growth. By fitting a growth equation, we estimated asymptotic growth, relative growth rate, the timing of inflection point and duration of linear growth for both shoot and taproot growth. Treating these heterochronic parameters as phenotypes, a univariate mapping model detected 19 heterochronic quantitative trait loci (hQTLs), of which 15 mediate the forms of shoot growth and four mediate taproot growth. A bivariate mapping model identified 11 pleiotropic hQTLs that determine the covariation of shoot and taproot growth. Most QTLs detected reside within the region of candidate genes with various functions, thus confirming their roles in the biochemical processes underlying plant growth. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

  18. Scientific Basis for Sustainable Management of Eucalyptus and Populus as Short-Rotation Woody Crops in the U.S.

    Directory of Open Access Journals (Sweden)

    Eric D. Vance

    2014-05-01

    Full Text Available Short rotation woody crops (SRWC, fast growing tree species that are harvested on short, repeated intervals, can augment traditional fiber sources. These crops have economic and environmental benefits stemming from their capability of supplying fiber on a reduced land base in close proximity to users and when sensitive sites cannot be accessed. Eucalyptus and Populus appear to be genera with the greatest potential to provide supplemental fiber in the U.S. Optimal productivity can be achieved through practices that overcome site limitations and by choosing the most appropriate sites, species, and clones. Some Eucalyptus species are potentially invasive, yet field studies across multiple continents suggest they are slower to disperse than predicted by risk assessments. Some studies have found lower plant and animal diversity in SRWC systems compared to mature, native forests, but greater than some alterative land uses and strongly influenced by stand management, land use history, and landscape context. Eucalyptus established in place of grasslands, arable lands, and, in some cases, native forests can reduce streamflow and lower water tables due to higher interception and transpiration rates but results vary widely, are scale dependent, and are most evident in drier regions.

  19. Nutrient concentrations in coarse and fine woody debris of Populus tremuloides Michx.-dominated forests, northern Minnesota, USA

    Science.gov (United States)

    Klockow, Paul A.; D'Amato, Anthony W.; Bradford, John B.; Fraver, Shawn

    2014-01-01

    Contemporary forest harvesting practices, specifically harvesting woody biomass as a source of bioenergy feedstock, may remove more woody debris from a site than conventional harvesting. Woody debris, particularly smaller diameter woody debris, plays a key role in maintaining ecosystem nutrient stores following disturbance. Understanding nutrient concentrations within woody debris is necessary for assessing the long-term nutrient balance consequences of altered woody debris retention, particularly in forests slated for use as bioenergy feedstocks. Nutrient concentrations in downed woody debris of various sizes, decay classes, and species were characterized within one such forest type, Populus tremuloides Michx.-dominated forests of northern Minnesota, USA. Nutrient concentrations differed significantly between size and decay classes and generally increased as decay progressed. Fine woody debris (≤ 7.5 cm diameter) had higher nutrient concentrations than coarse woody debris (> 7.5 cm diameter) for all nutrients examined except Na and Mn, and nutrient concentrations varied among species. Concentrations of N, Mn, Al, Fe, and Zn in coarse woody debris increased between one and three orders of magnitude, while K decreased by an order of magnitude with progressing decay. The variations in nutrient concentrations observed here underscore the complexity of woody debris nutrient stores in forested ecosystems and suggest that retaining fine woody debris at harvest may provide a potentially important source of nutrients following intensive removals of bioenergy feedstocks.

  20. Litter Quality of Populus Species as Affected by Free-Air CO2 Enrichment and N-Fertilization

    International Nuclear Information System (INIS)

    Vermue, E.; Buurman, P.; Hoosbeek, M.R.

    2010-01-01

    The effect of elevated CO 2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher contents of phenols and benzofurans/pyrans. The difference between replications was at least as large as the effect of treatments, so that no systematic chemical changes were attributable to CO 2 effect or N-fertilization effect. The chemistry of SOM under the various species and treatments did not show significant changes either. The low number of available replicates that is two was clearly insufficient to overcome the effect of spatial variation on litter chemistry and detect small differences in molecular litter chemistry.

  1. Stem respiration of Populus species in the third year of free-air CO{sub 2} enrichment

    Energy Technology Data Exchange (ETDEWEB)

    Bielen, B.; Geulemans, R. [Univ. of Antwerp, Dept. of Biology, Research Group of Plant and Vegetation Ecology, Wilrijk (Belgium); Scarascia-Mugnozza, G. [Univ. degli Studi della Tuscia, Dept. of Forest Environment and Resources, Viterbo (Italy)

    2003-04-01

    Carbon cycling in ecosystems, and especially in forests, is intensively studied to predict the effects of global climate change, and the role which forests may play in 'changing climate change'. One of the questions is whether the carbon balance of forests will be affected by increasing atmospheric CO{sub 2} concentrations. Regarding this question, effects of elevated [CO{sub 2}] on woody-tissue respiration have frequently been neglected. Stem respiration of three Populus species (P. alba L. (Clone 2AS-11), P. nigra L. (Clone Jean Pourtet), and P. x euramericana (Clone I-214)) was measured in a managed, high-density forest plantation exposed to free-air CO{sub 2} enrichment (POPFACE). During the period of measurements, in May of the third year, stem respiration rates were not affected by the FACE treatment. Moreover, FACE did not influence the relationships between respiration rate and both stem temperature and relative growth rate. The results were supported by the reported absence of a FACE-effect on growth and stem wood density. (au)

  2. Identification of proteins from cambium tissues of the chinese white poplar (populus tomentosa) sampled during the growing season

    International Nuclear Information System (INIS)

    Xie, J.; Liu, S.; Qi, Q.; Hou, Y.

    2014-01-01

    Various protein extraction methods have been used to investigate Chinese white poplar (Populus tomentosa) proteomics. However, extracting and characterizing proteins from woody plants remains a challenge. Two-dimensional gel electrophoresis is a powerful, widely used method for the analysis of complex protein mixtures extracted from biological samples. The technique separates mixtures of proteins along two dimensions, by isoelectric point and molecular weight, and can resolve thousands of different proteins. Here, we report a new application of two-dimensional gel electrophoresis to investigate the proteomics of P. tomentosa cambium tissues over the course of a growing season. Of three protein extraction methods that we compared (the Tris-phenol method, trichloroacetic acid-acetone method, and trichloroacetic acid-acetone-phenol method), trichloroacetic acid-acetone was the most efficient approach for protein extraction from cambium tissues of P. tomentosa. After extraction, the proteins were separated using two-dimensional gel electrophoresis. The protein quantities of six spots changed over the course of the growing season from February to July. Five spots were identified using matrix-assisted laser desorption/ionization time-of-flight/time-of-flight mass spectrometry, and the sixth spot was identified by liquid chromatography-mass spectrometry. The proteins included enolase, class Ia chitinase, and four unnamed proteins. Our results show the best approach to proteomics in P. tomentosa and reveal trends in protein activities during a growing season in this tree species. (author)

  3. Can the capacity for isoprene emission acclimate to environmental modifications during autumn senescence in temperate deciduous tree species Populus tremula?

    Science.gov (United States)

    Sun, Zhihong; Copolovici, Lucian; Niinemets, Ülo

    2012-03-01

    Changes in isoprene emission (Φ(isoprene)), and foliage photosynthetic (A) rates, isoprene precursor dimethylallyldiphosphate (DMADP), and nitrogen and carbon contents were studied from late summer to intensive leaf fall in Populus tremula to gain insight into the emission controls by temperature and endogenous, senescence-induced, modifications. Methanol emissions, characterizing degradation of cell wall pectins, were also measured. A rapid reduction in Φ(isoprene) and A of 60-70% of the initial value was observed in response to a rapid reduction of ambient temperature by ca. 15°C (cold stress). Later phases of senescence were associated with further reductions in Φ(isoprene) and A, with simultaneous major decrease in nitrogen content. However, during episodes of temperature increase, A and in particular, Φ(isoprene) partly recovered. Variation in Φ(isoprene) during senescence was correlated with average temperature of preceding days, with the highest degree of explained variance observed with average temperature of 6 days. Throughout the study, methanol emissions were small, but a large burst of methanol emission was associated with leaf yellowing and abscission. Overall, these data demonstrate that the capacity for isoprene emission can adjust to environmental conditions in senescing leaves as well, but the responsiveness is low compared with mid-season and is also affected by stress.

  4. Litter Quality of Populus Species as Affected by Free-Air CO2 Enrichment and N-Fertilization

    Directory of Open Access Journals (Sweden)

    Esther Vermue

    2009-01-01

    Full Text Available The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher contents of phenols and benzofurans/pyrans. The difference between replications was at least as large as the effect of treatments, so that no systematic chemical changes were attributable to CO2 effect or N-fertilization effect. The chemistry of SOM under the various species and treatments did not show significant changes either. The low number of available replicates that is two was clearly insufficient to overcome the effect of spatial variation on litter chemistry and detect small differences in molecular litter chemistry.

  5. Comparative Physiological and Proteomic Analysis Reveals the Leaf Response to Cadmium-Induced Stress in Poplar (Populus yunnanensis.

    Directory of Open Access Journals (Sweden)

    Yunqiang Yang

    Full Text Available Excess amounts of heavy metals are important environmental pollutants with significant ecological and nutritional effects. Cdmium (Cd is of particular concern because of its widespread occurrence and high toxicity. We conducted physiological and proteomic analyses to improve our understanding of the responses of Populus yunnanensis to Cd stress. The plantlets experienced two apparent stages in their response to Cd stress. During the first stage, transiently induced defense-response molecules, photosynthesis- and energy-associated proteins, antioxidant enzymes and heat shock proteins (HSPs accumulated to enhance protein stability and establish a new cellular homeostasis. This activity explains why plant photosynthetic capability during this period barely changed. During the second stage, a decline of ribulose-1, 5-bisphosphate carboxylase (RuBisCO and HSP levels led to imbalance of the plant photosynthetic system. Additionally, the expression of Mitogen-activated protein kinase 3 (MPK3, Mitogen-activated protein kinase 6 (MPK6 and a homeobox-leucine zipper protein was higher in the second stage. Higher expression of caffeoyl-CoA O-methyltransferase (CCoAOMT may regulate plant cell wall synthesis for greater Cd storage. These genes may be candidates for further research and use in genetic manipulation of poplar tolerance to Cd stress.

  6. Energy sensitivity and variability analysis of Populus hybrid short-rotation plantations in northeastern United States. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Bowersox, T.W.; Blankenhorn, P.R.

    1979-10-24

    Production of biomass by corn-like plantations has been demonstrated by a number of researchers. These forest analogs of agronomic cropping systems have the potential to yield substantially more biomass per unit area than traditional forests. Care is needed in choosing the appropriate sites, species, spacing, and harvesting strategies. Opportunities for increased yields have been suggested for fertilization and irrigation. Utilization of the biomass from these dense plantations for energy was the focus of this study. Although the amount of energy potential of the biomass is important, the energy output must be greater than the energy input for biomass to have a positive benefit to society. Further, in order to completely evaluate the net energy of the system it is necessary to examine the energy out-to-in ratios on the basis of usable energy (for example, usable heat, process steam and electricity), as well as all of the energies expended in producing, harvesting, transporting and processing the biomass. The objective of this study is to establish and analyze the energy inputs for selected management strategies in order to evaluate the sensitivity and variability of the energy inputs in the net energy analysis, and based on the net energy analysis to recommend a management strategy that minimizes energy inputs while maximizing biomass yield for short-rotation systems of Populus spp. in the northeastern United States.

  7. Growth, leaf traits and litter decomposition of roadside hybrid aspen (Populus tremula L. x P. tremuloides Michx.) clones

    International Nuclear Information System (INIS)

    Nikula, Suvi; Manninen, Sirkku; Vapaavuori, Elina; Pulkkinen, Pertti

    2011-01-01

    Road traffic contributes considerably to ground-level air pollution and is therefore likely to affect roadside ecosystems. Differences in growth and leaf traits among 13 hybrid aspen (Populus tremula x P. tremuloides) clones were studied in relation to distance from a motorway. The trees sampled were growing 15 and 30 m from a motorway and at a background rural site in southern Finland. Litter decomposition was also measured at both the roadside and rural sites. Height and diameter growth rate and specific leaf area were lowest, and epicuticular wax amount highest in trees growing 15 m from the motorway. Although no significant distance x clone interactions were detected, clone-based analyses indicated differences in genotypic responses to motorway proximity. Leaf N concentration did not differ with distance from the motorway for any of the clones. Leaf litter decomposition was only temporarily retarded in the roadside environment, suggesting minor effects on nutrient cycling. - Highlights: → Roadside hybrid aspen displayed xeromorphic leaf traits and reduction in growth rate. → These responses were limited to trees close to the motorway and only to some clones. → Leaf litter decomposition was only temporarily retarded in the roadside environment. - Hybrid aspen had more xeromorphic leaves, displayed reduced growth, and showed retarded litter decomposition at an early stage in the roadside environment.

  8. Determination of As in tree-rings of poplar (Populus alba L.) by U-shaped DC arc.

    Science.gov (United States)

    Marković, D M; Novović, I; Vilotić, D; Ignjatović, Lj

    2009-04-01

    An argon-stabilized U-shaped DC arc with a system for aerosol introduction was used for determination of As in poplar (Populus alba L.) tree-rings. After optimization of the operating parameters and selection of the most appropriate signal integration time (30 s), the limit of detection for As was reduced to 15.0 ng/mL. This detection limit obtained with the optimal integration time was compared with those for other methods: inductively coupled plasma-atomic emission spectrometry (ICP-AES), direct coupled plasma-atomic emission spectrometry (DCP-AES), microwave induced plasma-atomic emission spectrometry (MIP-AES) and improved thermospray flame furnace atomic absorption spectrometry (TS-FF-AAS). Arsenic is toxic trace element which can adversely affect plant, animal and human health. As an indicator of environment pollution we collected poplar tree-rings from two locations. The first area was close to the "Nikola Tesla" (TENT-A) power plant, Obrenovac, while the other was in the urban area of Novi Sad. In all cases elevated average concentrations of As were registered in poplar tree-rings from the Obrenovac location.

  9. A novel bHLH transcription factor PebHLH35 from Populus euphratica confers drought tolerance through regulating stomatal development, photosynthesis and growth in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Yan [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Liaoning Forestry Vocational-Technical College, Shenyang 110101 (China); Wang, Congpeng; Han, Xiao; Tang, Sha; Liu, Sha [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Xia, Xinli, E-mail: xiaxl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Yin, Weilun, E-mail: yinwl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China)

    2014-07-18

    Highlights: • PebHLH35 is firstly cloned from Populus euphratica and characterized its functions. • PebHLH35 is important for earlier seedling establishment and vegetative growth. • PebHLH35 enhances tolerance to drought by regulating growth. • PebHLH35 enhances tolerance to drought by regulating stomatal development. • PebHLH35 enhances tolerance to drought by regulating photosynthesis and transpiration. - Abstract: Plant basic helix-loop-helix (bHLH) transcription factors (TFs) are involved in a variety of physiological processes including the regulation of plant responses to various abiotic stresses. However, few drought-responsive bHLH family members in Populus have been reported. In this study, a novel bHLH gene (PebHLH35) was cloned from Populus euphratica. Expression analysis in P. euphratica revealed that PebHLH35 was induced by drought and abscisic acid. Subcellular localization studies using a PebHLH35-GFP fusion showed that the protein was localized to the nucleus. Ectopic overexpression of PebHLH35 in Arabidopsis resulted in a longer primary root, more leaves, and a greater leaf area under well-watered conditions compared with vector control plants. Notably, PebHLH35 overexpression lines showed enhanced tolerance to water-deficit stress. This finding was supported by anatomical and physiological analyses, which revealed a reduced stomatal density, stomatal aperture, transpiration rate, and water loss, and a higher chlorophyll content and photosynthetic rate. Our results suggest that PebHLH35 functions as a positive regulator of drought stress responses by regulating stomatal density, stomatal aperture, photosynthesis and growth.

  10. A novel bHLH transcription factor PebHLH35 from Populus euphratica confers drought tolerance through regulating stomatal development, photosynthesis and growth in Arabidopsis

    International Nuclear Information System (INIS)

    Dong, Yan; Wang, Congpeng; Han, Xiao; Tang, Sha; Liu, Sha; Xia, Xinli; Yin, Weilun

    2014-01-01

    Highlights: • PebHLH35 is firstly cloned from Populus euphratica and characterized its functions. • PebHLH35 is important for earlier seedling establishment and vegetative growth. • PebHLH35 enhances tolerance to drought by regulating growth. • PebHLH35 enhances tolerance to drought by regulating stomatal development. • PebHLH35 enhances tolerance to drought by regulating photosynthesis and transpiration. - Abstract: Plant basic helix-loop-helix (bHLH) transcription factors (TFs) are involved in a variety of physiological processes including the regulation of plant responses to various abiotic stresses. However, few drought-responsive bHLH family members in Populus have been reported. In this study, a novel bHLH gene (PebHLH35) was cloned from Populus euphratica. Expression analysis in P. euphratica revealed that PebHLH35 was induced by drought and abscisic acid. Subcellular localization studies using a PebHLH35-GFP fusion showed that the protein was localized to the nucleus. Ectopic overexpression of PebHLH35 in Arabidopsis resulted in a longer primary root, more leaves, and a greater leaf area under well-watered conditions compared with vector control plants. Notably, PebHLH35 overexpression lines showed enhanced tolerance to water-deficit stress. This finding was supported by anatomical and physiological analyses, which revealed a reduced stomatal density, stomatal aperture, transpiration rate, and water loss, and a higher chlorophyll content and photosynthetic rate. Our results suggest that PebHLH35 functions as a positive regulator of drought stress responses by regulating stomatal density, stomatal aperture, photosynthesis and growth

  11. The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a.

    Directory of Open Access Journals (Sweden)

    Juan Jesús Molina-Rueda

    Full Text Available BACKGROUND: Glutamine synthetase (GS plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4 expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. RESULTS: In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs. The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs, with concomitant up-regulation of plastidic iron SODs (FSDs in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. CONCLUSIONS: Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this

  12. Development of a Threshold Model to Predict Germination of Populus tomentosa Seeds after Harvest and Storage under Ambient Condition

    Science.gov (United States)

    Wang, Wei-Qing; Cheng, Hong-Yan; Song, Song-Quan

    2013-01-01

    Effects of temperature, storage time and their combination on germination of aspen (Populus tomentosa) seeds were investigated. Aspen seeds were germinated at 5 to 30°C at 5°C intervals after storage for a period of time under 28°C and 75% relative humidity. The effect of temperature on aspen seed germination could not be effectively described by the thermal time (TT) model, which underestimated the germination rate at 5°C and poorly predicted the time courses of germination at 10, 20, 25 and 30°C. A modified TT model (MTT) which assumed a two-phased linear relationship between germination rate and temperature was more accurate in predicting the germination rate and percentage and had a higher likelihood of being correct than the TT model. The maximum lifetime threshold (MLT) model accurately described the effect of storage time on seed germination across all the germination temperatures. An aging thermal time (ATT) model combining both the TT and MLT models was developed to describe the effect of both temperature and storage time on seed germination. When the ATT model was applied to germination data across all the temperatures and storage times, it produced a relatively poor fit. Adjusting the ATT model to separately fit germination data at low and high temperatures in the suboptimal range increased the models accuracy for predicting seed germination. Both the MLT and ATT models indicate that germination of aspen seeds have distinct physiological responses to temperature within a suboptimal range. PMID:23658654

  13. Molecular Cloning and Functional Analysis of UV RESISTANCE LOCUS 8 (PeUVR8 from Populus euphratica.

    Directory of Open Access Journals (Sweden)

    Ke Mao

    Full Text Available Ultraviolet-B (UV-B; 280-315 nm light, which is an integral part of the solar radiation reaching the surface of the Earth, induces a broad range of physiological responses in plants. The UV RESISTANCE LOCUS 8 (UVR8 protein is the first and only light photoreceptor characterized to date that is specific for UV-B light and it regulates various aspects of plant growth and development in response to UV-B light. Despite its involvement in the control of important plant traits, most studies on UV-B photoreceptors have focused on Arabidopsis and no data on UVR8 function are available for forest trees. In this study, we isolated a homologue of the UV receptor UVR8 of Arabidopsis, PeUVR8, from Populus euphratica (Euphrates poplar and analyzed its structure and function in detail. The deduced PeUVR8 amino acid sequence contained nine well-conserved regulator of chromosome condensation 1 (RCC1 repeats and the region 27 amino acids from the C terminus (C27 that interact with COP1 (CONSTITUTIVELY PHOTOMORPHOGENIC1. Secondary and tertiary structure analysis showed that PeUVR8 shares high similarity with the AtUVR8 protein from Arabidopsis thaliana. Using heterologous expression in Arabidopsis, we showed that PeUVR8 overexpression rescued the uvr8 mutant phenotype. In addition, PeUVR8 overexpression in wild-type background seedlings grown under UV-B light inhibited hypocotyl elongation and enhanced anthocyanin accumulation. Furthermore, we examined the interaction between PeUVR8 and AtCOP1 using a bimolecular fluorescence complementation (BiFC assay. Our data provide evidence that PeUVR8 plays important roles in the control of photomorphogenesis in planta.

  14. Comparison of Pyrolysis Mass Spectrometry and Near Infrared Spectroscopy for Genetic Analysis of Lignocellulose Chemical Composition in Populus

    Directory of Open Access Journals (Sweden)

    Jianxing Zhang

    2014-03-01

    Full Text Available Genetic analysis of wood chemical composition is often limited by the cost and throughput of direct analytical methods. The speed and low cost of Fourier transform near infrared (FT-NIR overcomes many of these limitations, but it is an indirect method relying on calibration models that are typically developed and validated with small sample sets. In this study, we used >1500 young greenhouse grown trees from a clonally propagated single Populus family, grown at low and high nitrogen, and compared FT-NIR calibration sample sizes of 150, 250, 500 and 750 on calibration and prediction model statistics, and heritability estimates developed with pyrolysis molecular beam mass spectrometry (pyMBMS wood chemical composition. As calibration sample size increased from 150 to 750, predictive model statistics improved slightly. Overall, stronger calibration and prediction statistics were obtained with lignin, S-lignin, S/G ratio, and m/z 144 (an ion from cellulose, than with C5 and C6 carbohydrates, and m/z 114 (an ion from xylan. Although small differences in model statistics were observed between the 250 and 500 sample calibration sets, when predicted values were used for calculating genetic control, the 500 sample set gave substantially more similar results to those obtained with the pyMBMS data. With the 500 sample calibration models, genetic correlations obtained with FT-NIR and pyMBMS methods were similar. Quantitative trait loci (QTL analysis with pyMBMS and FT-NIR predictions identified only three common loci for lignin traits. FT-NIR identified four QTLs that were not found with pyMBMS data, and these QTLs were for the less well predicted carbohydrate traits.

  15. Cuticle lipids on heteromorphic leaves of Populus euphratica Oliv. growing in riparian habitats differing in available soil moisture.

    Science.gov (United States)

    Xu, Xiaojing; Xiao, Lei; Feng, Jinchao; Chen, Ningmei; Chen, Yue; Song, Buerbatu; Xue, Kun; Shi, Sha; Zhou, Yijun; Jenks, Matthew A

    2016-11-01

    Populus euphratica is an important native tree found in arid regions from North Africa and South Europe to China, and is known to tolerate many forms of environmental stress, including drought. We describe cuticle waxes, cutin and cuticle permeability for the heteromorphic leaves of P. euphratica growing in two riparian habitats that differ in available soil moisture. Scanning electron microscopy revealed variation in epicuticular wax crystallization associated with leaf type and site. P. euphratica leaves are dominated by cuticular wax alkanes, primary-alcohols and fatty acids. The major cutin monomers were 10,16-diOH C 16 :0 acids. Broad-ovate leaves (associated with adult phase growth) produced 1.3- and 1.6-fold more waxes, and 2.1- and 0.9-fold more cutin monomers, than lanceolate leaves (associated with juvenile phase growth) at the wetter site and drier site, respectively. The alkane-synthesis-associated ECERIFERUM1 (CER1), as well as ABC transporter- and elongase-associated genes, were expressed at much higher levels at the drier than wetter sites, indicating their potential function in elevating leaf cuticle lipids in the dry site conditions. Higher cuticle lipid amounts were closely associated with lower cuticle permeability (both chlorophyll efflux and water loss). Our results implicate cuticle lipids as among the xeromorphic traits associated with P. euphratica adult-phase broad-ovate leaves. Results here provide useful information for protecting natural populations of P. euphratica and their associated ecosystems, and shed new light on the functional interaction of cuticle and leaf heterophylly in adaptation to more arid, limited-moisture environments. © 2016 Scandinavian Plant Physiology Society.

  16. Lead uptake increases drought tolerance of wild type and transgenic poplar (Populus tremula x P. alba) overexpressing gsh 1.

    Science.gov (United States)

    Samuilov, Sladjana; Lang, Friedericke; Djukic, Matilda; Djunisijevic-Bojovic, Danijela; Rennenberg, Heinz

    2016-09-01

    Growth and development of plants largely depends on their adaptation ability in a changing climate. This is particularly true on heavy metal contaminated soils, but the interaction of heavy metal stress and climate on plant performance has not been intensively investigated. The aim of the present study was to elucidate if transgenic poplars (Populus tremula x P. alba) with enhanced glutathione content possess an enhanced tolerance to drought and lead (Pb) exposure (single and in combination) and if they are good candidates for phytoremediation of Pb contaminated soil. Lead exposure reduced growth and biomass accumulation only in above-ground tissue of wild type poplar, although most of lead accumulated in the roots. Drought caused a decline of the water content rather than reduced biomass production, while Pb counteracted this decline in the combined exposure. Apparently, metals such as Pb possess a protective function against drought, because they interact with abscisic acid dependent stomatal closure. Lead exposure decreased while drought increased glutathione content in leaves of both plant types. Lead accumulation was higher in the roots of transgenic plants, presumably as a result of chelation by glutathione. Water deprivation enhanced Pb accumulation in the roots, but Pb was subject to leakage out of the roots after re-watering. Transgenic plants showed better adaptation under mild drought plus Pb exposure partially due to improved glutathione synthesis. However, the transgenic plants cannot be considered as a good candidate for phytoremediation of Pb, due to its small translocation to the shoots and its leakage out of the roots upon re-watering. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Gas exchange, dry weights, and chlorophyll contents of Populus tremuloides seedlings grown from gamma-irradiated seeds

    International Nuclear Information System (INIS)

    Salmonson, B.J.; Zavitkovski, J.

    1977-01-01

    Photosynthesis and respiration rates of Populus tremuloides seedlings grown from seeds acutely irradiated with gamma rays (at levels of 0, 0.47, 0.94, 1.8, 3.7, 7.5, and 15 kr) were measured using a closed system and infrared (IR) gas analyzer. Dry weights of seedling roots and shoots and chlorophyll contents were also determined. In general, gamma irradiation of seed had little effect on subsequent gas-exchange processes in the plant. Net photosynthesis and dark respiration rates of the seedling at any radiation level were not significantly different from those of the control group. Pooled net photosynthesis of all irradiated seedlings was nonsignificantly lower than that of the control seedlings. The data suggested a slight stimulation in dry-matter production of shoots by low levels of gamma radiation. At the highest levels of radiation, shoot dry weight was significantly reduced. Root production displayed a pattern similar to that of shoots. No trends different from controls were evident in the shoot/root ratios. Total chlorophyll concentrations of the seedling increased over the controls by radiation treatment. Age and radiation effects were evident in the chlorophyll a/b ratios. The chlorophyll a/b ratios decreased with age in both the control and treatment groups. Although in seedlings 39 through 46 days old chlorophyll a/b ratios were higher in the control, chlorophyll a/b ratios were significantly higher in the treatment seedlings at 68 days. Changes in chlorophyll a were primarily responsible for this change

  18. White popular (Populus alba L.) - Litter impact on chemical and biochemical parameters related to nitrogen cycle in contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Ciadamidaro, L.; Madejon, P.; Cabrera, F.; Madejon, E.

    2014-06-01

    Aim of study: The aim of this study was to determine the effect of litter from Populus alba on chemical and biochemical properties related to the N cycle in soils with different pH values and trace element contents. We hypothesized that this litter would influence several parameters related to the N cycle and consequently to soil health. Area of study: we collected two reforested contaminated soils of different pH values (AZ pH 7.23 and DO pH 2.66) and a non-contaminated soil (RHU pH 7.19). Materials and methods: Soil samples were placed in 2,000 cm{sup 3} microcosms and were incubated for 40 weeks in controlled conditions. Each soil was mixed with its corresponding litter, and soils without litter were also tested for comparison. Ammonium (NH{sub 4}{sup 4}+-N) and nitrate (NO{sub 3}{sup -} -N) content, potential nitrification rate (PNR), microbial biomass nitrogen (MBN), protease activity, and several chemical properties such as pH, available trace element concentrations (extracted with 0.01 M CaCl{sub 2}) were determined at different times of incubation. Main results: Values of available trace elements did not vary during the incubation and were always higher in acid soil. In neutral soils litter presence increased values of Kjeldahl-N, NO{sub 3} –-N content, potential nitrification rate (PNR), microbial biomass nitrogen (MBN) and protease activity. Presence of trace elements in neutral soils did not alter the parameters studied. However, acidic pH and high content of available trace elements strongly affected NH{sub 4}{sup +}-N and NO{sub 3}{sup -} -N, microbial biomass N and protease activity. Research highlights: Our results showed the negative effect of the acidity and trace element availability in parameters related with the N-cycle. (Author)

  19. [Effects of mixed decomposition of Populus simonii and other tree species leaf litters on soil properties in Loess Plateau].

    Science.gov (United States)

    Li, Qian; Liu, Zeng-Wen; Du, Liang-Zhen

    2012-03-01

    In this study, the leaf litters of Populus simonii and other 11 tree species were put into soil separately or in mixture after grinding, and incubated in laboratory to analyze the effects of their decomposition on soil properties and the interactions between the litters decomposition. The decomposition of each kind of the leaf litters in soil increased the soil urease, dehydrogenase, and phosphatase activities and the soil organic matter and available N contents markedly, but had greater differences in the effects on the soil available P content and CEC. The decomposition of the leaf litters of Caragana microphylla and of Amorpha fruticosa showed obvious effects in improving soil properties. The decomposition of the mixed leaf litters of P. simonii and Pinus tabulaeformis, Platycladus orientalis, Robinia pseudoacacia, or Ulmus pumila showed interactive promotion effects on the abundance of soil microbes, and that of the mixed leaf litters of P. simonii and P. orientalis or C. microphylla showed interactive promotion effects on the soil organic matter, available P, and available K contents and soil CEC but interactive inhibition effects on the activities of most of the soil enzymes tested. The decomposition of the mixed leaf litters of P. simonii and Larix principis-rupprechtii showed interactive promotion effects on the activities of most of the soil enzymes and soil nutrient contents, while that of the mixed leaf litters of P. simonii and P. sylvestris var. mongolica showed interactive inhibition effects. Overall, the decomposition of the mixed leaf litters of P. simo- nii and U. pumila, P. tabulaeformis, L. principis-rupprechtii, or R. pseudoacacia could improve soil quality, but the mixed leaf litters of P. simonii and P. orientalis, C. microphylla, P. sylvestris var. mongolica, Hippophae rhamnoides, or A. fruticosa showed an interactive inhibition effect during their decomposition.

  20. Selection against recombinant hybrids maintains reproductive isolation in hybridizing Populus species despite F1 fertility and recurrent gene flow.

    Science.gov (United States)

    Christe, Camille; Stölting, Kai N; Bresadola, Luisa; Fussi, Barbara; Heinze, Berthold; Wegmann, Daniel; Lexer, Christian

    2016-06-01

    Natural hybrid zones have proven to be precious tools for understanding the origin and maintenance of reproductive isolation (RI) and therefore species. Most available genomic studies of hybrid zones using whole- or partial-genome resequencing approaches have focused on comparisons of the parental source populations involved in genome admixture, rather than exploring fine-scale patterns of chromosomal ancestry across the full admixture gradient present between hybridizing species. We have studied three well-known European 'replicate' hybrid zones of Populus alba and P. tremula, two widespread, ecologically divergent forest trees, using up to 432 505 single-nucleotide polymorphisms (SNPs) from restriction site-associated DNA (RAD) sequencing. Estimates of fine-scale chromosomal ancestry, genomic divergence and differentiation across all 19 poplar chromosomes revealed strikingly contrasting results, including an unexpected preponderance of F1 hybrids in the centre of genomic clines on the one hand, and genomically localized, spatially variable shared variants consistent with ancient introgression between the parental species on the other. Genetic ancestry had a significant effect on survivorship of hybrid seedlings in a common garden trial, pointing to selection against early-generation recombinants. Our results indicate a role for selection against recombinant genotypes in maintaining RI in the face of apparent F1 fertility, consistent with the intragenomic 'coadaptation' model of barriers to introgression upon secondary contact. Whole-genome resequencing of hybridizing populations will clarify the roles of specific genetic pathways in RI between these model forest trees and may reveal which loci are affected most strongly by its cyclic breakdown. © 2016 John Wiley & Sons Ltd.

  1. Testing applicability of black poplar (Populus nigra L.) bark to heavy metal air pollution monitoring in urban and industrial regions

    International Nuclear Information System (INIS)

    Berlizov, A.N.; Blum, O.B.; Filby, R.H.; Malyuk, I.A.; Tryshyn, V.V.

    2007-01-01

    A comparative study of the capabilities of black poplar-tree (Populus nigra L.) bark as a biomonitor of atmospheric heavy-metal pollution is reported. Performance indicators (concentrations and enrichment factors) of heavy metal bioaccumulation of bark were compared to the corresponding indicators of epiphytic lichens Xanthoria parietina (L.) Th. Fr. and Physcia adscendens (Fr.) H. Oliver, collected simultaneously with bark samples within the Kiev urban-industrial conurbation. The concentrations of 40 minor and trace elements in the samples were measured by a combination of epithermal and instrumental neutron activation analysis (NAA) using a 10 MW nuclear research reactor WWR-M as the neutron source. Statistical analysis of the data was carried out using non-parametric tests. It was shown that for the majority of the elements determined a good correlation exists between their concentrations in bark and in the lichen species. The accumulation capability of the bark was found to be as effective as, and in some cases better, for both types of lichens. Based on the background levels and variations of the elemental concentration in black poplar-tree bark, threshold values for the enrichment factors were established. For a number of elements (As, Au, Ce, Co, Cr, Cu, La, Mn, Mo, Ni, Sb, Sm, Ti, Th, U, V, W) an interspecies calibration was performed. An optimized pre-irradiation treatment of the bark sample was employed which efficiently separated the most informative external layer from the deeper layers of the bark and thus minimized variations of the element concentrations. Results of this study support black poplar-tree bark as an alternative to epiphytic lichens for heavy metal air pollution monitoring in urban and industrial regions, where severe environmental conditions may result in scarcity or even lack of the indicator species

  2. Seasonal N changes in alnus orientalis and populus nigra and N2 fixation by exotic alder species in Syria

    International Nuclear Information System (INIS)

    Kurdali, F.

    2002-01-01

    Two experiments were conducted.The first was to study nodulation and N 2 fixation of several introduced alder species (Alnus glutinosa, A. incana, A. rubra and A. viridis) grown in soil from beneath Alnus orientalis. The second was to determine pattern of N changes in leaves and bark of Alnus orientalis and populus nigra natural stands during two successive years. Results showed that frankia in soil from underneath Alnus orientalis nodulated and fixed nitrogen on roots of local alder as well as on roots of introduced alder species from distant and ecologically diverse localities. However, differences were found among species in the number of nodules formed and amount of nitrogen fixed. Percentages of nitrogen derived from atmosphere (%Ndfa) ranged from 5% in A.viridis to 66% in A. orientalis. Microscopic study of Alnus orientalis nodules showed the presence of vesicles, and frankia belonging to Sp-type. Foliar N concentration was higher in alder than in poplar. Total N concentration in alder leaves remained relatively constant at about 3% during summer, whereas N concentration in poplar decreased sharply in leaves and increased in bark. No substantial increase in N concentration was found in alder bark, and the fallen leaves were rich in nitrogen. During autumn, leaf N concentration in poplar decreased by 43% and 51% for the first and the second year, respectively, whereas N concentrations in bark increased by 71% and 100%. Total N concentrations in alder leaves decreased only by 8-16% while, values in the adjacent bark remained stable. In contrast to poplar, it seems that Alnus orientalis does not exhibit net leaf retranslocation to bark tissues.(author)

  3. White poplar (Populus alba L. - Litter impact on chemical and biochemical parameters related to nitrogen cycle in contaminated soils

    Directory of Open Access Journals (Sweden)

    Paula Madejon

    2014-04-01

    Full Text Available Aim of study: The aim of this study was to determine the effect of litter from Populus alba on chemical and biochemical properties related to the N cycle in soils with different pH values and trace element contents. We hypothesized that this litter would influence several parameters related to the N cycle and consequently to soil health.Area of study: we collected two reforested contaminated soils of different pH values (AZ pH 7.23 and DO pH = 2.66 and a non-contaminated soil (RHU pH 7.19.Materials and methods: Soil samples were placed in 2,000 cm3 microcosms and were incubated for 40 weeks in controlled conditions. Each soil was mixed with its corresponding litter, and soils without litter were also tested for comparison. Ammonium (NH4+-N and nitrate (NO3–-N content, potential nitrification rate (PNR, microbial biomass nitrogen (MBN, protease activity, and several chemical properties such as pH, available trace element concentrations (extracted with 0.01 M CaCl2 were determined at different times of incubation.Main results: Values of available trace elements did not vary during the incubation and were always higher in acid soil. In neutral soils litter presence increased values of Kjeldahl-N, NO3–-N content, potential nitrification rate (PNR, microbial biomass nitrogen (MBN and protease activity. Presence of trace elements in neutral soils did not alter the parameters studied. However, acidic pH and high content of available trace elements strongly affected NH4+-N andNO3–-N, microbial biomass N and protease activity.Research highlights: Our results showed the negative effect of the acidity and trace element availability in parameters related with the N-cycle.Key words: microbial biomass N; protease activity; soil pH; N mineralization; nitrification; phytoremediation.

  4. Factors affecting fall down rates of dead aspen (Populus tremuloides) biomass following severe drought in west-central Canada.

    Science.gov (United States)

    Ted Hogg, Edward H; Michaelian, Michael

    2015-05-01

    Increases in mortality of trembling aspen (Populus tremuloides Michx.) have been recorded across large areas of western North America following recent periods of exceptionally severe drought. The resultant increase in standing, dead tree biomass represents a significant potential source of carbon emissions to the atmosphere, but the timing of emissions is partially driven by dead-wood dynamics which include the fall down and breakage of dead aspen stems. The rate at which dead trees fall to the ground also strongly influences the period over which forest dieback episodes can be detected by aerial surveys or satellite remote sensing observations. Over a 12-year period (2000-2012), we monitored the annual status of 1010 aspen trees that died during and following a severe regional drought within 25 study areas across west-central Canada. Observations of stem fall down and breakage (snapping) were used to estimate woody biomass transfer from standing to downed dead wood as a function of years since tree death. For the region as a whole, we estimated that >80% of standing dead aspen biomass had fallen after 10 years. Overall, the rate of fall down was minimal during the year following stem death, but thereafter fall rates followed a negative exponential equation with k = 0.20 per year. However, there was high between-site variation in the rate of fall down (k = 0.08-0.37 per year). The analysis showed that fall down rates were positively correlated with stand age, site windiness, and the incidence of decay fungi (Phellinus tremulae (Bond.) Bond. and Boris.) and wood-boring insects. These factors are thus likely to influence the rate of carbon emissions from dead trees following periods of climate-related forest die-off episodes. © 2014 Her Majesty the Queen in Right of Canada Global Change Biology © 2014 John Wiley & Sons Ltd Reproduced with the permission of the Minister of Natural Resources Canada.

  5. Analysis of a Farquhar-von Caemmerer-Berry leaf-level photosynthetic rate model for Populus tremuloides in the context of modeling and measurement limitations

    International Nuclear Information System (INIS)

    Lenz, Kathryn E.; Host, George E.; Roskoski, Kyle; Noormets, Asko; Sober, Anu; Karnosky, David F.

    2010-01-01

    The balance of mechanistic detail with mathematical simplicity contributes to the broad use of the Farquhar, von Caemmerer and Berry (FvCB) photosynthetic rate model. Here the FvCB model was coupled with a stomatal conductance model to form an [A,g s ] model, and parameterized for mature Populus tremuloides leaves under varying CO 2 and temperature levels. Data were selected to be within typical forest light, CO 2 and temperature ranges, reducing artifacts associated with data collected at extreme values. The error between model-predicted photosynthetic rate (A) and A data was measured in three ways and found to be up to three times greater for each of two independent data sets than for a base-line evaluation using parameterization data. The evaluation methods used here apply to comparisons of model validation results among data sets varying in number and distribution of data, as well as to performance comparisons of [A,g s ] models differing in internal-process components. - A photosynthetic rate model is parameterized for Populus tremuloides and evaluated based on its ability to predict dependent as well as independent data.

  6. Effects of progressive soil water deficit on growth, and physiological and biochemical responses of populus euphratica in arid area: a case study in China

    International Nuclear Information System (INIS)

    Yang, Y.; Chen, Y.; Li, W.; Zhu, C.

    2015-01-01

    The aim of this study was to investigate the responses of Populus euphratica seedlings under a short-term soil water deficit. To mimic natural conditions in which drought stress develops gradually, stress was imposed by subjecting plants to a gradual decrease of soil water content for a period of 21 d. We studied growth, physiological and biochemical responses to progressive soil water deficit of potted Populus euphratica seedlings at outdoors. Results showed that, in 6 d of water withholding, the soil moisture content decreased to a slight drought stress level, and it reached a severe drought stress level after 15 d of water withholding in July. In the process of soil water declining from saturated to severe drought levels, the increasing soil water deficit resulted in decreases in the height, stem base diameter, number of lateral branches. Leaf predawn water potential decreased after 15 d of withholding irrigation. After 21 d of withholding irrigation, actual photochemical efficiency of photosystem II (PSII) in light-adapted leaves and photochemical quenching coefficient decreased, respectively; the peroxidase activity, the content of chlorophyll a and chlorophyll b decreased. There were no significant changes in proline, malondialdehyde content, chlorophyll a/b value and superoxide dismutase activity. (author)

  7. Roles of gibberellin catabolism and signaling in growth and physiological response to drought and short-day photoperiods in Populus trees.

    Directory of Open Access Journals (Sweden)

    Christine Zawaski

    Full Text Available Survival and productivity of perennial plants in temperate zones are dependent on robust responses to prolonged and seasonal cycles of unfavorable conditions. Here we report whole-genome microarray, expression, physiological, and transgenic evidence in hybrid poplar (Populus tremula × Populus alba showing that gibberellin (GA catabolism and repressive signaling mediates shoot growth inhibition and physiological adaptation in response to drought and short-day (SD induced bud dormancy. Both water deprivation and SDs elicited activation of a suite of poplar GA2ox and DELLA encoding genes. Poplar transgenics with up-regulated GA 2-oxidase (GA2ox and DELLA domain proteins showed hypersensitive growth inhibition in response to both drought and SDs. In addition, the transgenic plants displayed greater drought resistance as evidenced by increased pigment concentrations (chlorophyll and carotenoid and reductions in electrolyte leakage (EL. Comparative transcriptome analysis using whole-genome microarray showed that the GA-deficiency and GA-insensitivity, SD-induced dormancy, and drought response in poplar share a common regulon of 684 differentially-expressed genes, which suggest GA metabolism and signaling plays a role in plant physiological adaptations in response to alterations in environmental factors. Our results demonstrate that GA catabolism and repressive signaling represents a major route for control of growth and physiological adaptation in response to immediate or imminent adverse conditions.

  8. Efeito da aplicação de calcário em estacas de Populus deltoides Bartr. ex Marsh cultivadas em vaso

    Directory of Open Access Journals (Sweden)

    Jean Gabriel Medeiros da Silva

    2002-01-01

    Full Text Available This work intended to study the behavior of Populus deltoides regarding its development when submitted to different doses of lime. The research was carried out in the Silviculture Tecnology Center, at Universidade Federal de Santa Maria, Santa Maria - RS. The experiment was constituted by forty eight (48 experimental units completely randomized, with six (06 treatments and eight repetitions (08. Each experimental unit was constituted by a vase of three liters containing only one shoot cutting of Populus deltoides. The treatments were constituted by five different doses (T2: 7 tons of lime/ha; T3: 14 tons of lime/ha; T4: 21 tons of lime/ha; T5: 29 tons of lime/ha; T6: 38 tons of lime/ha plus the testimony, determined with base in the soil analysis used in the experiment. The plants were evaluated, after 120 days of the plantation date, considering its growth in height, its diameter of the neck and its weigh dry of the aerial part. The best average were reached by the treatments without lime and with seven tons of lime for ha in all the parameters observed. The other treatments presented inferior averages, which do not possess significant difference to each other at the level of 5%, for all the observed parameters.

  9. Zinc accumulation potential and toxicity threshold determined for a metal-accumulating Populus canescens clone in a dose-response study

    Energy Technology Data Exchange (ETDEWEB)

    Langer, Ingrid [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria); Krpata, Doris [Institute of Microbiology, Innsbruck University, Technikerstrasse 25, A-6020 Innsbruck (Austria); Fitz, Walter J.; Wenzel, Walter W. [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria); Schweiger, Peter F., E-mail: peter.schweiger@boku.ac.a [Institute of Soil Science, University of Natural Resources and Applied Life Sciences, Peter Jordan-Strasse 82, A-1190 Vienna (Austria)

    2009-10-15

    The effect of increasing soil Zn concentrations on growth and Zn tissue concentrations of a metal-accumulating aspen clone was examined in a dose-response study. Plants were grown in a soil with a low native Zn content which was spiked with Zn salt solutions and subsequently aged. Plant growth was not affected by NH{sub 4}NO{sub 3}-extractable soil Zn concentrations up to 60 mug Zn g{sup -1} soil, but it was completely inhibited at extractable concentrations above 90 mug Zn g{sup -1} soil. From these data an effective concentration of 68.5 mug extractable Zn g{sup -1} soil was calculated at which plant growth was reduced by 50%. The obtained information on toxicity threshold concentrations, and the relation between plant Zn accumulation and extractable soil Zn concentrations may be used to assess the suitability of the investigated Populus canescens clone for various phytoremediation strategies. The potential risk of metal transfer into food webs associated with P. canescens stands on Zn-polluted sites may also be estimated. - Quantitative information about the concentration-dependent Zn accumulation of Populus canescens contributes to assess its suitability for phytoremediation.

  10. Barrier to gene flow between two ecologically divergent Populus species, P. alba (white poplar) and P. tremula (European aspen): the role of ecology and life history in gene introgression.

    Science.gov (United States)

    Lexer, C; Fay, M F; Joseph, J A; Nica, M-S; Heinze, B

    2005-04-01

    The renewed interest in the use of hybrid zones for studying speciation calls for the identification and study of hybrid zones across a wide range of organisms, especially in long-lived taxa for which it is often difficult to generate interpopulation variation through controlled crosses. Here, we report on the extent and direction of introgression between two members of the "model tree" genus Populus: Populus alba (white poplar) and Populus tremula (European aspen), across a large zone of sympatry located in the Danube valley. We genotyped 93 hybrid morphotypes and samples from four parental reference populations from within and outside the zone of sympatry for a genome-wide set of 20 nuclear microsatellites and eight plastid DNA restriction site polymorphisms. Our results indicate that introgression occurs preferentially from P. tremula to P. alba via P. tremula pollen. This unidirectional pattern is facilitated by high levels of pollen vs. seed dispersal in P. tremula (pollen/seed flow = 23.9) and by great ecological opportunity in the lowland floodplain forest in proximity to P. alba seed parents, which maintains gene flow in the direction of P. alba despite smaller effective population sizes (N(e)) in this species (P. alba N(e)c. 500-550; P. tremula N(e)c. 550-700). Our results indicate that hybrid zones will be valuable tools for studying the genetic architecture of the barrier to gene flow between these two ecologically divergent Populus species.

  11. Production potential of 36 poplar clones grown at medium length rotation in Denmark

    DEFF Research Database (Denmark)

    Nielsen, Ulrik Brauner; Madsen, Palle; Hansen, Jon Kehlet

    2014-01-01

    years. The estimated mean annual increment of above ground biomass ranged from 1 to 9 Mg ha−1 yr−1 at age 13 years. A hybrid clone O.P. 42 (synonyms Hybrid 275, NE 42) Populus maximowiczii × trichocarpa, performed best, but also clones of the species Populus trichocarpa had a high biomass production....... In general the hybrids using P. maximowiczii as a parent were well performing. Lowest production had pure species Populus nigra and Populus deltoides as well as their hybrids. The choice of species hybrid combination had a very strong impact on biomass production, but less influence on quality and health......The importance of choosing suitable clones for production of timber and biomass has long been recognized. The aims of this study were to describe the genetic variation and production potential among 36 poplar clones grown in a rotation of 5–13 years and evaluate the different species and hybrid...

  12. Untangling the effects of root age and tissue nitrogen on root respiration in Populus tremuloides at different nitrogen supply.

    Science.gov (United States)

    Ceccon, Christian; Tagliavini, Massimo; Schmitt, Armin Otto; Eissenstat, David M

    2016-05-01

    Root respiration is a major contributor to terrestrial carbon flux. Many studies have shown root respiration to increase with an increase in root tissue nitrogen (N) concentration across species and study sites. Studies have also shown that both root respiration and root N concentration typically decrease with root age. The effects of added N may directly increase respiration of existing roots or may affect respiration by shifting the age structure of a root population by stimulating growth. To the best of our knowledge, no study has ever examined the effect of added N as a function of root age on root respiration. In this study, root respiration of 13-year-old Populus tremuloides Michx. trees grown in the field and 1-year-old P. tremuloides seedlings grown in containers was analyzed for the relative influence of root age and root N concentration independent of root age on root respiration. Field roots were first tracked using root windows and then sampled at known age. Nitrogen was either applied or not to small patches beneath the windows. In a pot experiment, each plant was grown with its root system split between two separate pots and N was applied at three different levels, either at the same or at different rates between pots. Root N concentration ranged between 1.4 and 1.7% in the field experiment and 1.8 and 2.6% in the seedling experiment. We found that addition of N increased root N concentration of only older roots in the field but of roots of all ages in the potted seedlings. In both experiments, the age-dependent decline in root respiration was largely consistent, and could be explained by a negative power function. Respiration decreased ∼50% by 3 weeks of age. Although root age was the dominant factor affecting respiration in both experiments, in the field experiment, root N also contributed to root respiration independent of root age. These results add further insight into respiratory responses of roots to N addition and mechanisms underlying the

  13. Expression of multiple resistance genes enhances tolerance to environmental stressors in transgenic poplar (Populus × euramericana 'Guariento'.

    Directory of Open Access Journals (Sweden)

    Xiaohua Su

    Full Text Available Commercial and non-commercial plants face a variety of environmental stressors that often cannot be controlled. In this study, transgenic hybrid poplar (Populus × euramericana 'Guariento' harboring five effector genes (vgb, SacB, JERF36, BtCry3A and OC-I were subjected to drought, salinity, waterlogging and insect stressors in greenhouse or laboratory conditions. Field trials were also conducted to investigate long-term effects of transgenic trees on insects and salt tolerance in the transformants. In greenhouse studies, two transgenic lines D5-20 and D5-21 showed improved growth, as evidenced by greater height and basal diameter increments and total biomass relative to the control plants after drought or salt stress treatments. The improved tolerance to drought and salt was primarily attributed to greater instantaneous water use efficiency (WUEi in the transgenic trees. The chlorophyll concentrations tended to be higher in the transgenic lines under drought or saline conditions. Transformed trees in drought conditions accumulated more fructan and proline and had increased Fv/Fm ratios (maximum quantum yield of photosystem II under waterlogging stress. Insect-feeding assays in the laboratory revealed a higher total mortality rate and lower exuviation index of leaf beetle [Plagiodera versicolora (Laicharting] larvae fed with D5-21 leaves, suggesting enhanced insect resistance in the transgenic poplar. In field trials, the dominance of targeted insects on 2-year-old D5-21 transgenic trees was substantially lower than that of the controls, indicating enhanced resistance to Coleoptera. The average height and DBH (diameter at breast height of 2.5-year-old transgenic trees growing in naturally saline soil were 3.80% and 4.12% greater than those of the control trees, but these increases were not significant. These results suggested that multiple stress-resistance properties in important crop tree species could be simultaneously improved, although

  14. Transcriptomic analysis reveals importance of ROS and phytohormones in response to short-term salinity stress in Populus tomentosa

    Directory of Open Access Journals (Sweden)

    Lingyu eZheng

    2015-09-01

    Full Text Available Populus tomentosa (Chinese white poplar is well adapted to various extreme environments, and is considered an important species to study the effects of salinity stress on poplar trees. To decipher the mechanism of poplar’s rapid response to short-term salinity stress, we firstly detected the changes in H2O2 and hormone, and then profiled the gene expression pattern of ten-week-old seedling roots treated with 200 mM NaCl for 0, 6, 12 and 24 hours (h by RNA-seq on the Illumina-Solexa platform. Physiological determination showed that the significant increase in H2O2 began at 6 h, while that in hormone ABA was at 24 h, under salt stress. Compared with controls (0 h, 3991, 4603 and 4903 genes were up regulated, and 1408, 2206 and 3461 genes were down regulated (adjusted P-value ≤ 0.05 and |log2Ratio|≥1 at 6, 12, and 24 h time points, respectively. The Gene Ontology (GO and Kyoto Encyclopedia of Genes and Genomes (KEGG pathway annotation revealed that the differentially expressed genes (DEGs were highly enriched in hormone- and reactive oxygen species-related biological processes, including ‘response to oxidative stress or abiotic stimulus’, ‘peroxidase activity’, ‘regulation of transcription’, ‘hormone synthetic and metabolic process’, ‘hormone signal transduction’, ‘antioxidant activity’ and ‘transcription factor activity’. Moreover, K-means clustering demonstrated that DEGs (total RPKM value>12 from four time points could be categorized into four kinds of expression trends: quick up/down over 6 h or 12 h, and slow up/down over 24 h. Of these, DEGs involved in H2O2- and hormone- producing and signal-related genes were further enriched in this analysis, which indicated that the two kinds of small molecules, hormones and H2O2, play pivotal roles in the short-term salt stress response in poplar. This study provides a basis for future studies of the molecular adaptation of poplar and other tree species to salinity

  15. Impacts of climate and insect defoliators on productivity and function of trembling aspen (Populus tremuloides) in Alaskan boreal forests

    Science.gov (United States)

    Boyd, M. A.; Walker, X. J.; Rogers, B. M.; Goetz, S. J.; Wagner, D.; Mack, M. C.

    2017-12-01

    Climate change has increased tree mortality and growth decline in forested ecosystems worldwide. In response to warming and drying of the boreal forest, trembling aspen (Populus tremuloides) has experienced recent large-scale productivity declines. Although declines in productivity are thought to be primarily a result of moistures stress, infestation is another major driver of aspen decline and may interact strongly with climate. Throughout interior Alaska widespread and consistent foliar damage by the aspen epidermal leaf miner Phyllocnistis populiella has been observed concurrent with some of the warmest and driest growing seasons on record. Here we use tree ring measurements and remote sensing indices of vegetation productivity (NDVI) to study the influence of leaf miner and climate on aspen productivity and physiology in the Alaskan boreal forest, and assess if NDVI reflects variations in these ground-based measurements. We assessed ring width and tree ring stable carbon isotope (d13C) response of aspen to infestation and a climate moisture index (CMI) from 2004 - 2014. We found that when growth was negatively correlated to infestation, then it was no longer positively influenced by moisture availability during the growing season. Regardless of the radial growth response to leaf mining, tree ring d13C decreased with increasing infestation. We also found that NDVI was influenced by leaf mining and showed a positive correlation with tree ring d13C, which suggests that NDVI is reflective of changes in tree characteristics under leaf mining that influence tree ring d13C. This finding also reveals the prospect of using satellite data to monitor fluctuations in tree physiology during leaf miner infestation. Our results indicate that aspen productivity will be severely hindered during leaf miner infestation, and that infestation will inhibit the ability of aspen to respond to favorable climate conditions by increasing growth and potentially photosynthesis. This

  16. Comparative study of volatile components from male and female flower buds of Populus × tomentosa by HS-SPME-GC-MS.

    Science.gov (United States)

    Xu, Liang; Liu, Haiping; Ma, Yucui; Wu, Cui; Li, Ruiqi; Chao, Zhimao

    2018-06-13

    The differences of volatile components in male (MFB) and female flower buds (FFB) of Populus × tomentosa were analysed and compared by HS-SPME with GC-MS for the first time. A total of 34 compounds were identified. Two clusters were clearly divided into male and female by hierarchical clustering analysis. Both the male and female flower buds showed methyl salicylate (22.83 and 24.09%, respectively) and 2-hydroxy-benzaldehyde (10.05 and 12.41%, respectively) as the main volatile constituents. The content of 2-cyclohexen-1-one, benzyl benzoate, and methyl benzoate in FFB was remarkably higher than in MFB. In contrast, the content of ethyl benzoate in MFB was greater than that in FFB. The phenomena showed the characteristic differences between MFB and FFB of P. × tomentosa, which enriched the basic studies on dioecious plant.

  17. Methylobacterium populi sp. nov., a novel aerobic, pink-pigmented, facultatively methylotrophic, methane-utilizing bacterium isolated from poplar trees (Populus deltoides x nigra DN34).

    Science.gov (United States)

    Van Aken, Benoit; Peres, Caroline M; Doty, Sharon Lafferty; Yoon, Jong Moon; Schnoor, Jerald L

    2004-07-01

    A pink-pigmented, aerobic, facultatively methylotrophic bacterium, strain BJ001T, was isolated from internal poplar tissues (Populus deltoidesxnigra DN34) and identified as a member of the genus Methylobacterium. Phylogenetic analyses showed that strain BJ001T is related to Methylobacterium thiocyanatum, Methylobacterium extorquens, Methylobacterium zatmanii and Methylobacterium rhodesianum. However, strain BJ001T differed from these species in its carbon-source utilization pattern, particularly its use of methane as the sole source of carbon and energy, an ability that is shared with only one other member of the genus, Methylobacterium organophilum. In addition, strain BJ001T is the only member of the genus Methylobacterium to be described as an endophyte of poplar trees. On the basis of its physiological, genotypic and ecological properties, the isolate is proposed as a member of a novel species of the genus Methylobacterium, Methylobacterium populi sp. nov. (type strain, BJ001T=ATCC BAA-705T=NCIMB 13946T).

  18. Investigation of seedlings growth and development of some trees and shrubs grown on energetic ashes of two types. [Acer negundo; Fraxinus pennsylvanica; Populus alba; Myricaria germanica

    Energy Technology Data Exchange (ETDEWEB)

    Kluczynski, B

    1973-01-01

    Pot experiments concerning the degree of resistance, of chosen species of trees and shrubs to unfavorable physical and chemical properties of energetic ashes, obtained from burning brown (K) and pit (O) coal, were carried out. Seeds were sown out in prepared substrates, in 8 combinations. The investigation consisted of two parts. Seeds of 11 species of trees and shrubs and 1 herb plant were used in the first part. Seeds of 6 species of trees and shrubs were used in the second part. All the environmental variants were investigated in 4 replications (replication = pot). Each species was evaluated according to several features determining its usefulness on various substrates. These features were divided into two groups, characterizing seedlings survival (feature group ..cap alpha..) and health conditions and general vitality (feature group ..beta..). The obtained results indicate a need of examining the usefulness for dump recultivation in field conditions of Acer negundo, Fraxinus pennsylvanica, Populus alba and probably Myricaria germanica. 8 references, 17 tables.

  19. Plant Signals Disrupt (regulate?) Arbuscular Mycorrhizal Fungal Growth Under Enhanced Ozone and CO2 Growing Conditions for Populus tremuloides

    Science.gov (United States)

    Miller, R. M.; Podila, G. K.

    2008-12-01

    An understanding of the genetic determinants of keystone symbiotic relationships is essential to elucidating adaptive mechanisms influencing higher-order processes, including shifts in community composition following environmental perturbations. The Aspen FACE project offers a unique opportunity to address adaptive processes with an imposed three way interaction experiment composed of the atmospheric pollutant ozone (eO3), elevated CO2 (eCO2) fumigations, five Populus tremuloides (aspen) genotypes, and both arbuscular mycorrhizal and ectomycorrhizal fungal interactions. The 10 year time span of this experiment has allowed for a realistic and mechanistic understanding of above ground responses of the aspen genotypes to eCO2, eO3 and the interaction effects of eCO2 and eO3. Even so, treatment influences to the below ground, including carbon allocation to roots and associated mycorrhizal symbionts, and rhizosphere dynamics are just beginning to be understood. We hypothesized that mycorrhizal fungal responses to eCO2, eO3, and the interaction effects of eCO2+eO3 are conditioned by the degree of response of their aspen hosts. We intend to describe the molecular mechanisms of an important critical interaction between host and fungus using microarray analysis of expression profiles, as well as metabolic profiling of aspen roots and their associated mycorrhizal partner, the arbuscular mycorrhizal fungus (AMF) Glomus intraradices, under eCO2, eO3 and eCO2+eO3. We present evidence that host-derived factors, expressed in response to eCO2+eO3, trigger responses in Glomus leading to the partitioning or metabolic shift in lipid biosynthesis that is associated with reduced extraradical hyphae growth and altered lipid metabolism. We then scale these lower-level responses to give better insight to fungal intraradical and extraradical allocation of biomass and fungal and root lipid and carbohydrate content in association with aspen genotype responses to the imposed treatments. By

  20. Abnormal meiosis in an intersectional allotriploid of Populus L. and segregation of ploidy levels in 2x × 3x progeny.

    Directory of Open Access Journals (Sweden)

    Jun Wang

    Full Text Available Triploid plants are usually highly aborted owing to unbalanced meiotic chromosome segregation, but limited viable gametes can participate in the transition to different ploidy levels. In this study, numerous meiotic abnormalities were found with high frequency in an intersectional allotriploid poplar (Populus alba × P. berolinensis 'Yinzhong', including univalents, precocious chromosome migration, lagging chromosomes, chromosome bridges, micronuclei, and precocious cytokinesis, indicating high genetic imbalance in this allotriploid. Some micronuclei trigger mini-spindle formation in metaphase II and participate in cytokinesis to form polyads with microcytes. Unbalanced chromosome segregation and chromosome elimination resulted in the formation of microspores with aneuploid chromosome sets. Fusion of sister nuclei occurs in microsporocytes with precocious cytokinesis, which could form second meiotic division restitution (SDR-type gametes. However, SDR-type gametes likely contain incomplete chromosome sets due to unbalanced segregation of homologous chromosomes during the first meiotic division in triploids. Misorientation of spindles during the second meiotic division, such as fused and tripolar spindles with low frequency, could result in the formation of first meiotic division restitution (FDR-type unreduced gametes, which most likely contain three complete chromosome sets. Although 'Yinzhong' yields 88.7% stainable pollen grains with wide diameter variation from 23.9 to 61.3 μm, the pollen viability is poor (2.78% ± 0.38. A cross of 'Yinzhong' pollen with a diploid female clone produced progeny with extensive segregation of ploidy levels, including 29 diploids, 18 triploids, 4 tetraploids, and 48 aneuploids, suggesting the formation of viable aneuploidy and unreduced pollen in 'Yinzhong'. Individuals with different chromosome compositions are potential to analyze chromosomal function and to integrate the chromosomal dosage variation into

  1. Spring leaf flush in aspen (Populus tremuloides) clones is altered by long-term growth at elevated carbon dioxide and elevated ozone concentration

    International Nuclear Information System (INIS)

    McGrath, Justin M.; Karnosky, David F.; Ainsworth, Elizabeth A.

    2010-01-01

    Early spring leaf out is important to the success of deciduous trees competing for light and space in dense forest plantation canopies. In this study, we investigated spring leaf flush and how long-term growth at elevated carbon dioxide concentration ([CO 2 ]) and elevated ozone concentration ([O 3 ]) altered leaf area index development in a closed Populus tremuloides (aspen) canopy. This work was done at the Aspen FACE experiment where aspen clones have been grown since 1997 in conditions simulating the [CO 2 ] and [O 3 ] predicted for ∼2050. The responses of two clones were compared during the first month of spring leaf out when CO 2 fumigation had begun, but O 3 fumigation had not. Trees in elevated [CO 2 ] plots showed a stimulation of leaf area index (36%), while trees in elevated [O 3 ] plots had lower leaf area index (-20%). While individual leaf area was not significantly affected by elevated [CO 2 ], the photosynthetic operating efficiency of aspen leaves was significantly improved (51%). There were no significant differences in the way that the two aspen clones responded to elevated [CO 2 ]; however, the two clones responded differently to long-term growth at elevated [O 3 ]. The O 3 -sensitive clone, 42E, had reduced individual leaf area when grown at elevated [O 3 ] (-32%), while the tolerant clone, 216, had larger mature leaf area at elevated [O 3 ] (46%). These results indicate a clear difference between the two clones in their long-term response to elevated [O 3 ], which could affect competition between the clones, and result in altered genotypic composition in future atmospheric conditions. - Spring leaf flush is stimulated by elevated [CO 2 ] and suppressed by elevated [O 3 ] in aspen (Populus tremuloides).

  2. Unexpected ancestry of Populus seedlings from a hybrid zone implies a large role for postzygotic selection in the maintenance of species.

    Science.gov (United States)

    Lindtke, Dorothea; Gompert, Zachariah; Lexer, Christian; Buerkle, C Alex

    2014-09-01

    In the context of potential interspecific gene flow, the integrity of species will be maintained by reproductive barriers that reduce genetic exchange, including traits associated with prezygotic isolation or poor performance of hybrids. Hybrid zones can be used to study the importance of different reproductive barriers, particularly when both parental species and hybrids occur in close spatial proximity. We investigated the importance of barriers to gene flow that act early vs. late in the life cycle of European Populus by quantifying the prevalence of homospecific and hybrid matings within a mosaic hybrid zone. We obtained genotypic data for 11 976 loci from progeny and their maternal parents and constructed a Bayesian model to estimate individual admixture proportions and hybrid classes for sampled trees and for the unsampled pollen parent. Matings that included one or two hybrid parents were common, resulting in admixture proportions of progeny that spanned the whole range of potential ancestries between the two parental species. This result contrasts strongly with the distribution of admixture proportions in adult trees, where intermediate hybrids and each of the parental species are separated into three discrete ancestry clusters. The existence of the full range of hybrids in seedlings is consistent with weak reproductive isolation early in the life cycle of Populus. Instead, a considerable amount of selection must take place between the seedling stage and maturity to remove many hybrid seedlings. Our results highlight that high hybridization rates and appreciable hybrid fitness do not necessarily conflict with the maintenance of species integrity. © 2014 John Wiley & Sons Ltd.

  3. Changes in photosynthesis, mesophyll conductance to CO{sub 2}, and isoprenoid emissions in Populus nigra plants exposed to excess nickel

    Energy Technology Data Exchange (ETDEWEB)

    Velikova, Violeta, E-mail: violet@obzor.bio21.bas.bg [Bulgarian Academy of Sciences, Acad. M. Popov Institute of Plant Physiology, Acad. G. Bonchev, Bl. 21, 1113 Sofia (Bulgaria); Tsonev, Tsonko [Bulgarian Academy of Sciences, Acad. M. Popov Institute of Plant Physiology, Acad. G. Bonchev, Bl. 21, 1113 Sofia (Bulgaria); Loreto, Francesco [Consiglio Nazionale delle Ricerche, Istituto per la Protezione delle Piante, Via Madonna del Piano 10, 50019 Sesto Fiorentino, Firenze (Italy); Centritto, Mauro [Consiglio Nazionale delle Ricerche, Istituto di Biologia Agroambientale e Forestale, 00015 Monterotondo Scalo (RM) (Italy)

    2011-05-15

    Poplar (Populus nigra) plants were grown hydroponically with 30 and 200 {mu}M Ni (Ni{sub 30} and Ni{sub 200}). Photosynthesis limitations and isoprenoid emissions were investigated in two leaf types (mature and developing). Ni stress significantly decreased photosynthesis, and this effect depended on the leaf Ni content, which was lower in mature than in developing leaves. The main limitations to photosynthesis were attributed to mesophyll conductance and metabolism impairment. In Ni-stressed developing leaves, isoprene emission was significantly stimulated. We attribute such stimulation to the lower chloroplastic [CO{sub 2}] than in control leaves. However chloroplastic [CO{sub 2}] did not control isoprene emission in mature leaves. Ni stress induced the emission of cis-{beta}-ocimene in mature leaves, and of linalool in both leaf types. Induced biosynthesis and emission of isoprenoids reveal the onset of antioxidant processes that may also contribute to reduce Ni stress, especially in mature poplar leaves. - Graphical abstract: Visible damage caused by Ni treatment. 1 - Ni{sub 0} (control plants); 2 - Ni{sub 200}; M = mature and D = developing Populus nigra leaves. Display Omitted Highlights: > We study the effect of Ni pollution on photosynthesis and isoprenoid emissions. > Ni stress significantly decreases photosynthesis. The main limitations are attributed to mesophyll conductance and metabolism impairment. > Constitutive isoprene emission was significantly stimulated in Ni-stressed leaves. Exposure to enhanced Ni concentration induces cis-beta-ocimene and linalool emissions. - The study reveals consequences of Ni stress on plant physiology, namely increasing diffusional limitation to photosynthesis and isoprenoid emissions.

  4. Organ and Tissue-specific Sucrose Transporters. Important Hubs in Gene and Metabolite Networks Regulating Carbon Use in Wood-forming Tissues of Populus

    Energy Technology Data Exchange (ETDEWEB)

    Harding, Scott A. [Univ. of Georgia, Athens, GA (United States); Tsai, Chung-Jui [Univ. of Georgia, Athens, GA (United States)

    2016-01-04

    The overall project objective was to probe the relationship between sucrose transporters and plant productivity in the biomass for biofuels woody perennial, Populus. At the time the proposal was written, sucrose transporters had already been investigated in many plant model systems, primarily with respect to the export of photosynthate sucrose from source leaves, and the uptake of sucrose in storage organs and seeds. Preliminary findings by the PI found that in Populus, sucrose transporter genes (SUTs) were well expressed in wood-forming tissues that comprise the feedstock for biofuels production. Because sucrose comprises by far the predominant form in which photosynthate is delivered from source organs to sink organs like roots and wood-forming tissues, SUTs control a gate that nominally at least could impact the allocation or partitioning of sucrose for potentially competing end uses like growth (stem biomass) and storage. In addition, water use might be conditioned by the way in which sucrose is distributed throughout the plant, and/or by the way in which sucrose is partitioned intracellularly. Several dozen transgenic lines were produced in year 1 of the project to perturb the expression ratio of multiple plasma membrane (PM) SUTs (intercellular trafficking), versus the single tonoplast membrane (TM) sucrose transporter that effectively regulates intracellular trafficking of sucrose. It was possible to obtain transgenic lines with dual SUT gene knockdown using the 35S promoter, but not the wood-specific TUA1 promoter. By the end of project year 2, a decision was made to work with the 35S plants while archiving the TUA1 plants. The PhD candidate charged with producing the transgenic lines abandoned the project during its second year, substantially contributing to the decision to operate with just the 35S lines. That student’s interests ranged more toward evolutionary topics, and a report on SUT gene evolution was published (Peng et al 2014).

  5. Gender determination in populus

    Energy Technology Data Exchange (ETDEWEB)

    McLetchie, D.N. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Biological Sciences; Tuskan, G.A. [Oak Ridge National Lab., TN (United States)

    1994-12-31

    Gender, the expression of maleness or femaleness, in dioecious plants has been associated with changes in morphology, physiology, ecological position, and commercial importance of several species, including members of the Salicaceae family. Various mechanisms have been proposed to explain the expression of gender in Salicaceae, including sex chromosomes, simple Mendelian genes, quantitative genes, environment, and genotype-by-environment interactions. Published reports would favor a genetic basis for gender. The objective of this study was to identify molecular markers associated with gender in a segregating family of hybrid poplars. Bulked segregant analysis and chi-squared analysis were used to test for the occurrence of sex chromosomes, individual loci, and chromosome ratios (i.e., ploidy levels) as the mechanisms for gender determination. Examination of 2488 PCR based RAPD markers from 1219 primers revealed nine polymorphic bands between male and female bulked samples. However, linkage analysis indicated that none of these markers were significantly associated with gender. Chisquared results for difference in male-to-female ratios between diploid and triploid genotypes also revealed no significant differences. These findings suggest gender is not controlled via sex chromosomes, simple Mendelian loci or ratios of autosome to gender-determining loci. It is possible that gender is determined genetically by regions of the genome not sampled by the tested markers or by a complex of loci operating in an additive threshold manner or in an epistatic manner. It is also possible that gender is determined environmentally at an early zygote stage, canalizing gender expression.

  6. Construction of a full-length cDNA library and analysis of expressed ...

    African Journals Online (AJOL)

    ... in the GenBank databases. Cluster analysis allowed the identification of 61 unique sequences. These genes were classified into six types by Gene Ontology (GO) annotation. The results also indicated that unigenes of C. capsularis have higher homology to Populus trichocarpa, Ricinus communis and Corchorus olitorius.

  7. Evaluation of two hybrid poplar clones as constructed wetland plant species for treating saline water high in boron and selenium, or waters only high in boron

    Science.gov (United States)

    Wetland mesocosms were constructed to assess two salt- and B-tolerant hybrid poplar clones (Populus trichocarpa ×P. deltoides×P. nigra '345-1' and '347-14') for treating saline water high in boron (B) and selenium (Se). In addition, a hydroponic experiment was performed to test the B tolerance and B...

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Estimation of in situ mating systems in wild sorghum (Sorghum bicolor (L.) Moench) in .... is one of the novel chromosome regions influencing dough-mixing strength. ... Validation of PPP1R12B as a candidate gene for childhood asthma in Russians ... Genomewide analysis of the chitinase gene family in Populus trichocarpa.

  9. Efficacy of plastic mesh tubes in reducing herbivory damage by the invasive nutria (Myocastor coypus) in an urban restoration site

    Science.gov (United States)

    Sheffels, Trevor R.; Systma, Mark D.; Carter, Jacoby; Taylor, Jimmy D.

    2014-01-01

    The restoration of stream corridors is becoming an increasingly important component of urban landscape planning, and the high cost of these projects necessitates the need to understand and address potential ecological obstacles to project success. The nutria(Myocastor coypus) is an invasive, semi-aquatic rodent native to South America that causes detrimental ecological impacts in riparian and wetland habitats throughout its introduced range, and techniques are needed to reduce nutria herbivory damage to urban stream restoration projects. We assessed the efficacy of standard Vexar® plastic mesh tubes in reducing nutria herbivory damage to newly established woody plants. The study was conducted in winter-spring 2009 at Delta Ponds, a 60-ha urban waterway in Eugene, Oregon. Woody plants protected by Vexar® tubes demonstrated 100% survival over the 3-month initial establishment period, while only 17% of unprotected plantings survived. Nutria demonstrated a preference for black cottonwood (Populus balsamifera ssp trichocarpa) over red osier dogwood (Cornussericea) and willow (Salix spp). Camera surveillance showed that nutria were more active in unprotected rather than protected treatments. Our results suggest that Vexar® plastic mesh tubing can be an effective short-term herbivory mitigation tool when habitat use by nutria is low. Additionally, planting functionally equivalent woody plant species that are less preferred by nutria, and other herbivores, may be another method for reducing herbivory and improving revegetation success. This study highlights the need to address potential wildlife damage conflicts in the planning process for stream restoration in urban landscapes.

  10. Identification of five B-type response regulators as members of a multistep phosphorelay system interacting with histidine-containing phosphotransfer partners of Populus osmosensor

    Directory of Open Access Journals (Sweden)

    Bertheau Lucie

    2012-12-01

    Full Text Available Abstract Background In plants, the multistep phosphorelay signaling pathway mediates responses to environmental factors and plant hormones. This system is composed of three successive partners: hybrid Histidine-aspartate Kinases (HKs, Histidine-containing Phosphotransfer proteins (HPts, and Response Regulators (RRs. Among the third partners, B-type RR family members are the final output elements of the pathway; they act as transcription factors and clearly play a pivotal role in the early response to cytokinin in Arabidopsis. While interactions studies between partners belonging to the multistep phosphorelay system are mainly focused on protagonists involved in cytokinin or ethylene pathways, very few reports are available concerning partners of osmotic stress signaling pathway. Results In Populus, we identified eight B-type RR proteins, RR12-16, 19, 21 and 22 in the Dorskamp genotype. To assess HPt/B-type RR interactions and consequently determine potential third partners in the osmosensing multistep phosphorelay system, we performed global yeast two-hybrid (Y2H assays in combination with Bimolecular Fluorescence Complementation (BiFC assays in plant cells. We found that all B-type RRs are able to interact with HPt predominant partners (HPt2, 7 and 9 of HK1, which is putatively involved in the osmosensing pathway. However, different profiles of interaction are observed depending on the studied HPt. HPt/RR interactions displayed a nuclear localization, while the nuclear and cytosolic localization of HPt and nuclear localization of RR proteins were validated. Although the nuclear localization of HPt/RR interaction was expected, this work constitutes the first evidence of such an interaction in plants. Furthermore, the pertinence of this partnership is reinforced by highlighting a co-expression of B-type RR transcripts and the other partners (HK1 and HPts belonging to a potential osmosensing pathway. Conclusion Based on the interaction studies

  11. Determination of Fe, Hg, Mn, and Pb in three-rings of poplar (Populus alba L.) by U-shaped DC arc

    Science.gov (United States)

    Marković, D. M.; Novović, I.; Vilotić, D.; Ignjatović, Lj.

    2007-09-01

    The U-shaped DC arc with aerosol supply was applied for the determination of Fe, Hg, Mn, and Pb in poplar (Populus alba L.) tree-rings. By optimization of the operating parameters and by selection of the most appropriate signal integration time (20 s for Fe, Mn, and Pb and 30 s for Hg), the obtained limits of detection for Fe, Hg, Mn, and Pb are 5.8, 2.6, 1.6, and 2.0 ng/ml, respectively. The detection limits achieved by this method for Fe, Hg, Mn, and Pb are comparable with the detection limits obtained for these elements by such methods as inductively coupled plasma-atomic emission spectrometry (ICP-AES), direct coupled plasmatomic emission spectrometry (DCP-AES), and microwave-induced plasma-atomic emission spectrometry (MIP-AES). We used the tree-rings of poplar from two different locations. The first one is in the area close to the power plant “Nikola Tesla” TENT A, Obrenovac, while the other one is in the urban area of Novi Sad. In almost all cases, samples from the location at Obrenovac registered elevated average concentrations of Fe, Hg, Mn, and Pb in the tree-rings of poplar.

  12. Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China.

    Science.gov (United States)

    He, Xuemin; Lv, Guanghui; Qin, Lu; Chang, Shunli; Yang, Min; Yang, Jianjun; Yang, Xiaodong

    2015-01-01

    One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N). This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1) were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (Pdesert ecosystem of the Ebinur Lake area, N deposition indirectly changes the soil respiration rate by altering soil properties.

  13. Seasonal dynamics of the photosynthetic pigments content in Populus tremula L. leaves at the adaptation on an open-pit coal mine revegetating dump

    Directory of Open Access Journals (Sweden)

    Yu. V. Zagurskaya

    2017-02-01

    Full Text Available Seasonal dynamics of the basic photosynthetic pigments (a and b chlorophylls, carotenoids content in the samples of aspen Populus tremula during natural regeneration on a revegetating pit dump of a worked-out coal pit has been studied. The studies were conducted every ten days during the vegetation period in 2015 (June–September on the territory of «Yuzhniy» dump of «Kedrovskiy» open-pit coal mine (Kemerovo region. The pigment content was identified by the means of spectrophotometric detection. The content of photosynthetic pigments in aspen leaves was calculated on oven-dry weight of the leaves, as moisture aspen leaves can greatly vary, and the determination of accuracy of dry matter content higher than the for specific gravity of the sheet. No changes in visible absorption spectrum of acetone extracts indicating pheophytin formation in chlorophylls have been identified. For all variants the larger amount of b chlorophyll was contained in control samples. The largest differences in a/b chlorophylls and chlorophylls/carotenoids ratio were observed in the end of vegetation period. The ratio between a and b chlorophylls of aspen leaves in both cases by the end of the season was considerably lower. The adaptation of aspen photosynthetic system to the revegetating dump conditions was performed due to decrease in the total pigment content and the percent of b chlorophyll in their composition.

  14. Down-regulation of KORRIGAN-like endo-β-1,4-glucanase genes impacts carbon partitioning, mycorrhizal colonization and biomass production in Populus

    Directory of Open Access Journals (Sweden)

    Udaya C Kalluri

    2016-10-01

    Full Text Available A greater understanding of the genetic regulation of plant cell wall remodeling and the impact of modified cell walls on plant performance is important for the development of sustainable biofuel crops. Here, we studied the impact of down-regulating KORRIGAN-like cell wall biosynthesis genes, belonging to the endo-β-1,4-glucanase gene family, on Populus growth, metabolism and the ability to interact with symbiotic microbes. The reductions in cellulose content and lignin syringyl-to-guaiacyl unit ratio, and increase in cellulose crystallinity of cell walls of PdKOR RNAi plants corroborated the functional role of PdKOR in cell wall biosynthesis. Altered metabolism and reduced growth characteristics of RNAi plants revealed new implications on carbon allocation and partitioning. The distinctive metabolome phenotype comprised of a higher phenolic and salicylic acid content, and reduced lignin, shikimic acid and maleic acid content relative to control. Plant sustainability implications of modified cell walls on beneficial plant-microbe interactions were explored via co-culture with an ectomycorrhizal fungus, Laccaria bicolor. A significant increase in the mycorrhization rate was observed in transgenic plants, leading to measurable beneficial growth effects. These findings present new evidence for functional interconnectedness of cellulose biosynthesis pathway, metabolism and mycorrhizal association in plants, and further emphasize the consideration of the sustainability implications of plant trait improvement efforts.

  15. Populus balsamifera Extract and Its Active Component Salicortin Reduce Obesity and Attenuate Insulin Resistance in a Diet-Induced Obese Mouse Model

    Directory of Open Access Journals (Sweden)

    Despina Harbilas

    2013-01-01

    Full Text Available Populus balsamifera L. (BP is a medicinal plant stemming from the traditional pharmacopoeia of the Cree of Eeyou Istchee (CEI—Northern Quebec. In vitro screening studies revealed that it strongly inhibited adipogenesis in 3T3-L1 adipocytes, suggesting potential antiobesity activity. Salicortin was identified, through bioassay-guided fractionation, as the active component responsible for BP’s activity. The present study aimed to assess the potential of BP and salicortin at reducing obesity and features of the metabolic syndrome, in diet-induced obese C57Bl/6 mice. Mice were subjected to high fat diet (HFD for sixteen weeks, with BP (125 or 250 mg/kg or salicortin (12.5 mg/kg introduced in the HFD for the last eight of the sixteen weeks. BP and salicortin effectively reduced whole body and retroperitoneal fat pad weights, as well as hepatic triglyceride accumulation. Glycemia, insulinemia, leptin, and adiponectin levels were also improved. This was accompanied by a small yet significant reduction in food intake in animals treated with BP. BP and salicortin (slightly also modulated key components in signaling pathways involved with glucose regulation and lipid oxidation in the liver, muscle, and adipose tissue. These results confirm the validity of the CEI pharmacopoeia as alternative and complementary antiobesity and antidiabetic therapies.

  16. Genome-wide patterns of differentiation and spatially varying selection between postglacial recolonization lineages of Populus alba (Salicaceae), a widespread forest tree.

    Science.gov (United States)

    Stölting, Kai N; Paris, Margot; Meier, Cécile; Heinze, Berthold; Castiglione, Stefano; Bartha, Denes; Lexer, Christian

    2015-08-01

    Studying the divergence continuum in plants is relevant to fundamental and applied biology because of the potential to reveal functionally important genetic variation. In this context, whole-genome sequencing (WGS) provides the necessary rigour for uncovering footprints of selection. We resequenced populations of two divergent phylogeographic lineages of Populus alba (n = 48), thoroughly characterized by microsatellites (n = 317), and scanned their genomes for regions of unusually high allelic differentiation and reduced diversity using > 1.7 million single nucleotide polymorphisms (SNPs) from WGS. Results were confirmed by Sanger sequencing. On average, 9134 high-differentiation (≥ 4 standard deviations) outlier SNPs were uncovered between populations, 848 of which were shared by ≥ three replicate comparisons. Annotation revealed that 545 of these were located in 437 predicted genes. Twelve percent of differentiation outlier genome regions exhibited significantly reduced genetic diversity. Gene ontology (GO) searches were successful for 327 high-differentiation genes, and these were enriched for 63 GO terms. Our results provide a snapshot of the roles of 'hard selective sweeps' vs divergent selection of standing genetic variation in distinct postglacial recolonization lineages of P. alba. Thus, this study adds to our understanding of the mechanisms responsible for the origin of functionally relevant variation in temperate trees. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  17. Symplasmic, long-distance transport in xylem and cambial regions in branches of Acer pseudoplatanus (Aceraceae) and Populus tremula x P. tremuloides (Salicaceae).

    Science.gov (United States)

    Sokołowska, Katarzyna; Zagórska-Marek, Beata

    2012-11-01

    The picture of how long-distance transport proceeds in trees is still far from being complete. Beside the apoplasmic pathway, transport undoubtedly also takes place within the system of living cells in the secondary xylem and cambial region. Because detailed, thorough studies of the symplasmic routes in woody branches, using direct localization with fluorescent tracers, had not been done, here we focused on the main routes of long-distance symplasmic transport in xylem and cambial tissues and analyzed in detail tracer distribution in the rays on the extended cambial surface in branches of Acer pseudoplatanus and Populus tremula ×P. tremuloides. Fluorescent tracers were loaded into branches through the vascular system, then their distribution in xylem and cambial regions was analyzed. Tracer signal was present in the symplast of axial and radial xylem parenchyma cells and in both types of cambial cells. The living cells of xylem parenchyma and of the cambium were symplasmically interconnected via xylem rays. Tracer distribution in rays was uneven on the extended cambial surface; cambial regions with intensively or sparsely dyed rays alternated along the vertical axis of analyzed branches. Symplasmic, long-distance transport is present between the living cells of xylem and the cambial region in woody branches. The uneven distribution of fluorescent tracers in cambial rays along the stems is surprising and suggests the presence of an intrinsic pattern caused by an unknown mechanism.

  18. Evaluation of drought response of two poplar clones (Populus x canadensis Monch 'I-214' and P. deltoides Marsh. 'Dvina') through high resolution analysis of stem growth.

    Science.gov (United States)

    Giovannelli, Alessio; Deslauriers, Annie; Fragnelli, Giuseppe; Scaletti, Luciano; Castro, Gaetano; Rossi, Sergio; Crivellaro, Alan

    2007-01-01

    Different irrigation effects on stem radius variation (DeltaR) and maximum daily shrinkage (MDS) in Populus deltoides 'Dvina' and Populusxcanadensis 'I-214' were studied to assess differences in drought tolerance between clones. One-year-old trees growing in concrete tanks were submitted to two irrigation regimes (natural rainfall and irrigation) from 24 June to 10 August, and DeltaR was monitored by automatic point dendrometers. Independently of the irrigation regime, 'Dvina' showed a higher stem radial increment than 'I-214'. In both clones, the first response to changed soil water content was a significant increase in MDS, whilst DeltaR decreased about 20 d later when pre-dawn leaf water potential (Psipd) dropped below -0.4 MPa. However, they displayed different strategies to overcome drought. 'Dvina' maintained a positive DeltaR for longer than 'I-214', which had lower leaf Psipd and greater leaf abscission at the end of the drought period. After irrigation resumed, 'Dvina' showed a higher capacity to restore stem growth. 'I-214' was probably unable to recover secondary growth because of higher leaf abscission during drought stress and the production of newly expanded leaves during recovery. It is concluded that the larger radial growth of 'Dvina' derived from a better water use (carbon uptake versus water loss) than 'I-214' under limited water availability.

  19. Significant differences in gene expression and key genetic components associated with high growth vigor in populus section tacamahaca as revealed by comparative transcriptome analysis

    International Nuclear Information System (INIS)

    Cheng, S.; Chen, M.; Li, Y.; Wang, J.; Sun, X.; Wang, J.

    2017-01-01

    To identify genetic components involved in high growth vigor in F1 Populus section Tacamahaca hybrid plants, high and low vigor plants showing significant differences in apical dominance during a rapid growth period were selected. Apical bud transcriptomes of high and low-growth-vigor hybrids and their parents were analyzed using high-throughput RNA sequencing on an Illumina HiSeq 2000 platform. A total of 5,542 genes were differently expressed between high growth vigor hybrid and its parents, the genes were significantly enriched in pathways related to processes such as photosynthesis, pyrimidine ribonucleotide biosynthetic processes and nucleoside metabolic processes. There were 1410 differentially expressed genes between high and low growth vigor hybrid, the genes were mainly involved in photosynthesis, chlorophyll biosynthetic process, carbon fixation in photosynthetic organisms, porphyrin and chlorophyll metabolism and nitrogen metabolism. Moreover, a k-core of a gene co-expression network analysis was performed to identify the potential functions of genes related to high growth vigor. The functions of 8 selected candidate genes were associated mainly with circadian rhythm, water transport, cellulose catabolic processes, sucrose biosynthesis, pyrimidine ribonucleotide biosynthesis, purine nucleotide biosynthesis, meristem maintenance, and carbohydrate metabolism. Our results may contribute to a better understanding of the molecular basis of high growth vigor in hybrids and its regulation. (author)

  20. A survey of poplar (populus nigra rust and identification of fungal agent species with conventional and molecular approaches in Maragheh area of Iran.

    Directory of Open Access Journals (Sweden)

    Seyed Mohsen Damadi

    2014-12-01

    Full Text Available In a survey for rust diseases in Maragheh area rust symptoms were observed on poplars (Populus nigra in Maragheh city parks and orchards near the city. Uredinia and urediniospores typical of Melampsora were present on the underside of leaves. Paraphyses were clavate with walls evenly thick and Telia, formed on the leaves early in the autumn, were epiphyllous and subepidermal. DNA was extracted from urediniospores and the primers ITS1 and ITS4 were used to amplify the internal transcribed spacer region of the ribosomal DNA. Based on the key provided by Bagyanarayana and the species description by Pei and Shang, and the result of sequencing, the causal agent was identified as Melampsora allii-populina Kelb. Melampsora species are mainly determined based on their morphology, alternate hosts and telial host range. However, in most cases, only one or two spore stages could be found at the time of observation and there is no information of the alternate hosts. This is the first study of poplar rust disease to the species level in the area. Rust disease is likely to be the most important disease on poplar in this area. As poplar rust can cause severe damages to nursery plants and young trees, there must be further research to understand the epidemiology of the rust disease. A key question to be answered is whether the rust goes through a full life-cycle, possible via known alternate host Allium spp. or only uredinial and telial stages are present in the studied area.

  1. Understanding the role of the cytoskeleton in wood formation in angiosperm trees: hybrid aspen (Populus tremula x P. tremuloides) as a model species

    Energy Technology Data Exchange (ETDEWEB)

    Chaffey, N.; Barlow, P. [Bristol Univ., Dept. of Agricultural Sciences, Long Ashton, (United Kingdom); Sundberg, B. [Swedish Univ. of Agricultural Sciences, Dept. of Forest Genetics and Plant Physiology, Umea (Sweden)

    2002-03-01

    The involvement of microfilaments (MFs) and microtubules (MTs) in the development of the radial and axial components of secondary wood in hybrid aspen (Populus tremula X P. tremuloides) was studied by indirect immunofluorescent localization techniques in order to elucidate a consensus view of the roles of the cytoskeleton during wood formation in angiosperm trees. Early and late vessel elements, axial parenchyma, normal-wood fibres and contact and isolation cells were included in addition to cambial cells. Microfilaments were found to be rare in cambial cells, but were abundant and axially arranged in their derivatives once cell elongation begun. Microtubules were randomly oriented in ray and fusiform cells of the cambial zone. Ellipses of microfilaments were associated with pit development in fiber cells and isolation ray cells. Rings of localized microtubules and microfilaments were associated with developing inter-vessel bordered pits and vessel-contact ray cell contact pits. Although only microtubules were seen in the periphery of the perforation plate of vessel elements, a prominent meshwork of microfilaments overlaid the perforation plate itself. These observations indicate that there are corresponding subcellular control points whose manipulation could lead to the development of 'designer wood'. However, such development would require a better understanding of the physiological basis for the behaviour of microtubule and microfibre cytoskeletons during wood formation. 44 refs., 6 figs.

  2. PHYTOALEXIN DEFICIENT 4 affects reactive oxygen species metabolism, cell wall and wood properties in hybrid aspen (Populus tremula L. × tremuloides).

    Science.gov (United States)

    Ślesak, Ireneusz; Szechyńska-Hebda, Magdalena; Fedak, Halina; Sidoruk, Natalia; Dąbrowska-Bronk, Joanna; Witoń, Damian; Rusaczonek, Anna; Antczak, Andrzej; Drożdżek, Michał; Karpińska, Barbara; Karpiński, Stanisław

    2015-07-01

    The phytoalexin deficient 4 (PAD4) gene in Arabidopsis thaliana (AtPAD4) is involved in the regulation of plant--pathogen interactions. The role of PAD4 in woody plants is not known; therefore, we characterized its function in hybrid aspen and its role in reactive oxygen species (ROS)-dependent signalling and wood development. Three independent transgenic lines with different suppression levels of poplar PAD expression were generated. All these lines displayed deregulated ROS metabolism, which was manifested by an increased H2O2 level in the leaves and shoots, and higher activities of manganese superoxide dismutase (MnSOD) and catalase (CAT) in the leaves in comparison to the wild-type plants. However, no changes in non-photochemical quenching (NPQ) between the transgenic lines and wild type were observed in the leaves. Moreover, changes in the ROS metabolism in the pad4 transgenic lines positively correlated with wood formation. A higher rate of cell division, decreased tracheid average size and numbers, and increased cell wall thickness were observed. The results presented here suggest that the Populus tremula × tremuloides PAD gene might be involved in the regulation of cellular ROS homeostasis and in the cell division--cell death balance that is associated with wood development. © 2014 John Wiley & Sons Ltd.

  3. A single European aspen (Populus tremula) tree individual may potentially harbour dozens of Cenococcum geophilum ITS genotypes and hundreds of species of ectomycorrhizal fungi.

    Science.gov (United States)

    Bahram, Mohammad; Põlme, Sergei; Kõljalg, Urmas; Tedersoo, Leho

    2011-02-01

    Ectomycorrhizal fungi (EcMF) form diverse communities and link different host plants into mycorrhizal networks, yet little is known about the magnitude of mycobiont diversity of a single tree individual. This study addresses species richness and spatial structure of EcMF in the root system of a single European aspen (Populus tremula) individual in an old-growth boreal mixed forest ecosystem in Estonia. Combining morphological and molecular identification methods for both plant and fungi, 122 species of EcMF were recovered from 103 root samples of the single tree. Richness estimators predicted the total EcMF richness to range from 182 to 207 species, reflecting the observation of 62.3% singletons and doubletons within the community. Fine-scale genetic diversity in Cenococcum geophilum indicates the presence of 23 internal transcribed spacer genotypes. EcMF community was significantly spatially autocorrelated only at the lineage level up to 3 m distance, but not at the species level. Proximity of other hosts had a significant effect on the spatial distribution of EcMF lineages. This study demonstrates that a single tree may host as many EcMF species and individuals as recovered on multiple hosts in diverse communities over larger areas. © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  4. The impact of vessel size on vulnerability curves: data and models for within-species variability in saplings of aspen, Populus tremuloides Michx.

    Science.gov (United States)

    Cai, Jing; Tyree, Melvin T

    2010-07-01

    The objective of this study was to quantify the relationship between vulnerability to cavitation and vessel diameter within a species. We measured vulnerability curves (VCs: percentage loss hydraulic conductivity versus tension) in aspen stems and measured vessel-size distributions. Measurements were done on seed-grown, 4-month-old aspen (Populus tremuloides Michx) grown in a greenhouse. VCs of stem segments were measured using a centrifuge technique and by a staining technique that allowed a VC to be constructed based on vessel diameter size-classes (D). Vessel-based VCs were also fitted to Weibull cumulative distribution functions (CDF), which provided best-fit values of Weibull CDF constants (c and b) and P(50) = the tension causing 50% loss of hydraulic conductivity. We show that P(50) = 6.166D(-0.3134) (R(2) = 0.995) and that b and 1/c are both linear functions of D with R(2) > 0.95. The results are discussed in terms of models of VCs based on vessel D size-classes and in terms of concepts such as the 'pit area hypothesis' and vessel pathway redundancy.

  5. Linking the Salt Transcriptome with Physiological Responses of a Salt-Resistant Populus Species as a Strategy to Identify Genes Important for Stress Acclimation1[W][OA

    Science.gov (United States)

    Brinker, Monika; Brosché, Mikael; Vinocur, Basia; Abo-Ogiala, Atef; Fayyaz, Payam; Janz, Dennis; Ottow, Eric A.; Cullmann, Andreas D.; Saborowski, Joachim; Kangasjärvi, Jaakko; Altman, Arie; Polle, Andrea

    2010-01-01

    To investigate early salt acclimation mechanisms in a salt-tolerant poplar species (Populus euphratica), the kinetics of molecular, metabolic, and physiological changes during a 24-h salt exposure were measured. Three distinct phases of salt stress were identified by analyses of the osmotic pressure and the shoot water potential: dehydration, salt accumulation, and osmotic restoration associated with ionic stress. The duration and intensity of these phases differed between leaves and roots. Transcriptome analysis using P. euphratica-specific microarrays revealed clusters of coexpressed genes in these phases, with only 3% overlapping salt-responsive genes in leaves and roots. Acclimation of cellular metabolism to high salt concentrations involved remodeling of amino acid and protein biosynthesis and increased expression of molecular chaperones (dehydrins, osmotin). Leaves suffered initially from dehydration, which resulted in changes in transcript levels of mitochondrial and photosynthetic genes, indicating adjustment of energy metabolism. Initially, decreases in stress-related genes were found, whereas increases occurred only when leaves had restored the osmotic balance by salt accumulation. Comparative in silico analysis of the poplar stress regulon with Arabidopsis (Arabidopsis thaliana) orthologs was used as a strategy to reduce the number of candidate genes for functional analysis. Analysis of Arabidopsis knockout lines identified a lipocalin-like gene (AtTIL) and a gene encoding a protein with previously unknown functions (AtSIS) to play roles in salt tolerance. In conclusion, by dissecting the stress transcriptome of tolerant species, novel genes important for salt endurance can be identified. PMID:20959419

  6. Linking the salt transcriptome with physiological responses of a salt-resistant Populus species as a strategy to identify genes important for stress acclimation.

    Science.gov (United States)

    Brinker, Monika; Brosché, Mikael; Vinocur, Basia; Abo-Ogiala, Atef; Fayyaz, Payam; Janz, Dennis; Ottow, Eric A; Cullmann, Andreas D; Saborowski, Joachim; Kangasjärvi, Jaakko; Altman, Arie; Polle, Andrea

    2010-12-01

    To investigate early salt acclimation mechanisms in a salt-tolerant poplar species (Populus euphratica), the kinetics of molecular, metabolic, and physiological changes during a 24-h salt exposure were measured. Three distinct phases of salt stress were identified by analyses of the osmotic pressure and the shoot water potential: dehydration, salt accumulation, and osmotic restoration associated with ionic stress. The duration and intensity of these phases differed between leaves and roots. Transcriptome analysis using P. euphratica-specific microarrays revealed clusters of coexpressed genes in these phases, with only 3% overlapping salt-responsive genes in leaves and roots. Acclimation of cellular metabolism to high salt concentrations involved remodeling of amino acid and protein biosynthesis and increased expression of molecular chaperones (dehydrins, osmotin). Leaves suffered initially from dehydration, which resulted in changes in transcript levels of mitochondrial and photosynthetic genes, indicating adjustment of energy metabolism. Initially, decreases in stress-related genes were found, whereas increases occurred only when leaves had restored the osmotic balance by salt accumulation. Comparative in silico analysis of the poplar stress regulon with Arabidopsis (Arabidopsis thaliana) orthologs was used as a strategy to reduce the number of candidate genes for functional analysis. Analysis of Arabidopsis knockout lines identified a lipocalin-like gene (AtTIL) and a gene encoding a protein with previously unknown functions (AtSIS) to play roles in salt tolerance. In conclusion, by dissecting the stress transcriptome of tolerant species, novel genes important for salt endurance can be identified.

  7. Genetic variation of the riparian pioneer tree species populus nigra. II. Variation In susceptibility to the foliar rust melampsora larici-populina

    Science.gov (United States)

    Legionnet; Muranty; Lefevre

    1999-04-01

    Partial resistance of Populus nigra L. to three races of the foliar rust Melampsora larici-populina Kleb. was studied in a field trial and in laboratory tests, using a collection of P. nigra originating from different places throughout France. No total resistance was found. The partial resistance was split into epidemiological components, which proved to be under genetic control. Various patterns of association of epidemiological components values were found. Principal components analysis revealed their relationships. Only 24% of the variance of the field susceptibility could be explained by the variation of the epidemiological components of susceptibility. This variable was significantly correlated with susceptibility to the most ancient and widespread race of the pathogen, and with the variables related to the size of the lesions of the different races. Analysis of variance showed significant differences in susceptibility between regions and between stands within one region. Up to 20% of variation was between regions, and up to 22% between stands, so that these genetic factors appeared to be more differentiated than the neutral diversity (up to 3.5% Legionnet & Lefevre, 1996). However, no clear pattern of geographical distribution of diversity was detected.

  8. Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China

    Science.gov (United States)

    He, Xuemin; Lv, Guanghui; Qin, Lu; Chang, Shunli; Yang, Min; Yang, Jianjun; Yang, Xiaodong

    2015-01-01

    One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N). This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1) were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (Psoil respiration rate by approximately 66.7±2.7% (Psoil moisture, whereas N deposition significantly increased the soil temperature in the 0–5 cm layer (Psoil respiration rate by altering soil properties. PMID:26379186

  9. Diurnal changes in photosynthetic parameters of Populus tremuloides, modulated by elevated concentrations of CO2 and/or O3 and daily climatic variation

    International Nuclear Information System (INIS)

    Kets, Katre; Darbah, Joseph N.T.; Sober, Anu; Riikonen, Johanna; Sober, Jaak; Karnosky, David F.

    2010-01-01

    The diurnal changes in light-saturated photosynthesis (Pn) under elevated CO 2 and/or O 3 in relation to stomatal conductance (g s ), water potential, intercellular [CO 2 ], leaf temperature and vapour-pressure difference between leaf and air (VPD L ) were studied at the Aspen FACE site. Two aspen (Populus tremuloides Michx.) clones differing in their sensitivity to ozone were measured. The depression in Pn was found after 10:00 h. The midday decline in Pn corresponded with both decreased g s and decreased Rubisco carboxylation efficiency, Vc max . As a result of increasing VPD L , g s decreased. Elevated [CO 2 ] resulted in more pronounced midday decline in Pn compared to ambient concentrations. Moreover, this decline was more pronounced under combined treatment compared to elevated CO 2 treatment. The positive impact of CO 2 on Pn was relatively more pronounced in days with environmental stress but relatively less pronounced during midday depression. The negative impact of ozone tended to decrease in both cases. - Diurnal and seasonal patterns of environmental stress (drought, high air temperature) affects a relative impact of elevated concentrations of CO 2 and O 3 on trees.

  10. Vapour pressure deficit during growth has little impact on genotypic differences of transpiration efficiency at leaf and whole-plant level: an example from Populus nigra L.

    Science.gov (United States)

    Rasheed, Fahad; Dreyer, Erwin; Richard, Béatrice; Brignolas, Franck; Brendel, Oliver; Le Thiec, Didier

    2015-04-01

    Poplar genotypes differ in transpiration efficiency (TE) at leaf and whole-plant level under similar conditions. We tested whether atmospheric vapour pressure deficit (VPD) affected TE to the same extent across genotypes. Six Populus nigra genotypes were grown under two VPD. We recorded (1) (13)C content in soluble sugars; (2) (18)O enrichment in leaf water; (3) leaf-level gas exchange; and (4) whole-plant biomass accumulation and water use. Whole-plant and intrinsic leaf TE and (13)C content in soluble sugars differed significantly among genotypes. Stomatal conductance contributed more to these differences than net CO2 assimilation rate. VPD increased water use and reduced whole-plant TE. It increased intrinsic leaf-level TE due to a decline in stomatal conductance. It also promoted higher (18)O enrichment in leaf water. VPD had no genotype-specific effect. We detected a deviation in the relationship between (13)C in leaf sugars and (13)C predicted from gas exchange and the standard discrimination model. This may be partly due to genotypic differences in mesophyll conductance, and to its lack of sensitivity to VPD. Leaf-level (13)C discrimination was a powerful predictor of the genetic variability of whole-plant TE irrespective of VPD during growth. © 2014 John Wiley & Sons Ltd.

  11. The influence of liming on soil chemical properties and on the alleviation of manganese and copper toxicity in Juglans regia, Robinia pseudoacacia, Eucalyptus sp. and Populus sp. plantations.

    Science.gov (United States)

    Chatzistathis, T; Alifragis, D; Papaioannou, A

    2015-03-01

    Juglans regia, Robinia pseudoacacia, Eucalyptus sp. and Populus sp. plantations, suffering from Mn and Cu toxicity, were limed in order to reduce Cu and Mn solubility in soil. The purposes of the present work were: i) to study the changes in soil chemical properties after the addition of CaCO3, ii) to investigate the influence of liming on the reduction of Mn and Cu toxicity. After the addition of CaCO3 (three applications, during three successive years), pH and CaCO3 content were significantly increased, while organic C and N were significantly reduced. Exchangeable Ca concentrations have been slightly, or significantly, increased, while those of Mg have been decreased; in addition, ratios Ca/Mg and C/N have been significantly increased after liming. Impressive reductions of DTPA extractable Cu and Mn concentrations (more than 10 times in most cases) were recorded. It was also found that trees without Mn and Cu toxicity symptoms (healthy tress) before liming did not have, in many cases, significantly greater leaf Mn, Cu and Fe concentrations, than trees after soil liming (all the trees were healthy). This probably happened because excess Mn and Cu quantities had been accumulated into their root system. Finally, leaf Mn, Cu and Zn concentrations of trees suffering from toxicity were significantly decreased after soil liming, while leaf Fe concentrations, in all the plant species studied, were increased. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. Chilling of dormant buds hyperinduces FLOWERING LOCUS T and recruits GA-inducible 1,3-beta-glucanases to reopen signal conduits and release dormancy in Populus.

    Science.gov (United States)

    Rinne, Päivi L H; Welling, Annikki; Vahala, Jorma; Ripel, Linda; Ruonala, Raili; Kangasjärvi, Jaakko; van der Schoot, Christiaan

    2011-01-01

    In trees, production of intercellular signals and accessibility of signal conduits jointly govern dormancy cycling at the shoot apex. We identified 10 putative cell wall 1,3-β-glucanase genes (glucan hydrolase family 17 [GH17]) in Populus that could turn over 1,3-β-glucan (callose) at pores and plasmodesmata (PD) and investigated their regulation in relation to FT and CENL1 expression. The 10 genes encode orthologs of Arabidopsis thaliana BG_ppap, a PD-associated glycosylphosphatidylinositol (GPI) lipid-anchored protein, the Arabidopsis PD callose binding protein PDCB, and a birch (Betula pendula) putative lipid body (LB) protein. We found that these genes were differentially regulated by photoperiod, by chilling (5°C), and by feeding of gibberellins GA(3) and GA(4). GA(3) feeding upregulated all LB-associated GH17s, whereas GA(4) upregulated most GH17s with a GPI anchor and/or callose binding motif, but only GA(4) induced true bud burst. Chilling upregulated a number of GA biosynthesis and signaling genes as well as FT, but not CENL1, while the reverse was true for both GA(3) and GA(4). Collectively, the results suggest a model for dormancy release in which chilling induces FT and both GPI lipid-anchored and GA(3)-inducible GH17s to reopen signaling conduits in the embryonic shoot. When temperatures rise, the reopened conduits enable movement of FT and CENL1 to their targets, where they drive bud burst, shoot elongation, and morphogenesis.

  13. [Exploration of a quantitative methodology to characterize the retention of PM2.5 and other atmospheric particulate matter by plant leaves: taking Populus tomentosa as an example].

    Science.gov (United States)

    Zhang, Zhi-Dan; Xi, Ben-Ye; Cao, Zhi-Guo; Jia, Li-Ming

    2014-08-01

    Taking Populus tomentosa as an example, a methodology called elution-weighing-particle size-analysis (EWPA) was proposed to evaluate quantitatively the ability of retaining fine particulate matter (PM2.5, diameter d ≤ 2.5 μm) and atmospheric particulate matter by plant leaves using laser particle size analyzer and balance. This method achieved a direct, accurate measurement with superior operability about the quality and particle size distribution of atmospheric particulate matter retained by plant leaves. First, a pre-experiment was taken to test the stability of the method. After cleaning, centrifugation and drying, the particulate matter was collected and weighed, and then its particle size distribution was analyzed by laser particle size analyzer. Finally, the mass of particulate matter retained by unit area of leaf and stand was translated from the leaf area and leaf area index. This method was applied to a P. tomentosa stand which had not experienced rain for 27 days in Beijing Olympic Forest Park. The results showed that the average particle size of the atmospheric particulate matter retained by P. tomentosa was 17.8 μm, and the volume percentages of the retained PM2.5, inhalable particulate matter (PM10, d ≤ 10 μm) and total suspended particle (TSP, d ≤ 100 μm) were 13.7%, 47.2%, and 99.9%, respectively. The masses of PM2.5, PM10, TSP and total particulate matter were 8.88 x 10(-6), 30.6 x 10(-6), 64.7 x 10(-6) and 64.8 x 10(-6) g x cm(-2) respectively. The retention quantities of PM2.5, PM10, TSP and total particulate matter by the P. tomentosa stand were 0.963, 3.32, 7.01 and 7.02 kg x hm(-2), respectively.

  14. Testing a hydraulic trait based model of stomatal control: results from a controlled drought experiment on aspen (Populus tremuloides, Michx.) and ponderosa pine (Pinus ponderosa, Douglas)

    Science.gov (United States)

    Love, D. M.; Venturas, M.; Sperry, J.; Wang, Y.; Anderegg, W.

    2017-12-01

    Modeling approaches for tree stomatal control often rely on empirical fitting to provide accurate estimates of whole tree transpiration (E) and assimilation (A), which are limited in their predictive power by the data envelope used to calibrate model parameters. Optimization based models hold promise as a means to predict stomatal behavior under novel climate conditions. We designed an experiment to test a hydraulic trait based optimization model, which predicts stomatal conductance from a gain/risk approach. Optimal stomatal conductance is expected to maximize the potential carbon gain by photosynthesis, and minimize the risk to hydraulic transport imposed by cavitation. The modeled risk to the hydraulic network is assessed from cavitation vulnerability curves, a commonly measured physiological trait in woody plant species. Over a growing season garden grown plots of aspen (Populus tremuloides, Michx.) and ponderosa pine (Pinus ponderosa, Douglas) were subjected to three distinct drought treatments (moderate, severe, severe with rehydration) relative to a control plot to test model predictions. Model outputs of predicted E, A, and xylem pressure can be directly compared to both continuous data (whole tree sapflux, soil moisture) and point measurements (leaf level E, A, xylem pressure). The model also predicts levels of whole tree hydraulic impairment expected to increase mortality risk. This threshold is used to estimate survivorship in the drought treatment plots. The model can be run at two scales, either entirely from climate (meteorological inputs, irrigation) or using the physiological measurements as a starting point. These data will be used to study model performance and utility, and aid in developing the model for larger scale applications.

  15. The effects of gamma irradiation on growth and expression of genes encoding DNA repair-related proteins in Lombardy poplar (Populus nigra var. italica).

    Science.gov (United States)

    Nishiguchi, Mitsuru; Nanjo, Tokihiko; Yoshida, Kazumasa

    2012-07-01

    In this study, to elucidate the mechanisms of adaptation and tolerance to ionizing radiation in woody plants, we investigated the various biological effects of γ-rays on the Lombardy poplar (Populus nigra L. var. italica Du Roi). We detected abnormal leaf shape and color, fusion, distorted venation, shortened internode, fasciation and increased axillary shoots in γ-irradiated poplar plants. Acute γ-irradiation with a dose of 100Gy greatly reduced the height, stem diameter and biomass of poplar plantlets. After receiving doses of 200 and 300Gy, all the plantlets stopped growing, and then most of them withered after 4-10 weeks of γ-irradiation. Comet assays showed that nuclear DNA in suspension-cultured poplar cells had been damaged by γ-rays. To determine whether DNA repair-related proteins are involved in the response to γ-rays in Lombardy poplars, we cloned the PnRAD51, PnLIG4, PnKU70, PnXRCC4, PnPCNA and PnOGG1 cDNAs and investigated their mRNA expression. The PnRAD51, PnLIG4, PnKU70, PnXRCC4 and PnPCNA mRNAs were increased by γ-rays, but the PnOGG1 mRNA was decreased. Moreover, the expression of PnLIG4, PnKU70 and PnRAD51 was also up-regulated by Zeocin known as a DNA cleavage agent. These observations suggest that the morphogenesis, growth and protective gene expression in Lombardy poplars are severely affected by the DNA damage and unknown cellular events caused by γ-irradiation. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Management of Animal Carcass Disposal Sites Using a Biochar Permeable Reactive Barrier and Fast Growth Tree (Populus euramericana: A Field Study in Korea

    Directory of Open Access Journals (Sweden)

    Jung-Hwan Yoon

    2017-03-01

    Full Text Available Among many disposal options of animal carcasses due to animal diseases including foot-and-mouth disease (FMD and avian influenza (AI, on-farm burial has been the most frequently used one in Korea. Animal carcasses generate contaminants such as ammonium-N and chloride. This study aimed at testing biochar (BC as a permeable reactive barrier (PRB material in combination with fast growing tree species (Populus euramericana to mitigate groundwater pollution from animal burial sites. For this, a PRB filled with BC was installed and 400 poplar tree (P. euramericana seedlings were planted. Tested BC was obtained from rice husk and its efficiency to mitigate contaminant migration from a burial site of pig carcasses was tested using ammonium-N, chloride, electrical conductivity (EC, and pH as monitoring parameters. Monitoring wells downstream from the burial site were used. Leachates from a monitoring well, three wells inside the burial site close to PRB and three wells outside the burial site close to PRB were sampled and analyzed for ammonium-N, Cl−, EC, and pH for four years from PRB installation. The pH, EC, and ammonium-N of leachate fluctuated during the test period depending on precipitation. pH, EC, and ammonium-N of the leachate samples collected from outside of the burial site close to PRB decreased compared to those from inside of the burial site close to PRB. The concentrations of ammonium-N in the leachate from the monitoring well kept under the threshold value of 10 mg·L−1 for two years from PRB construction. In addition, the growth of poplar plants appeared to be increased via uptaking available N and P released from the burial sites. Achieved results suggest that BC PRBs can be used to in situ mitigate contaminant release from buried animal carcasses.

  17. The effects of groundwater depth on water uptake of Populus euphratica and Tamarix ramosissima in the hyperarid region of Northwestern China.

    Science.gov (United States)

    Chen, Yapeng; Chen, Yaning; Xu, Changchun; Li, Weihong

    2016-09-01

    Knowledge of the water sources used by desert trees and shrubs is critical for understanding how they function and respond to groundwater decline and predicting the influence of water table changes on riparian plants. In this paper, we test whether increased depth to groundwater changed the water uptake pattern of desert riparian species and whether competition for water resources between trees and shrubs became more intense with a groundwater depth gradient. The water sources used by plants were calculated using the IsoSource model, and the results suggested differences in water uptake patterns with varying groundwater depths. At the river bank (groundwater depth = 1.8 m), Populus euphratica and Tamarix ramosissima both used a mixture of river water, groundwater, and deeper soil water (>75 cm). When groundwater depth was 3.8 m, trees and shrubs both depended predominantly on soil water stored at 150-375 cm depth. When the groundwater depth was 7.2 m, plant species switched to predominantly use both groundwater and deeper soil water (>375 cm). However, differences in water acquisition patterns between species were not found. The proportional similarity index (PSI) of proportional contribution to water uptake of different water resources between P. euphratica and T. ramosissima was calculated, and results showed that there was intense water resource competition between P. euphratica and T. ramosissima when grown at shallow groundwater depth (not more than 3.8 m), and the competition weakened when the groundwater depth increased to 7.2 m.

  18. Effects of Simulated Nitrogen Deposition on Soil Respiration in a Populus euphratica Community in the Ebinur Lake Area, a Desert Ecosystem of Northwestern China.

    Directory of Open Access Journals (Sweden)

    Xuemin He

    Full Text Available One of the primary limiting factors for biological activities in desert ecosystems is nitrogen (N. This study therefore examined the effects of N and investigated the responses of an arid ecosystem to global change. We selected the typical desert plant Populus euphratica in a desert ecosystem in the Ebinur Lake area to evaluate the effects of N deposition on desert soil respiration. Three levels of N deposition (0, 37.5 and 112.5 kg·N·ha-1·yr-1 were randomly artificially provided to simulate natural N deposition. Changes in the soil respiration rates were measured from July to September in both 2010 and 2013, after N deposition in April 2010. The different levels of N deposition affected the total soil N, soil organic matter, soil C/N ratio, microorganism number, and microbial community structure and function. However, variable effects were observed over time in relation to changes in the magnitude of N deposition. Simulated high N deposition significantly reduced the soil respiration rate by approximately 23.6±2.5% (P<0.05, whereas low N deposition significantly increased the soil respiration rate by approximately 66.7±2.7% (P<0.05. These differences were clearer in the final growth stage (September. The different levels of N deposition had little effect on soil moisture, whereas N deposition significantly increased the soil temperature in the 0-5 cm layer (P<0.05. These results suggest that in the desert ecosystem of the Ebinur Lake area, N deposition indirectly changes the soil respiration rate by altering soil properties.

  19. Understanding the role of the cytoskeleton in wood formation in angiosperm trees: hybrid aspen (Populus tremula x P. tremuloides) as the model species.

    Science.gov (United States)

    Chaffey, Nigel; Barlow, Peter; Sundberg, Björn

    2002-03-01

    The involvement of microfilaments and microtubules in the development of the radial and axial components of secondary xylem (wood) in hybrid aspen (Populus tremula L. x P. tremuloides Michx.) was studied by indirect immunofluorescent localization techniques. In addition to cambial cells, the differentiated cell types considered were early- and late-wood vessel elements, axial parenchyma, normal-wood fibers and gelatinous fibers, and contact and isolation ray cells. Microfilaments were rare in ray cambial cells, but were abundant and axially arranged in their derivatives once cell elongation had begun, and persisted in that orientation in mature ray cells. Microfilaments were axially arranged in fusiform cambial cells and persisted in that orientation in all xylem derivatives of those cells. Microtubules were randomly oriented in ray and fusiform cells of the cambial zone. Dense arrays of parallel-aligned microtubules were oriented near axially in the developing gelatinous fibers, but at a wide range of angles in normal-wood fibers. Ellipses of microfilaments were associated with pit development in fiber cells and isolation ray cells. Rings of co-localized microtubules and microfilaments were associated with developing inter-vessel bordered pits and vessel-contact ray cell contact pits, and, in the case of bordered pits, these rings decreased in diameter as the over-arching pit border increased in size. Although only microtubules were seen at the periphery of the perforation plate of vessel elements, a prominent meshwork of microfilaments overlaid the perforation plate itself. A consensus view of the roles of the cytoskeleton during wood formation in angiosperm trees is presented.

  20. N-fertilization has different effects on the growth, carbon and nitrogen physiology, and wood properties of slow- and fast-growing Populus species.

    Science.gov (United States)

    Li, Hong; Li, Mengchun; Luo, Jie; Cao, Xu; Qu, Long; Gai, Ying; Jiang, Xiangning; Liu, Tongxian; Bai, Hua; Janz, Dennis; Polle, Andrea; Peng, Changhui; Luo, Zhi-Bin

    2012-10-01

    To investigate how N-fertilization affects the growth, carbon and nitrogen (N) physiology, and wood properties of poplars with contrasting growth characteristics, slow-growing (Populus popularis, Pp) and fast-growing (P. alba×P. glandulosa, Pg) poplar saplings were exposed to different N levels. Above-ground biomass, leaf area, photosynthetic rates (A), instantaneous photosynthetic nitrogen use efficiency (PNUE (i)), chlorophyll and foliar sugar concentrations were higher in Pg than in Pp. Foliar nitrate reductase (NR) activities and root glutamate synthase (GOGAT) activities were higher in Pg than in Pp as were the N amount and NUE of new shoots. Lignin contents and calorific values of Pg wood were less than that of Pp wood. N-fertilization reduced root biomass of Pg more than of Pp, but increased leaf biomass, leaf area, A, and PNUE(i) of Pg more than of Pp. Among 13 genes involved in the transport of ammonium or nitrate or in N assimilation, transcripts showed more pronounced changes to N-fertilization in Pg than in Pp. Increases in NR activities and N contents due to N-fertilization were larger in Pg than in Pp. In both species, N-fertilization resulted in lower calorific values as well as shorter and wider vessel elements/fibres. These results suggest that growth, carbon and N physiology, and wood properties are more sensitive to increasing N availability in fast-growing poplars than in slow-growing ones, which is probably due to prioritized resource allocation to the leaves and accelerated N physiological processes in fast-growing poplars under higher N levels.

  1. Production physiology and morphology of Populus species and their hybrids grown under short rotation. III. Seasonal carbon allocation patterns from branches

    Energy Technology Data Exchange (ETDEWEB)

    Scarascia-Mugnozza, G.E.; Hinckley, T.M.; Stettler, R.F. [Washington Univ., College of Forest Resources, Seattle, WA (United States)

    1999-09-01

    A study was carried out to compare highly productive cones, in the Pacific Northwest, in terms of contrasting growth and morphology. The objective of the study was to determine seasonal differences in carbon allocation patterns among 1- and 2-year old trees of Populus deltoides Bartr, and 2 of their interspecific hybrids. The study examined if there are different patterns of carbon allocation associated with the more productive poplar clones, how these patterns vary over the course of the growing season and from the first and the second year, if sylleptic branches vary from proleptic branches in their carbon allocation patterns, if there are the translocation patterns within branches and the degree of branch autonomy that exists with sylleptic and proleptic branches and if these patterns vary during the growing season. Previous findings on general patterns of carbon allocation in poplar clones were confirmed, and new dimensions were introduced regarding differences among branch types and clones. In the first year, carbon export from sylleptic branches increased over the growing season, and they export primarily toward the lower stem and roots. In the second year, important differences in translocation efficiency occurred among branch types with the sylleptic branches contributing more than proleptic branches, on a per unit mass basis, to the growth of the tree. Transport patterns, within branches and among branches of different order, were similar to those in the main stem, with phenology playing an important role in controlling the sink activity of the apical portion of the growing axis. Exchange of photosynthates between adjacent branches of the same order or between branches and main stem leaves are minimal, supporting an hypothesis of branch autonomy. 29 refs., 5 tabs., 4 figs.

  2. Effect of applying an arsenic-resistant and plant growth-promoting rhizobacterium to enhance soil arsenic phytoremediation by Populus deltoides LH05-17.

    Science.gov (United States)

    Wang, Q; Xiong, D; Zhao, P; Yu, X; Tu, B; Wang, G

    2011-11-01

    Bioremediation of highly arsenic (As)-contaminated soil is difficult because As is very toxic for plants and micro-organisms. The aim of this study was to investigate soil arsenic removal effects using poplar in combination with the inoculation of a plant growth-promoting rhizobacterium (PGPR). A rhizobacterium D14 was isolated and identified within Agrobacterium radiobacter. This strain was highly resistant to arsenic and produced indole acetic acid and siderophore. Greenhouse pot bioremediation experiments were performed for 5 months using poplar (Populus deltoides LH05-17) grown on As-amended soils, inoculated with strain D14. The results showed that P. deltoides was an efficient arsenic accumulator; however, high As concentrations (150 and 300 mg kg(-1)) inhibited its growth. With the bacterial inoculation, in the 300 mg kg(-1) As-amended soils, 54% As in the soil was removed, which was higher than the uninoculated treatments (43%), and As concentrations in roots, stems and leaves were significantly increased by 229, 113 and 291%, respectively. In addition, the As translocation ratio [(stems + leaves)/roots = 0·8] was significantly higher than the uninoculated treatments (0·5). About 45% As was translocated from roots to the above-ground tissues. The plant height and dry weight of roots, stems and leaves were all enhanced; the contents of chlorophyll and soluble sugar, and the activities of superoxide dismutase and catalase were all increased; and the content of a toxic compound malondialdehyde was decreased. The results indicated that the inoculation of strain D14 could contribute to the increase in the As tolerance of P. deltoides, promotion of the growth, increase in the uptake efficiency and enhancement of As translocation. The use of P. deltoides in combination with the inoculation of strain D14 provides a potential application for efficient soil arsenic bioremediation. © 2011 The Authors. Journal of Applied Microbiology ©2011 The Society for Applied

  3. Sapflow of hybrid poplar (Populus nigra L.xP. maximowiczii A. Henry 'NM6') during phytoremediation of landfill leachate

    Energy Technology Data Exchange (ETDEWEB)

    Zalesny, Ronald S.; Wiese, Adam H.; Bauer, Edmund O.; Riemenschneider, Don E. [USDA Forest Service, North Central Research Station, Forestry Sciences Laboratory, 5985 Highway K, Rhinelander, WI 54501 (United States)

    2006-08-15

    Poplars are ideal for phytoremediation because of their high water usage, fast growth, and deep root systems. We measured in 2002 and 2003 the sapflow of hybrid poplars (Populus nigra L.xP. maximowiczii A. Henry 'NM6') planted in 1999 for phytoremediation of a landfill in Rhinelander, WI, USA (45.6{sup o}N, 89.4{sup o}W). Mean sap velocity per tree was 100+/-10 and 120+/-10{mu}ms{sup -1} for 2002 and 2003, respectively. Mean sapflow per tree was 1.4000+/-0.1698 and 5.6760+/-0.2997kgh{sup -1} for 2002 and 2003, respectively. Sapflow was negatively correlated with temperature, wind speed, precipitation, and vapor pressure deficit for both years (0.002

  4. Nitrogen-controlled intra- and interspecific competition between Populus purdomii and Salix rehderiana drive primary succession in the Gongga Mountain glacier retreat area.

    Science.gov (United States)

    Song, Mengya; Yu, Lei; Jiang, Yonglei; Lei, Yanbao; Korpelainen, Helena; Niinemets, Ülo; Li, Chunyang

    2017-06-01

    In this study, intra- and interspecific competition were investigated in early successional Salix rehderiana Schneider and later-appearing Populus purdomii Rehder under non-fertilized (control) and nitrogen (N)-fertilized conditions in the Hailuogou glacier retreat area. Our aim was to discover whether N is a key factor in plant-plant competition and whether N drives the primary succession process in a glacier retreat area. We analyzed differences in responses to intra- and interspecific competition and N fertilization between P. purdomii and S. rehderiana, including parameters such as biomass accumulation, nutrient absorption, non-structural carbohydrates, photosynthetic capacity, hydrolysable amino acids and leaf ultrastructure. In the control treatments, S. rehderiana individuals subjected to interspecific competition benefited from the presence of P. purdomii plants, as indicated by higher levels of biomass accumulation, photosynthetic capacity, N absorption, amino acid contents and photosynthetic N-use efficiency. However, in the N-fertilized treatments, P. purdomii individuals exposed to interspecific competition benefited from the presence of S. rehderiana plants, as shown by a higher growth rate, enhanced carbon gain capacity, greater amino acid contents, and elevated water-use efficiency, whereas the growth of S. rehderiana was significantly reduced. Our results demonstrate that N plays a pivotal role in determining the asymmetric competition pattern among Salicaceae species during primary succession. We argue that the interactive effects of plant-plant competition and N availability are key mechanisms that drive primary succession in the Gongga Mountain glacier retreat area. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Modeling phosphorus capture by plants growing in a multi-species riparian buffer

    Science.gov (United States)

    The NST 3.0 mechanistic nutrient uptake model was used to explore phosphorus (P) uptake to a depth of 120 cm over a 126-d growing season in simulated buffer communities composed of mixtures of cottonwood (Populus deltoids Bartr.), switchgrass (Panicum virgatum L.), and smooth brome (Bromis inermis L...

  6. Per tree estimates with n-tree distance sampling: an application to increment core data

    Science.gov (United States)

    Thomas B. Lynch; Robert F. Wittwer

    2002-01-01

    Per tree estimates using the n trees nearest a point can be obtained by using a ratio of per unit area estimates from n-tree distance sampling. This ratio was used to estimate average age by d.b.h. classes for cottonwood trees (Populus deltoides Bartr. ex Marsh.) on the Cimarron National Grassland. Increment...

  7. Fifteen-Year Growth of Six Planted Hardwood Species on Sharkey Clay Soil

    Science.gov (United States)

    Roger M. Krinard; Harvey E. Kennedy

    1987-01-01

    Six hardwood species planted on Sharkey clay soil that had been disked the first 5 years for weed control were significantly taller at age 5 when compared to species grown on mowed sites. By age 15, there were no differences in heights within species except for sweet pecan. Average heights by species at age 15 were: cottonwood (Populus deltoides...

  8. Analysis of genetic and environmental effects on hybrid poplar rooting in Central and Northern Minnesota, USA

    Science.gov (United States)

    Ronald S., Jr. Zalesny; Don Riemenschneider; Edmund Bauer

    2000-01-01

    We studied genetic and environmental effects on adventitious root initiation and growth because rooting is biologically prerequisite to the establishment of hybrid poplar plantations. Six clones from two pedigrees (pure Populus deltoides "cottonwoods" and P. deltoides x P. maximowiczii hybrids) were...

  9. Environmental Assessment: Land Acquisition at Whiteman Air Force Base, Missouri

    Science.gov (United States)

    2011-06-01

    Canadian clearweed (Pilea pumila), common duckweed ( Lemna minor ), common rush (Juncus effusus), cottonwood (Populus deltoides), crabgrass...resources, hazardous materials and hazardous waste, and safety. Implementation of the Proposed Action would result in minor , short-term adverse impacts...consumption of petroleum products during fence construction. As a result of implementing the Proposed Action, minor long-term adverse impacts to land use

  10. Captures of Crawford's gray shrews (Notiosorex crawfordi) along the Rio Grande in central New Mexico

    Science.gov (United States)

    Alice Chung-MacCoubrey; Heather L. Bateman; Deborah M. Finch

    2009-01-01

    We captured >2000 Crawford's gray shrews (Notiosorex crawfordi) in a riparian forest mainly consisting of cottonwoods (Populus deltoides) along the Rio Grande in central New Mexico. Little has been published about abundance and habitat of Crawford's gray shrew throughout its distributional range. During 7 summers, we...

  11. Impacts of post-harvest slash and live-tree retention on biomass and nutrient stocks in Populus tremuloides Michx.-dominated forests, northern Minnesota, USA

    Science.gov (United States)

    Klockow, Paul A.; D'Amato, Anthony W.; Bradford, John B.

    2013-01-01

    Globally, there is widespread interest in using forest-derived biomass as a source of bioenergy. While conventional timber harvesting generally removes only merchantable tree boles, harvesting biomass feedstock can remove all forms of woody biomass (i.e., live and dead standing woody vegetation, downed woody debris, and stumps) resulting in a greater loss of biomass and nutrients as well as more severe habitat alteration. To investigate the potential impacts of this practice, this study examined the initial impacts (pre- and post-harvest) of various levels of slash and live-tree retention on biomass and nutrient stocks, including carbon (C), nitrogen (N), calcium (Ca), potassium (K), and phosphorus (P), in Populus tremuloides Michx.-dominated forests of northern Minnesota, USA. Treatments examined included three levels of slash retention, whole-tree harvest (WTH), 20% slash retention (20SR), and stem-only harvest (SOH), factored with three levels of green-tree retention, no trees retained (NONE), dispersed retention (DISP), and aggregate retention (AGR). Slash retention was the primary factor affecting post-harvest biomass and nutrient stocks, including woody debris pools. Compared to the unharvested control, stocks of biomass, carbon, and nutrients, including N, Ca, K, and P, in woody debris were higher in all treatments. Stem-only harvests typically contained greater biomass and nutrient stocks than WTH, although biomass and nutrients within 20SR, a level recommended by biomass harvesting guidelines in the US and worldwide, generally did not differ from WTH or SOH. Biomass in smaller-diameter slash material (typically 2.5-22.5 cm in diameter) dominated the woody debris pool following harvest regardless of slash retention level. Trends among treatments in this diameter range were generally similar to those in the total woody debris pool. Specifically, SOH contained significantly greater amounts of biomass than WTH while 20SR was not different from either WTH or

  12. Tissue- and Cell-Specific Cytokinin Activity in Populus × canescens Monitored by ARR5::GUS Reporter Lines in Summer and Winter.

    Science.gov (United States)

    Paul, Shanty; Wildhagen, Henning; Janz, Dennis; Teichmann, Thomas; Hänsch, Robert; Polle, Andrea

    2016-01-01

    Cytokinins play an important role in vascular development. But knowledge on the cellular localization of this growth hormone in the stem and other organs of woody plants is lacking. The main focus of this study was to investigate the occurrence and cellular localization of active cytokinins in leaves, roots, and along the stem of Populus × canescens and to find out how the pattern is changed between summer and winter. An ARR5::GUS reporter construct was used to monitor distribution of active cytokinins in different tissues of transgenic poplar lines. Three transgenic lines tested under outdoor conditions showed no influence of ARR5::GUS reporter construct on the growth performance compared with the wild-type, but one line lost the reporter activity. ARR5::GUS activity indicated changes in the tissue- and cell type-specific pattern of cytokinin activity during dormancy compared with the growth phase. ARR5::GUS activity, which was present in the root tips in the growing season, disappeared in winter. In the stem apex ground tissue, ARR5::GUS activity was higher in winter than in summer. Immature leaves from tissue-culture grown plants showed inducible ARR5::GUS activity. Leaf primordia in summer showed ARR5::GUS activity, but not the expanded leaves of outdoor plants or leaf primordia in winter. In stem cross sections, the most prominent ARR5::GUS activity was detected in the cortex region and in the rays of bark in summer and in winter. In the cambial zone the ARR5::GUS activity was more pronounced in the dormant than in growth phase. The pith and the ray cells adjacent to the vessels also displayed ARR5::GUS activity. In silico analyses of the tissue-specific expression patterns of the whole PtRR type-A family of poplar showed that PtRR10, the closest ortholog to the Arabidopsis ARR5 gene, was usually the most highly expressed gene in all tissues. In conclusion, gene expression and tissue-localization indicate high activity of cytokinins not only in summer, but

  13. MODELAGEM DA ESTRUTURA DE FLORESTAS CLONAIS DE Populus deltoides Marsh. ATRAVÉS DE DISTRIBUIÇÕES DIAMÉTRICAS PROBABILÍSTICAS

    Directory of Open Access Journals (Sweden)

    Julio Eduardo Arce

    2004-04-01

    Full Text Available No presente estudo, foram avaliadas, entre os anos 1987 e 1995 (idades 1 a 9, as distribuições diamétricas de seis florestas clonais de Populus deltoides Marsh. plantadas em 1986. As funções probabilísticas normal, gama, beta, SB de Johnson e Weibull com dois e três parâmetros foram ajustadas aos dados observados utilizando na estimativa dos parâmetros, segundo o caso, o Método dos Momentos, o Método da Máxima Verossimilhança, a metodologia proposta por Loetsch et al. (1973 e a média aritmética e o desvio-padrão dos diâmetros. A qualidade dos ajustes das distribuições probabilísticas foi avaliada considerando os desvios relativos entre as somas observada e estimada dos diâmetros elevados à primeira, segunda, terceira e quarta potências. Para todas as funções analisadas, os desvios se incrementaram com o aumento da potência, sendo a função Weibull com dois parâmetros (a = 0 a que apresentou os menores valores em todos os anos ao considerar a quarta potência. Os valores dos desvios relativos entre as somas observada e estimada dos diâmetros elevados à quarta potência não superaram o valor de 0,005 (0,5% para a função Weibull com dois parâmetros, com exceção do primeiro ano, no qual todas as funções apresentaram valores de desvios mais elevados (entre 11 e 13%. Os parâmetros escala (b e forma (c da função Weibull com dois parâmetros foram estimados pelas equações ajustadas por regressão linear múltipla utilizando o diâmetro quadrático médio do povoamento como variável independente.

  14. The role of peu-miR164 and its target PeNAC genes in response to abiotic stress in Populus euphratica.

    Science.gov (United States)

    Lu, Xin; Dun, Hui; Lian, Conglong; Zhang, Xiaofei; Yin, Weilun; Xia, Xinli

    2017-06-01

    Plant miR164 family is highly conserved and miR164 members regulate conserved targets belonging to NAC transcription factors. Our previous studies have revealed that peu-miR164a-e and its target gene POPTR_0007s08420 participate in abiotic stress response in Populus euphratica according to deep sequencing and degradome sequencing. In this study, miR164 family comprises six members that generate two mature products (miR164a-e and miR164f) and target seven NAC genes in P. euphratica. Co-expression in Nicotiana benthamiana and 5' RACE confirmed that peu-miR164 directs PeNAC070, PeNAC012 and PeNAC028 mRNAs cleavage. Expression profiles of primary peu-miR164 a/b/c/d/e bear similarity to those of peu-miR164a-e, whereas PeNAC070 and PeNAC081 showed inverse expression patterns with peu-miR164a-e under abiotic stresses. Existence of cis-acting elements in PeNAC070 promoter (ABRE,MBs, Box-W1, GC-motif, and W-box) and in peu-MIR164b promoter (HSE) further confirmed different responses of peu-miR164 and PeNAC070 to abiotic stresses. Histochemical β-glucuronidase (GUS) staining revealed that GUS activities increased when Pro PeNAC070 ::GUS transgenic Arabidopsis plants were exposed to NaCl, mannitol and abscisic acid (ABA), whereas GUS activity of Pro peu-MIR164b ::GUS plants decreased under ABA treatment. Subcellular localization and transactivation assays showed that PeNAC070 protein was localized to the nucleus and exhibited transactivation activity at the C-terminal. Overexpression of PeNAC070 in Arabidopsis promoted lateral root development, delayed stem elongation, and increased sensitivity of transgenic plants to drought and salt stresses. This study aids in understanding the adaptability of P. euphratica to extreme drought and salt environment by analysing tissue-specific expression patterns of miR164-regulated and specific promoter-regulated PeNAC genes. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. Avian response to bottomland hardwood reforestation: the first 10 years

    Science.gov (United States)

    Twedt, D.J.; Wilson, R.R.; Henne-Kerr, J.L.; Grosshuesch, D.A.

    2002-01-01

    Bttomland hardwood forests were planted on agricultural fields in Mississippi and Louisiana using either predominantly Quercus species (oaks) or Populus deltoides (eastern cottonwood). We assessed avian colonization of these reforested sites between 2 and 10 years after planting. Rapid vertical growth of cottonwoods (circa 2 - 3 m / yr) resulted in sites with forest structure that supported greater species richness of breeding birds, increased Shannon diversity indices, and supported greater territory densities than on sites planted with slower-growing oak species. Grassland birds (Spiza americana [Dickcissel], and Sturnella magna [Eastern Meadowlark]) were indicative of species breeding on oak-dominated reforestation # 10 years old. Agelaius phoeniceus (Red-winged Blackbird) and Colinus virginianus (Northern Bobwhite) characterized cottonwood reforestation # 4 years old, whereas 14 species of shrub-scrub birds (e.g., Passerina cyanea [Indigo Bunting]) and early-successional forest birds (e.g., Vireo gilvus [Warbling Vireo]) typified cottonwood reforestation 5 to 9 years after planting. Rates of daily nest survival did not differ between reforestation strategies. Nest parasitism increased markedly in older cottonwood stands, but was overwhelmed by predation as a cause of nest failure. Based on Partners in Flight prioritization scores and territory densities, the value of cottonwood reforestation for avian conservation was significantly greater than that of oak reforestation during their first 10 years. Because of benefits conferred on breeding birds, we recommend reforestation of bottomland hardwoods include a high proportion of fast-growing, early successional species such as cottonwood.

  16. Contrasting patterns of cytokinins between years in senescing aspen leaves

    Czech Academy of Sciences Publication Activity Database

    Edlund, E.; Novák, Ondřej; Karady, M.; Ljung, K.; Jansson, S.

    2017-01-01

    Roč. 40, č. 5 (2017), s. 622-634 ISSN 0140-7791 R&D Projects: GA ČR GA14-34792S; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : leaf senescence * arabidopsis-thaliana * autumn senescence * gene-expression * populus-trichocarpa * mass-spectrometry * tobacco plants * translocation * biosynthesis * identification * autumn senescence * gene expression * metabolism * Populus tremula * profiling Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Plant sciences, botany Impact factor: 6.173, year: 2016

  17. Phylogenetic analysis, subcellular localization, and expression patterns of RPD3/HDA1 family histone deacetylases in plants

    OpenAIRE

    Alinsug, Malona V; Yu, Chun-Wei; Wu, Keqiang

    2009-01-01

    Abstract Background Although histone deacetylases from model organisms have been previously identified, there is no clear basis for the classification of histone deacetylases under the RPD3/HDA1 superfamily, particularly on plants. Thus, this study aims to reconstruct a phylogenetic tree to determine evolutionary relationships between RPD3/HDA1 histone deacetylases from six different plants representing dicots with Arabidopsis thaliana, Populus trichocarpa, and Pinus taeda, monocots with Oryz...

  18. Dicty_cDB: VHD854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N AC187854 |AC187854.2 Populus trichocarpa clone Pop1-11B14, complete sequence. 38 0.15 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent...itrus sinensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.2 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent

  19. Biochemical, physiological and climatic influence on the emission of isoprenoides from Grey Poplar (Populus x canescens (Aiton) Sm.) and Holm Oak (Quercus ilex L.); Biochemische, physiologische und klimatische Einfluesse auf die Isoprenoidemission der Graupappel (Populus x canescens (Aiton) Sm.) und der Steineiche (Quercus ilex L.)

    Energy Technology Data Exchange (ETDEWEB)

    Mayrhofer, S.

    2007-05-15

    Because of their important role for the atmospheric chemistry, global daily and seasonal emission rates of isoprene and monoterpenes have to be estimated with accuracy. Therefore, detailed knowledge of biochemical and physiological processes within the plant metabolism has to be gathered. Afterwards the gained cognitions are used as information for process-based model calculations. The major scope of the work was therefore to enlarge basic knowledge of the regulation of isoprenoid emission, which is known to be dependent on several environmental factors, especially light and temperature. Measurements of diurnal isoprene emission have been performed in parallel on physiological, translational and transcriptional level on leaves of Grey Poplar (Populus x canescens), a strong isoprene emitting species. Additionally, examinations of diurnal monoterpene emission in connection to physiologic and enzymatic processes was conducted in leaves of Holm Oak (Quercus ilex), which emits a large spectrum of monoterpenes. Furthermore a hypothesis was tested, whether isoprene emission may serve the plant as antioxidative protection mechanism in order to overcome oxidative stress. In main parts, the following results have been reached: 1. In the first part of this work, isolation of PcDXR (DXR of Grey Poplar) from a cDNA-Genbank and heterologous expression of the isolated gene was accomplished. 2. Daytime variation of physiological and biochemical parameters of the isoprene emission of Grey Poplar was measured twice on 2 following days in 2 years. All together, measurements have been performed on 8 representative plants. 3. Quantitative RT-PCR elucidated the gene expression pattern of PcDXR and PcISPS in parallel to diurnal gas exchange measurements. Gene expression of PcISPS showed distinct diurnal courses with maximum values on the late morning, whereas PcDXR transcript levels stayed consistent over the day. No short-term influence of PPFD and leaf temperature has been observed on

  20. Transcriptomic analysis of grain amaranth (Amaranthus hypochondriacus using 454 pyrosequencing: comparison with A. tuberculatus, expression profiling in stems and in response to biotic and abiotic stress

    Directory of Open Access Journals (Sweden)

    Vargas-Ortiz Erandi

    2011-07-01

    stems of Arabidopsis and black cottonwood (Populus trichocarpa. Conclusions This study represents the first large-scale transcriptomic analysis of A. hypochondriacus, considered to be a highly nutritious and stress-tolerant crop. Numerous genes were found to be induced in response to (abiotic stress, many of which could further the understanding of the mechanisms that contribute to multiple stress-resistance in plants, a trait that has potential biotechnological applications in agriculture.

  1. Soil Respiration at Different Stand Ages (5, 10, and 20/30 Years) in Coniferous (Pinus tabulaeformis Carrière) and Deciduous (Populus davidiana Dode) Plantations in a Sandstorm Source Area

    DEFF Research Database (Denmark)

    Zhao, Xin; Li, Fadong; Zhang, Wanjun

    2016-01-01

    respiration and its temperature sensitivity at three stand ages (5, 10, and 20 or 30 years) in two plantations of coniferous (Pinus tabulaeformis Carrière) and deciduous (Populus davidiana Dode) species using an automated chamber system in 2013 in the Beijing-Tianjin sandstorm source area. Results showed...... that mean soil respiration in the 5-, 10-, and 20/30-year-old plantations was 3.37, 3.17, and 2.99 μmol·m−2·s−1 for P. tabulaeformis and 2.92, 2.85, and 2.57 μmol·m−2·s−1 for P. davidiana, respectively. Soil respiration decreased with stand age for both species. There was no significant difference in soil...... respiration between the two plantation species at ages 5 and 10 years (p > 0.05). Temperature sensitivity of soil respiration, which ranged from 1.85–1.99 in P. tabulaeformis and 2.20–2.46 in P. davidiana plantations, was found to increase with stand age. Temperature sensitivity was also significantly higher...

  2. Genotype differences in 13C discrimination between atmosphere and leaf matter match differences in transpiration efficiency at leaf and whole-plant levels in hybrid Populus deltoides x nigra.

    Science.gov (United States)

    Rasheed, Fahad; Dreyer, Erwin; Richard, Béatrice; Brignolas, Franck; Montpied, Pierre; Le Thiec, Didier

    2013-01-01

    (13) C discrimination between atmosphere and bulk leaf matter (Δ(13) C(lb) ) is frequently used as a proxy for transpiration efficiency (TE). Nevertheless, its relevance is challenged due to: (1) potential deviations from the theoretical discrimination model, and (2) complex time integration and upscaling from leaf to whole plant. Six hybrid genotypes of Populus deltoides×nigra genotypes were grown in climate chambers and tested for whole-plant TE (i.e. accumulated biomass/water transpired). Net CO(2) assimilation rates (A) and stomatal conductance (g(s) ) were recorded in parallel to: (1) (13) C in leaf bulk material (δ(13) C(lb) ) and in soluble sugars (δ(13) C(ss) ) and (2) (18) O in leaf water and bulk leaf material. Genotypic means of δ(13) C(lb) and δ(13) C(ss) were tightly correlated. Discrimination between atmosphere and soluble sugars was correlated with daily intrinsic TE at leaf level (daily mean A/g(s) ), and with whole-plant TE. Finally, g(s) was positively correlated to (18) O enrichment of bulk matter or water of leaves at individual level, but not at genotype level. We conclude that Δ(13) C(lb) captures efficiently the genetic variability of whole-plant TE in poplar. Nevertheless, scaling from leaf level to whole-plant TE requires to take into account water losses and respiration independent of photosynthesis, which remain poorly documented. © 2012 Blackwell Publishing Ltd.

  3. Structure and vascular tissue expression of duplicated TERMINAL EAR1-like paralogues in poplar.

    Science.gov (United States)

    Charon, Céline; Vivancos, Julien; Mazubert, Christelle; Paquet, Nicolas; Pilate, Gilles; Dron, Michel

    2010-02-01

    TERMINAL EAR1-like (TEL) genes encode putative RNA-binding proteins only found in land plants. Previous studies suggested that they may regulate tissue and organ initiation in Poaceae. Two TEL genes were identified in both Populus trichocarpa and the hybrid aspen Populus tremula x P. alba, named, respectively, PoptrTEL1-2 and PtaTEL1-2. The analysis of the organisation around the PoptrTEL genes in the P. trichocarpa genome and the estimation of the synonymous substitution rate for PtaTEL1-2 genes indicate that the paralogous link between these two Populus TEL genes probably results from the Salicoid large-scale gene-duplication event. Phylogenetic analyses confirmed their orthology link with the other TEL genes. The expression pattern of both PtaTEL genes appeared to be restricted to the mother cells of the plant body: leaf founder cells, leaf primordia, axillary buds and root differentiating tissues, as well as to mother cells of vascular tissues. Most interestingly, PtaTEL1-2 transcripts were found in differentiating cells of secondary xylem and phloem, but probably not in the cambium itself. Taken together, these results indicate specific expression of the TEL genes in differentiating cells controlling tissue and organ development in Populus (and other Angiosperm species).

  4. Cultural Resources Survey and Testing Along Ditch 19 and Extensive Testing of 23DU289, Dunklin and Stoddard Counties, Missouri.

    Science.gov (United States)

    1988-06-30

    Carya illinoensis ) 1 1 Persimmon (Diospyros virginiana) T 2 2 Pl.um (Prunus sp.) T Red Haw (Crataegus sp.) T 1 11 Red Mulberry (Morus rubra) T...2 Cherry (Prunus sp.) T Cottonwood (Populus sp.) 1 3 Dogwood (Cornus sp.) 1 Hackberry (Celtus occidentalis) 12 9 Hickory, ( Carya sp.) 5 4 Shellhark... Carya laciniosa) T Hornbeam (Ostrya virginiana) 2 Kentucky Coffee Tree( Gymnoeladus dioica)T Locust, T Black (Robinia pseudo-acacia) T Honey

  5. Environmental Impact Assessment Sandia Laboratories, New Mexico.

    Science.gov (United States)

    1977-05-01

    awn (Aristida divaricata) 45. Arizona three-awn (Aristida arizonica ) 46. Purple three-awn (Aristida purpurea) 47. Wright’s three-awn (Aristida wrightii...californica) Willow Family *102. Fremont cottonwood (Populus fremontii) Beech Family *103. Gambel oak ( Quercus gambelii) *104. Gray oak ( Quercus grisea...105. Shrub live oak ( Quercus turbinella) Elm Family *106. Siberian elm or Chinese elm (Ulmus pumila) 107. Netlead hackberry (Celtis reticulata) Nist

  6. Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Western Mountains, Valleys, and Coast Region (Version 2.0)

    Science.gov (United States)

    2010-05-01

    monophylla or P. edulis), junipers (Juniperus), cottonwoods (e.g., Populus fremontii), willows (Salix), or hardwoods (e.g., Quercus , Platanus...pine in association with incense cedar and California black oak ( Quercus kelloggii) on the western slopes and Jeffrey pine on the eastern slopes...corkbark fir (Abies lasiocarpa var. arizonica ), limber pine (Pinus flexilis), and bristlecone pine (P. aristata) (Bailey 1995). Black Hills (MLRA

  7. Recreational Appendix Report, Elm Fork Flood Control Project, Dallas and Denton Counties, Texas.

    Science.gov (United States)

    1973-05-01

    Juniperus virginiana 2. Willow Salix nigra 3. Cottonwood Populus deltoides 4. Black Walnut Juglans migra 5. Pecan Carya illinoensis 6. Bur Oak...Maclura pomifera 12. Red Mulberry Morus rubra 13. Sycamore Platanus occidentailis 14. Red Haw Crataegus, sps. 15. Wild Plum Prunus mexicana 16. Mesquite...also provides a habitat for a number of mammals including: 1. Opossum Didelphis virginiana 2. Shrews Blarina brevicuada and Cryptotis parva 3. Raccoon

  8. Environmental and Water Quality Operational Studies. Reservoir Shoreline Revegetation Guidelines.

    Science.gov (United States)

    1986-11-01

    24. Taller trees such as green ash, cottonwood (Populus spp.), red maple (Acer rubrum), and persimmon (Diospyros virginiana ) should be planted in...be left aboveground to prevent moisture loss due to wicking. Any excess should be pruned off. Gray and Leiser (1982) provide the following... pruning , staking woody stems, and installing fencing around individual plants or the entire site to provide protection from animals or humans. Additional

  9. Study on the Effects of Diverting Water into Upper Burnt Pocket, Navigation Pool Number 18, Illinois and A Field Test of the Regression Simulation Model Previously Developed on Navigation Pool Number 8.

    Science.gov (United States)

    1981-03-01

    latifolia L. Commuon Cattail ULMACEAE Celtis occidentalis L. Hackberry Ulmus rubra Muhl. Slippery Elm Ulmus americana L. American Elm URTICACEAE...Populus deltoides Marsh. Cottonwood Celtis occidentalis L. Hackberry Ulmus rubra Muhl. Slippery Elm Ulmus americana L. American Elm *Dominant or most...Cryptochironomus sn. Tnta - Tanytarsus sp. Phys - Physa sp. Crcl n Crytoclido elm sp. Epio - Epoicocladius sp. Trun - Truncilla sp, Elnf - Einfeldia sp. Eusi

  10. Buffalo Metropolitan Area, New York Water Resources Management. Interim Report on Feasibility of Flood Management in Cazenovia Creek Watershed.

    Science.gov (United States)

    1977-03-01

    Ulmus rubra slippery elm Ulmus thomasii rock elm Pinus strobus white pine Juglans cinerea. butternut Juglans nigra black walnut Carya ovata shagbark...West Seneca X : X : X Town of Elm : X X X Town of Aurora : X : Town of Boston X : Town of Colden : X : 5.i, Table 1 (cont’d) Flood Insurance Status for...grandidentata bigtooth aspen Populus deltoides eastern cottonwood Rhus typhina staghorn. sumc Betula alleghaniesis yellow birch Ulmus americana. American elm

  11. Selection of black poplars for water use efficiency

    OpenAIRE

    Orlović Saša S.; Pajević Slobodanka P.; Krstić Borivoj Đ.

    2002-01-01

    Photosynthesis, transpiration, water use efficiency (WUE) and biomass production have been investigated in nine black poplar clones (section Aigeiros) in three field experiments. Eastern cottonwood clones (Populus deltoides) had the highest net photosynthesis and water use efficiency. European black poplar clones had the highest transpiration intensity. Correlation analysis showed that net photosynthesis was in a high positive correlation with biomass. Medium negative correlations existed bet...

  12. Chilling of Dormant Buds Hyperinduces FLOWERING LOCUS T and Recruits GA-Inducible 1,3-β-Glucanases to Reopen Signal Conduits and Release Dormancy in Populus[W][OA

    Science.gov (United States)

    Rinne, Päivi L.H.; Welling, Annikki; Vahala, Jorma; Ripel, Linda; Ruonala, Raili; Kangasjärvi, Jaakko; van der Schoot, Christiaan

    2011-01-01

    In trees, production of intercellular signals and accessibility of signal conduits jointly govern dormancy cycling at the shoot apex. We identified 10 putative cell wall 1,3-β-glucanase genes (glucan hydrolase family 17 [GH17]) in Populus that could turn over 1,3-β-glucan (callose) at pores and plasmodesmata (PD) and investigated their regulation in relation to FT and CENL1 expression. The 10 genes encode orthologs of Arabidopsis thaliana BG_ppap, a PD-associated glycosylphosphatidylinositol (GPI) lipid-anchored protein, the Arabidopsis PD callose binding protein PDCB, and a birch (Betula pendula) putative lipid body (LB) protein. We found that these genes were differentially regulated by photoperiod, by chilling (5°C), and by feeding of gibberellins GA3 and GA4. GA3 feeding upregulated all LB-associated GH17s, whereas GA4 upregulated most GH17s with a GPI anchor and/or callose binding motif, but only GA4 induced true bud burst. Chilling upregulated a number of GA biosynthesis and signaling genes as well as FT, but not CENL1, while the reverse was true for both GA3 and GA4. Collectively, the results suggest a model for dormancy release in which chilling induces FT and both GPI lipid-anchored and GA3-inducible GH17s to reopen signaling conduits in the embryonic shoot. When temperatures rise, the reopened conduits enable movement of FT and CENL1 to their targets, where they drive bud burst, shoot elongation, and morphogenesis. PMID:21282527

  13. Expression patterns of WRKY genes in di-haploid Populus simonii × P. nigra in response to salinity stress revealed by quantitative real-time PCR and RNA sequencing.

    Science.gov (United States)

    Wang, Shengji; Wang, Jiying; Yao, Wenjing; Zhou, Boru; Li, Renhua; Jiang, Tingbo

    2014-10-01

    Spatio-temporal expression patterns of 13 out of 119 poplar WRKY genes indicated dynamic and tissue-specific roles of WRKY family proteins in salinity stress tolerance. To understand the expression patterns of poplar WRKY genes under salinity stress, 51 of the 119 WRKY genes were selected from di-haploid Populus simonii × P. nigra by quantitative real-time PCR (qRT-PCR). We used qRT-PCR to profile the expression of the top 13 genes under salinity stress across seven time points, and employed RNA-Seq platforms to cross-validate it. Results demonstrated that all the 13 WRKY genes were expressed in root, stem, and leaf tissues, but their expression levels and overall patterns varied notably in these tissues. Regarding overall gene expression in roots, the 13 genes were significantly highly expressed at all six time points after the treatment, reaching the plateau of expression at hour 9. In leaves, the 13 genes were similarly up-regulated from 3 to 12 h in response to NaCl treatment. In stems, however, expression levels of the 13 genes did not show significant changes after the NaCl treatment. Regarding individual gene expression across the time points and the three tissues, the 13 genes can be classified into three clusters: the lowly expressed Cluster 1 containing PthWRKY28, 45 and 105; intermediately expressed Clusters 2 including PthWRKY56, 88 and 116; and highly expressed Cluster 3 consisting of PthWRKY41, 44, 51, 61, 62, 75 and 106. In general, genes in Cluster 2 and 3 displayed a dynamic pattern of "induced amplification-recovering", suggesting that these WRKY genes and corresponding pathways may play a critical role in mediating salt response and tolerance in a dynamic and tissue-specific manner.

  14. Soil Respiration at Different Stand Ages (5, 10, and 20/30 Years in Coniferous (Pinus tabulaeformis Carrière and Deciduous (Populus davidiana Dode Plantations in a Sandstorm Source Area

    Directory of Open Access Journals (Sweden)

    Xin Zhao

    2016-07-01

    Full Text Available Understanding the effects of stand age and forest type on soil respiration is crucial for predicting the potential of soil carbon sequestration. Thus far, however, there is no consensus regarding the variations in soil respiration caused by stand age and forest type. This study investigated soil respiration and its temperature sensitivity at three stand ages (5, 10, and 20 or 30 years in two plantations of coniferous (Pinus tabulaeformis Carrière and deciduous (Populus davidiana Dode species using an automated chamber system in 2013 in the Beijing-Tianjin sandstorm source area. Results showed that mean soil respiration in the 5-, 10-, and 20/30-year-old plantations was 3.37, 3.17, and 2.99 μmol·m−2·s−1 for P. tabulaeformis and 2.92, 2.85, and 2.57 μmol·m−2·s−1 for P. davidiana, respectively. Soil respiration decreased with stand age for both species. There was no significant difference in soil respiration between the two plantation species at ages 5 and 10 years (p > 0.05. Temperature sensitivity of soil respiration, which ranged from 1.85–1.99 in P. tabulaeformis and 2.20–2.46 in P. davidiana plantations, was found to increase with stand age. Temperature sensitivity was also significantly higher in P. davidiana plantations and when the soil water content was below 12.8%. Temperature sensitivity incorporated a combined response of soil respiration to soil temperature, soil water content, soil organic carbon, and fine root biomass and, thus, provided an ecological metric for comparing forest carbon dynamics of these species.

  15. Specific Gravity Variation in a Lower Mississippi Valley Cottonwood Population

    Science.gov (United States)

    R. E. Farmer; J. R. Wilcox

    1966-01-01

    Specific gravity varied from 0,32 to 0.46, averaging 0.38. Most of the variation was associated with individual trees; samples within locations accounted for a smaller, but statistically significant, portion of the variation. Variation between locatians was not significant. It was concluded that individual high-density trees' should be sought throughout the...

  16. Resprout and survival of willows (Salix purpurea and S. incana), Poplars (Populus nigra) and Tamaris (Tamarix gallica) cuttings in marly gullies with Southern aspect in a mountainous and Mediterranean climate (Southern Alps, France)

    Science.gov (United States)

    Rey, Freddy; Labonne, Sophie; Dangla, Laure; Lavandier, Géraud

    2014-05-01

    In the Southern French Alps under a mountainous and Mediterranean climate, a current strategy of bioengineering is developed for trapping sediment in marly gullies with surface area less than 1 ha. It is based on the use of structures in the form of brush layers and brush mats of cuttings on deadwood microdams. Purple and white Willows (Salix purpurea and S. incana) are recommended here as they proved their efficiency to resprout and survive in such environment. However, these species installed in Southern gullies did not survive in previous experiments, due to the too harsh conditions of solar radiation and drought. We thus decided to test other species, namely black Poplar (Populus nigra) and Tamaris (Tamarix gallica), which proved their resistance to drought conditions in other experiments. To this view, bioengineering structures have been built in 2010 in eroded marly gullies in the Roubines and Fontaugier catchments (Southern Alps, France). We tested two installation modalities: one in spring and a second in autumn. Seventy-eight bioengineering structures (50 in spring and 28 in autumn), among which 32 made with Poplar cuttings and 28 with Tamaris cuttings, as well as 11 structures with purple Willow and 7 with white Willow as controls, were built in 6 experimental gullies. After 3 observation years for each modality (2010 to 2012, and 2011 to 2013, respectively), results first revealed that Willow species succeeded in surviving in gullies in Southern aspect (76 % for the cuttings installed in spring and 52 % for those installed in autumn), which is in contradiction with previous results. Second, Poplar showed a good ability to survive (62 % for the cuttings installed in spring and 33 % for those installed in autumn). Tamaris obtained the worst score with 26 % and 38 % of survival for the cuttings installed in spring and autumn, respectively. Globally, excepted for Tamaris, survival rates were better for the cuttings installed in spring. The bioengineering

  17. Functional analyses of Populus euphratica brassinosteroid biosyn ...

    Indian Academy of Sciences (India)

    2016-09-28

    Sep 28, 2016 ... lengths and seed yields were similar, but in bolting time and stem diameters, they were opposite. .... This study reports the changes of PeDWF4-TL, PeCPD- .... RNA isolation and the first-strand cDNA synthesis were as above.

  18. PlantTribes: a gene and gene family resource for comparative genomics in plants

    OpenAIRE

    Wall, P. Kerr; Leebens-Mack, Jim; Müller, Kai F.; Field, Dawn; Altman, Naomi S.; dePamphilis, Claude W.

    2007-01-01

    The PlantTribes database (http://fgp.huck.psu.edu/tribe.html) is a plant gene family database based on the inferred proteomes of five sequenced plant species: Arabidopsis thaliana, Carica papaya, Medicago truncatula, Oryza sativa and Populus trichocarpa. We used the graph-based clustering algorithm MCL [Van Dongen (Technical Report INS-R0010 2000) and Enright et al. (Nucleic Acids Res. 2002; 30: 1575–1584)] to classify all of these species’ protein-coding genes into putative gene families, ca...

  19. Dicty_cDB: VHC611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.4 1 CX072512 |CX072512.1 UCRCS08_28E10_b Parent Washington ...72513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl... Populus trichocarpa clone Pop1-11B14, complete sequence. 38 0.30 5 CX072513 |CX0

  20. SPTEdb: a database for transposable elements in salicaceous plants

    Science.gov (United States)

    Jia, Zirui; Xiao, Yao; Ma, Wenjun; Wang, Junhui

    2018-01-01

    Abstract Although transposable elements (TEs) play significant roles in structural, functional and evolutionary dynamics of the salicaceous plants genome and the accurate identification, definition and classification of TEs are still inadequate. In this study, we identified 18 393 TEs from Populus trichocarpa, Populus euphratica and Salix suchowensis using a combination of signature-based, similarity-based and De novo method, and annotated them into 1621 families. A comprehensive and user-friendly web-based database, SPTEdb, was constructed and served for researchers. SPTEdb enables users to browse, retrieve and download the TEs sequences from the database. Meanwhile, several analysis tools, including BLAST, HMMER, GetORF and Cut sequence, were also integrated into SPTEdb to help users to mine the TEs data easily and effectively. In summary, SPTEdb will facilitate the study of TEs biology and functional genomics in salicaceous plants. Database URL: http://genedenovoweb.ticp.net:81/SPTEdb/index.php PMID:29688371

  1. Initial spacing of poplars and willows grown as arable coppice

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, A.; Johns, C.

    1997-11-01

    Two clones of poplar and two clones of willow were grown at two sites, on a three year cutting cycle, at six different square spacings, between 0.8 metres and 1.5 metres. The two willow clones 'Bowles hybrid' and 'Dasyclados' were planted at both sites. The poplar clones Populus interamericana 'Beaupre' and Populus trichocarpa 'Columbia River'' were planted at Wishanger in Hampshire. The poplar clones Populus interamericana 'Boelare' and Populus trichocarpa 'Trichobel' were planted at Downham Market in Norfolk. The highest yield of 17.55 oven dry tonnes per hectare (odt/ha/annum) was obtained from 'Bowles hybrid', at the closest spacing, grown on a water meadow adjacent to the River Wey at Wishanger. The highest yield for all clones at both sites was achieved at the closest spacing (in this first rotation). There was a significant linear effect. One of the most interesting observations was that when comparing the gradient of the linear relationship, within species, the gradient was steeper for the higher yielding clone. This was particularly so for the willows. This would suggest that higher yielding clones are more tolerant of crowding, or, that upright Salix viminalis make better use of close space than the more spreading Salix dasyclados. The new Salix x Salix schwerinnii hybrids should therefore also be responsive to closer spacing. The same effect was observed for the poplars at Wishanger only, but the difference was not as dramatic. There was a suggestion from the highest yielding poplar plots that optimum yield may still be obtained at the currently recommended spacing of 1.0 metre x 1.0 metre. (author)

  2. Herbivore-induced poplar cytochrome P450 enzymes of the CYP71 family convert aldoximes to nitriles which repel a generalist caterpillar.

    Science.gov (United States)

    Irmisch, Sandra; Clavijo McCormick, Andrea; Günther, Jan; Schmidt, Axel; Boeckler, Gerhard Andreas; Gershenzon, Jonathan; Unsicker, Sybille B; Köllner, Tobias G

    2014-12-01

    Numerous plant species emit volatile nitriles upon herbivory, but the biosynthesis as well as the relevance of these nitrogenous compounds in plant-insect interactions remains unknown. Populus trichocarpa has been shown to produce a complex blend of nitrogenous volatiles, including aldoximes and nitriles, after herbivore attack. The aldoximes were previously reported to be derived from amino acids by the action of cytochrome P450 enzymes of the CYP79 family. Here we show that nitriles are derived from aldoximes by another type of P450 enzyme in P. trichocarpa. First, feeding of deuterium-labeled phenylacetaldoxime to poplar leaves resulted in incorporation of the label into benzyl cyanide, demonstrating that poplar volatile nitriles are derived from aldoximes. Then two P450 enzymes, CYP71B40v3 and CYP71B41v2, were characterized that produce aliphatic and aromatic nitriles from their respective aldoxime precursors. Both possess typical P450 sequence motifs but do not require added NADPH or cytochrome P450 reductase for catalysis. Since both enzymes are expressed after feeding by gypsy moth caterpillars, they are likely to be involved in herbivore-induced volatile nitrile emission in P. trichocarpa. Olfactometer experiments showed that these volatile nitriles have a strong repellent activity against gypsy moth caterpillars, suggesting they play a role in induced direct defense against poplar herbivores. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

  3. Biomass production of intensively grown poplars in the southernmost part of Sweden: Observations of characters, traits and growth potential

    International Nuclear Information System (INIS)

    Christersson, Lars

    2006-01-01

    Observation of possibilities and problems was performed when trying to optimise growing conditions for high biomass production by irrigation and fertilisation in a clone test of poplar on sandy soil in the south of Sweden. One hundred and eight clones of pure Populus trichocarpa and hybrids between P. trichocarpa and P. deltoides were evaluated for growth rate, phenology, quality, frost hardiness and pest resistance. Some fertilisation experiments were performed. In some years, some unfertilised clones produced up to 2 kg m -2 of woody dry biomass. Some fertilised clones produced almost twice as much in the years following fertilisation. Stem canker was the main cause of serious injuries in all hybrids, but pure P. trichocarpa stems were not affected. The cimbicid sawfly (Cimbex lutea) caused damage to the quality of the trees in the form of curved stems of some clones. Winter frost killed top shoots of the hybrids in a year with particularly low winter temperatures with long duration. Summer frost (in June) killed up to 1 m of some young top shoots in some clones in the first 3-4 years. The results are discussed in terms of radiation utilisation efficiency, energy efficient ratio, and water and nutrient use efficiency. The discussion finishes with the conclusion that fertilisation, but not irrigation, can be economically motivated. If irrigation is to be economic, then the main objective of the whole operation should be to produce drinkable water from water polluted by society. Biomass production would then be a bonus

  4. Rapid continental-scale vegetation response to the Younger Dryas Cool Episode

    Science.gov (United States)

    Peros, M.; Gajewski, K.; Viau, A.

    2006-12-01

    The Younger Dryas Cool Episode had rapid and widespread effects on flora and fauna throughout the Americas. Fossil pollen records document how plant communities responded to this event, although such data are generally only representative of changes at local- to regional-scales. We use a new approach to provide insight into vegetation responses to the Younger Dryas at a continental-scale, by focusing on data extracted for a single taxon (Populus poplar, cottonwood, aspen) from pollen diagrams throughout North America. We show that Populus underwent a rapid and continent-wide decline as the climate rapidly cooled and dried. At the termination of the Younger Dryas, Populus underwent another widespread decline, this time in response to competition from boreal and temperate taxa as the climate abruptly warmed. Late glacial-early Holocene pollen assemblages with high quantities of Populus pollen often lack modern analogues and thus confound quantitative paleoclimatic reconstructions; our results provide a context to interpret these assemblages. Furthermore, while Populus may continue to expand in the future in response to human disturbance and increasing temperatures, its sensitivity to competition may eventually put it at risk as global warming accelerates.

  5. Insights into some physiological and biochemical responses of Populus alba and Populus nigra to lead contamination

    Directory of Open Access Journals (Sweden)

    Elham Etemadi

    2016-12-01

    Full Text Available The effects of lead (PbCl2 increment, under hydroponic conditions up to 15, 45 and 90 mg/l in presence of EDTA, on some physiological and biochemical traits of one year old saplings of P. nigra and P. alba, were investigated. Six weeks after establishing in target concentration, the amount of lead, biomass, water, soluble sugars, proline, electrolyte leakage, malondialdehyde, and pigments were assessed in different organs. The results revealed that with increasing lead concentration in culture medium in the studied period, the amount of lead in saplings increased, but no effect was observed on their biomass. In both species the magnitude of lead accumulation in root was higher than leaf. P. nigra had more water and less soluble sugars than P. alba. The concentration of soluble sugars increased up to 1.5 times with lead increment in both species, but proline content increased only in P. nigra up to 2 times and remained constant in P. alba. Elevation of electrolyte leakage in saplings of P. nigra in excess lead treatment was accompanied by no change in malondialdehyde content. Concentrations of pigments were not affected by lead, and only the ratio of chlorophyll a to b in P. nigra increased in high lead concentration. In general both species accumulated high extent of lead in their organs. But it seems that P. nigra, at least with respect of enhancing plasma membrane permeability, increasing proline and the ratio of chlorophyll a to b, was more sensitive to this toxic metal in compare with P. alba.

  6. The optimization of sewage sludge and effluent disposal on energy crops of short rotation hybrid poplar

    Energy Technology Data Exchange (ETDEWEB)

    Moffat, A.J.; Armstrong, A.T. [Forest Research, Farnham (United Kingdom); Ockleston, J. [Thames Water Utilities Ltd., Reading (United Kingdom)

    2001-07-01

    An experiment was set up to test the effect of sewage sludge application and waste water irrigation on the biomass production of two poplar varieties, Populus trichocarpa x P. deltoides ''Beaupre'', and Populus trichocarpa ''Trichobel''. Three sludge applications were examined factorially with two irrigation regimes (with and without), over the two final years of a three-year rotation. The effects of treatment on soil and soil water were monitored, and the amount of heavy metals removed in the biomass was quantified. Irrigation had a significant effect on biomass of both poplar varieties, with Beaupre yielding more than Trichobel. Sludge application was not effective in increasing biomass yield, but the experiment was valuable in identifying that modest amounts of sludge (approximately 100 m{sup 3} ha{sup -1} yr{sup -1}) were acceptable environmentally and did not compromise biomass production. Cadmium uptake was detected in the poplar biomass, but the amounts were small and insufficient for poplar to be used in phytoremediation of metal-contaminated land. (author)

  7. Red Cedar Invasion Along the Missouri River, South Dakota: Cause and Consequence

    Science.gov (United States)

    Greene, S.; Knox, J. C.

    2012-12-01

    This research evaluates drivers of and ecosystem response to red cedar (Juniperus virginiana) invasion of riparian surfaces downstream of Gavin's Point Dam on the Missouri River. Gavin's Point Dam changed the downstream geomorphology and hydrology of the river and its floodplain by reducing scouring floods and flood-deposited sediment. The native cottonwood species (Populus deltoides) favors cleared surfaces with little to no competitors to establish. Now that there are infrequent erosive floods along the riparian surfaces to remove competitor seeds and seedlings, other vegetation is able to establish. Red cedar is invading the understory of established cottonwood stands and post-dam riparian surfaces. To assess reasons and spatial patterns for the recent invasion of red cedar, a stratified random sampling of soil, tree density and frequency by species, and tree age of 14 forest stands was undertaken along 59 river kilometers of riparian habitat. Soil particle size was determined using laser diffraction and tree ages were estimated from ring counts of tree cores. As an indicator of ecosystem response to invasion, we measured organic matter content in soil collected beneath red cedar and cottonwood trees at three different depths. Of 565 red cedars, only two trees were established before the dam was built. We applied a multiple regression model of red cedar density as a function of cottonwood density and percent sand (63-1000 microns in diameter) in StatPlus© statistical software. Cottonwood density and percent sand are strongly correlated with invasion of red cedar along various riparian surfaces (n = 59, R2 = 0.42, p-values cedar and cottonwood trees (p-value > 0.05 for all depths). These findings suggest that the dam's minimization of downstream high-stage flows opened up new habitat for red cedar to establish. Fluvial geomorphic surfaces reflect soil type and cottonwood density and, in turn, predict susceptibility of a surface to red cedar invasion. Nonetheless

  8. Decomposition of leaf litter from a native tree and an actinorhizal invasive across riparian habitats.

    Science.gov (United States)

    Harner, Mary J; Crenshaw, Chelsea L; Abelho, Manuela; Stursova, Martina; Shah, Jennifer J Follstad; Sinsabaugh, Robert L

    2009-07-01

    Dynamics of nutrient exchange between floodplains and rivers have been altered by changes in flow management and proliferation of nonnative plants. We tested the hypothesis that the nonnative, actinorhizal tree, Russian olive (Elaeagnus angustifolia), alters dynamics of leaf litter decomposition compared to native cottonwood (Populus deltoides ssp. wislizeni) along the Rio Grande, a river with a modified flow regime, in central New Mexico (U.S.A.). Leaf litter was placed in the river channel and the surface and subsurface horizons of forest soil at seven riparian sites that differed in their hydrologic connection to the river. All sites had a cottonwood canopy with a Russian olive-dominated understory. Mass loss rates, nutrient content, fungal biomass, extracellular enzyme activities (EEA), and macroinvertebrate colonization were followed for three months in the river and one year in forests. Initial nitrogen (N) content of Russian olive litter (2.2%) was more than four times that of cottonwood (0.5%). Mass loss rates (k; in units of d(-1)) were greatest in the river (Russian olive, k = 0.0249; cottonwood, k = 0.0226), intermediate in subsurface soil (Russian olive, k = 0.0072; cottonwood, k = 0.0031), and slowest on the soil surface (Russian olive, k = 0.0034; cottonwood, k = 0.0012) in a ratio of about 10:2:1. Rates of mass loss in the river were indistinguishable between species and proportional to macroinvertebrate colonization. In the riparian forest, Russian olive decayed significantly faster than cottonwood in both soil horizons. Terrestrial decomposition rates were related positively to EEA, fungal biomass, and litter N, whereas differences among floodplain sites were related to hydrologic connectivity with the river. Because nutrient exchanges between riparian forests and the river have been constrained by flow management, Russian olive litter represents a significant annual input of N to riparian forests, which now retain a large portion of slowly

  9. Cottonwood Management Plan / Draft Programmatic Environmental Assessment. Proposed Implementation of a Cottonwood Management Plan Along Six Priority Segments of the Missouri River

    Science.gov (United States)

    2010-02-01

    floodplain ridges, levees, and road embankments), concave-up areas ( depressions , such as river channels, floodplain swales, and drainage ditches), and areas... depressions in dry, open, sandy areas with less than 30 percent vegetative cover and plant heights less than 1 foot (from USFWS 1990b; USFWS, 1990c as...U.S. Department of the Interior, NPS and the U.S. Army Corps of Engineers. National Park Service (NPS). 2007. First Annual Centennial Strategy for

  10. Biodegradation of Nitro-Substituted Explosives 2,4,6-Trinitrotoluene, Hexahydro-1,3,5-Trinitro-1,3,5-Triazine, and Octahydro-1,3,5,7-Tetranitro-1,3,5-Tetrazocine by a Phytosymbiotic Methylobacterium sp. Associated with Poplar Tissues (Populus deltoides × nigra DN34)

    Science.gov (United States)

    Van Aken, Benoit; Yoon, Jong Moon; Schnoor, Jerald L.

    2004-01-01

    A pink-pigmented symbiotic bacterium was isolated from hybrid poplar tissues (Populus deltoides × nigra DN34). The bacterium was identified by 16S and 16S-23S intergenic spacer ribosomal DNA analysis as a Methylobacterium sp. (strain BJ001). The isolated bacterium was able to use methanol as the sole source of carbon and energy, which is a specific attribute of the genus Methylobacterium. The bacterium in pure culture was shown to degrade the toxic explosives 2,4,6-trinitrotoluene (TNT), hexahydro-1,3,5-trinitro-1,3,5-triazene (RDX), and octahydro-1,3,5,7-tetranitro-1,3,5-tetrazocine (HMX). [U-ring-14C]TNT (25 mg liter−1) was fully transformed in less than 10 days. Metabolites included the reduction derivatives amino-dinitrotoluenes and diamino-nitrotoluenes. No significant release of 14CO2 was recorded from [14C]TNT. In addition, the isolated methylotroph was shown to transform [U-14C]RDX (20 mg liter−1) and [U-14C]HMX (2.5 mg liter−1) in less than 40 days. After 55 days of incubation, 58.0% of initial [14C]RDX and 61.4% of initial [14C]HMX were mineralized into 14CO2. The radioactivity remaining in solution accounted for 12.8 and 12.7% of initial [14C]RDX and [14C]HMX, respectively. Metabolites detected from RDX transformation included a mononitroso RDX derivative and a polar compound tentatively identified as methylenedinitramine. Since members of the genus Methylobacterium are distributed in a wide diversity of natural environments and are very often associated with plants, Methylobacterium sp. strain BJ001 may be involved in natural attenuation or in situ biodegradation (including phytoremediation) of explosive-contaminated sites. PMID:14711682

  11. Modeling Phosphorus Capture by Plants Growing in a Multispecies Riparian Buffer

    Directory of Open Access Journals (Sweden)

    J. M. Kelly

    2012-01-01

    Full Text Available The NST 3.0 mechanistic nutrient uptake model was used to explore P uptake to a depth of 120 cm over a 126 d growing season in simulated buffer communities composed of mixtures of cottonwood (Populus deltoids Bartr., switchgrass (Panicum virgatum L., and smooth brome (Bromus inermis Leyss. Model estimates of P uptake from pure stands of smooth brome and cottonwood were 18.9 and 24.5 kg ha−1, respectively. Uptake estimates for mixed stands of trees and grasses were intermediate to pure stands. A single factor sensitivity analysis of parameters used to calculate P uptake for each cover type indicated that Imax, k, ro, and Lo were consistently the most responsive to changes ranging from −50% to +100%. Model exploration of P uptake as a function of soil depth interval indicated that uptake was highest in the 0–30 cm intervals, with values ranging from 85% of total for cottonwood to 56% for switchgrass.

  12. How do riparian woody seedlings survive seasonal drought?

    Science.gov (United States)

    Stella, John C; Battles, John J

    2010-11-01

    In semi-arid regions, a major population limitation for riparian trees is seedling desiccation during the dry season that follows annual spring floods. We investigated the stress response of first-year pioneer riparian seedlings to experimental water table declines (0, 1 and 3 cm day(-1)), focusing on the three dominant cottonwood and willows (family Salicaceae) in California's San Joaquin Basin. We analyzed growth and belowground allocation response to water stress, and used logistic regression to determine if these traits had an influence on individual survival. The models indicate that high root growth (>3 mm day(-1)) and low shoot:root ratios (water-use efficiency for surviving water stress. Both S. gooddingii and sandbar willow (S. exigua) reduced leaf size from controls, whereas Fremont cottonwood (Populus fremontii) sustained a 29% reduction in specific leaf area (from 13.4 to 9.6 m(2) kg(-1)). The functional responses exhibited by Goodding's willow, the more drought-tolerant species, may play a role in its greater relative abundance in dry regions such as the San Joaquin Basin. This study highlights the potential for a shift in riparian forest composition. Under a future drier climate regime or under reduced regulated river flows, our results suggest that willow establishment will be favored over cottonwood.

  13. Overexpression of the PtSOS2 gene improves tolerance to salt stress in transgenic poplar plants.

    Science.gov (United States)

    Yang, Yang; Tang, Ren-Jie; Jiang, Chun-Mei; Li, Bei; Kang, Tao; Liu, Hua; Zhao, Nan; Ma, Xu-Jun; Yang, Lei; Chen, Shao-Liang; Zhang, Hong-Xia

    2015-09-01

    In higher plants, the salt overly sensitive (SOS) signalling pathway plays a crucial role in maintaining ion homoeostasis and conferring salt tolerance under salinity condition. Previously, we functionally characterized the conserved SOS pathway in the woody plant Populus trichocarpa. In this study, we demonstrate that overexpression of the constitutively active form of PtSOS2 (PtSOS2TD), one of the key components of this pathway, significantly increased salt tolerance in aspen hybrid clone Shanxin Yang (Populus davidiana × Populus bolleana). Compared to the wild-type control, transgenic plants constitutively expressing PtSOS2TD exhibited more vigorous growth and produced greater biomass in the presence of high concentrations of NaCl. The improved salt tolerance was associated with a decreased Na(+) accumulation in the leaves of transgenic plants. Further analyses revealed that plasma membrane Na(+) /H(+) exchange activity and Na(+) efflux in transgenic plants were significantly higher than those in the wild-type plants. Moreover, transgenic plants showed improved capacity in scavenging reactive oxygen species (ROS) generated by salt stress. Taken together, our results suggest that PtSOS2 could serve as an ideal target gene to genetically engineer salt-tolerant trees. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  14. 77 FR 50914 - Anchorage; Change to Cottonwood Island Anchorage, Columbia River, Oregon and Washington

    Science.gov (United States)

    2012-08-23

    ... under Executive Order 13211. 13. Technical Standards The National Technology Transfer and Advancement... of Proposed Rulemaking A. Regulatory History and Information On June 13, 2011, the Coast Guard...'' comprises small businesses, not-for-profit organizations that are independently owned and operated and are...

  15. 76 FR 49527 - Supplemental Environmental Impact Statement; Cottonwood and Watonwan Counties, Minnesota

    Science.gov (United States)

    2011-08-10

    ... facility: (1) Just west of the City of St. James to the eastern edge of the City of Butterfield, (2) western edge of the City of Butterfield to just east of the city of Mountain Lake, and (3) just west of... comment period. Public notice will be give for the time and place of the hearing. A final Supplemental EIS...

  16. 78 FR 13376 - Draft Environmental Impact Statement for the Cottonwood Cove and Katherine Landing Development...

    Science.gov (United States)

    2013-02-27

    ..., enhance the visitor experience, and mitigate flood hazards. The lake management plan established water... Current Management Trends (no action alternative) reflects current management direction and serves as a... flood mitigation. Alternative 3 Enhance Visitor Experience and Park Operations (agency-preferred...

  17. Biomass production and carbon storage of Populus ×canadensis ...

    African Journals Online (AJOL)

    euramericana (Dode) Guinier ex Piccarolo) clone I-214 have good potential for biomass production. The objective of the study was estimation of biomass using allometric equations and estimation of carbon allocation according to tree components.

  18. Genetic transformation of Populus tomentosa to improve salt tolerance

    Science.gov (United States)

    Ningxia Du; Xin Liu; Yun Li; Shouyi Chen; Jinsong Zhang; Da Ha; Wenguang Deng; Chunkui Sun; Yingzhi Zhang; Paula M Pijut

    2012-01-01

    Soil salinity can be a limiting factor for productivity in agriculture and forestry. In order to fully utilize saline lands productively in plantation forestry for pulp production, the genetic modification of tree species for salt tolerance may be required. The AhDREB1 gene, a DREB-like transcription factor gene, was transferred into ...

  19. Cadmium phytoextraction potential of poplar clones (Populus spp.)

    Energy Technology Data Exchange (ETDEWEB)

    Pilipovic, A.; Orlovic, S.; Petrovic, N. [Faculty of Agriculture, Inst. of Lowland Forestry and Environment, Novi Sad (Czechoslovakia); Nikolic, N.; Krstic, B. [Faculty of Natural Sciences, Dept. of Biology and Ecology, Novi Sad (Czechoslovakia)

    2005-04-01

    Biomass production, leaf number and area, photosynthetic and dark respiration rates, leaf concentration of photosynthetic pigments, nitrate reductase activity, as well as cadmium concentrations in leaves, stem, and roots were measured in poplar clones PE 4/68, B-229, 665, and 45/51. Plants were grown hydroponically under controlled conditions and treated with two different cadmium (Cd) concentrations (10{sup -5} and 10{sup -7} M) in the same background solution (Hoagland's solution). The presence of Cd did not cause serious disturbance of growth and physiological parameters in the studied poplar clones. Cd concentrations in plant tissues reflected external concentrations. In treated plants, root contents increased from 38.57 to 511.51 ppm, leaf contents from 0.91 to 7.50, while stem contents ranged from 1.37 to 9.50 ppm. (orig.)

  20. Generalized height-diameter models for Populus tremula L. stands

    African Journals Online (AJOL)

    USER

    2010-07-12

    Jul 12, 2010 ... and stand density) into the base height-diameter models increased the accuracy of prediction for P. tremula. .... parameter estimates compared with those obtained with ... using coefficient of determination for non-linear regression (. 2. R ), ..... stochastic height-diameter model for maritime pine ecoregions in.

  1. Slow lifelong growth predisposes Populus tremuloides to tree mortality

    Science.gov (United States)

    Kathryn B. Ireland; Margaret M. Moore; Peter Z. Fule; Thomas J. Zegler; Robert E. Keane

    2014-01-01

    Widespread dieback of aspen forests, sometimes called sudden aspen decline, has been observed throughout much of western North America, with the highest mortality rates in the southwestern United States. Recent aspen mortality has been linked to drought stress and elevated temperatures characteristic of conditions expected under climate change, but the role of...

  2. Evaluation of flooding tolerance in cuttings of Populus clones used ...

    African Journals Online (AJOL)

    We analysed the responses to flooding of 14 poplar clones used for forestation at the Paraná River Delta, Argentina. Some are commercial clones planted in the area, and others belong to a poplar breeding program from the National Institute of Agricultural Technology (INTA) in Argentina. Potted plants of 60 cm high ...

  3. Genome-wide analysis of SINA family in plants and their phylogenetic relationships.

    Science.gov (United States)

    Wang, Meng; Jin, Ying; Fu, Junjie; Zhu, Yun; Zheng, Jun; Hu, Jian; Wang, Guoying

    2008-06-01

    SINA genes in plants are part of a multigene family with 5 members in Arabidopsis thaliana, 10 members in Populus trichocarpa, 6 members in Oryza sativa, at least 6 members in Zea mays and at least 1 member in Physcomitrella patens. Six members in maize were confirmed by RT-PCR. All SINAs have one RING domain and one SINA domain. These two domains are highly conserved in plants. According to the motif organization and phylogenetic tree, SINA family members were divided into 2 groups. In addition, through semi-quantitative RT-PCR analysis of maize members and Digital Northern analysis of Arabidopsis and rice members, we found that the tissue expression patterns are more diverse in monocot than in Arabidopsis.

  4. Dicty_cDB: Contig-U01541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

  5. Overexpression of PtABCC1 contributes to mercury tolerance and accumulation in Arabidopsis and poplar.

    Science.gov (United States)

    Sun, Liping; Ma, Yifeng; Wang, Huihong; Huang, Weipeng; Wang, Xiaozhu; Han, Li; Sun, Wanmei; Han, Erqin; Wang, Bangjun

    2018-03-18

    Mercury (Hg) is a highly biotoxic heavy metal that contaminates the environment. Phytoremediation is a green technology for environmental remediation and is used to clean up Hg contaminated soil in recent years. In this study, we isolated an ATP-binding cassette (ABC) transporter gene PtABCC1 from Populus trichocarpa and overexpressed it in Arabidopsis and poplar. The transgenic plants conferred higher Hg tolerance than wild type (WT) plants, and overexpression of PtABCC1 could lead to 26-72% or 7-160% increase of Hg accumulation in Arabidopsis or poplar plants, respectively. These results demonstrated that PtABCC1 plays a crucial role in enhancing tolerance and accumulation to Hg in plants, which provides a promising way for phytoremediation of Hg contamination. Copyright © 2018 Elsevier Inc. All rights reserved.

  6. Functional genomic analysis supports conservation of function among cellulose synthase-like a gene family members and suggests diverse roles of mannans in plants

    DEFF Research Database (Denmark)

    Liepman, Aaron H; Nairn, C Joseph; Willats, William G T

    2007-01-01

    from Arabidopsis (Arabidopsis thaliana), guar (Cyamopsis tetragonolobus), and Populus trichocarpa catalyze beta-1,4-mannan and glucomannan synthase reactions in vitro. Mannan polysaccharides and homologs of CslA genes appear to be present in all lineages of land plants analyzed to date. In many plants......, the CslA genes are members of extended multigene families; however, it is not known whether all CslA proteins are glucomannan synthases. CslA proteins from diverse land plant species, including representatives of the mono- and dicotyledonous angiosperms, gymnosperms, and bryophytes, were produced...... they are prevalent at cell junctions and in buds. Taken together, these results demonstrate that members of the CslA gene family from diverse plant species encode glucomannan synthases and support the hypothesis that mannans function in metabolic networks devoted to other cellular processes in addition to cell wall...

  7. Dragon TIS Spotter: An Arabidopsis-derived predictor of translation initiation sites in plants

    KAUST Repository

    Magana-Mora, Arturo; Ashoor, Haitham; Jankovic, Boris R.; Kamau, Allan; Awara, Karim; Chowdhary, Rajesh; Archer, John A.C.; Bajic, Vladimir B.

    2012-01-01

    In higher eukaryotes, the identification of translation initiation sites (TISs) has been focused on finding these signals in cDNA or mRNA sequences. Using Arabidopsis thaliana (A.t.) information, we developed a prediction tool for signals within genomic sequences of plants that correspond to TISs. Our tool requires only genome sequence, not expressed sequences. Its sensitivity/specificity is for A.t. (90.75%/92.2%), for Vitis vinifera (66.8%/94.4%) and for Populus trichocarpa (81.6%/94.4%), which suggests that our tool can be used in annotation of different plant genomes. We provide a list of features used in our model. Further study of these features may improve our understanding of mechanisms of the translation initiation. The Author(s) 2012. Published by Oxford University Press.

  8. Genomic research in Eucalyptus.

    Science.gov (United States)

    Poke, Fiona S; Vaillancourt, René E; Potts, Brad M; Reid, James B

    2005-09-01

    Eucalyptus L'Hérit. is a genus comprised of more than 700 species that is of vital importance ecologically to Australia and to the forestry industry world-wide, being grown in plantations for the production of solid wood products as well as pulp for paper. With the sequencing of the genomes of Arabidopsis thaliana and Oryza sativa and the recent completion of the first tree genome sequence, Populus trichocarpa, attention has turned to the current status of genomic research in Eucalyptus. For several eucalypt species, large segregating families have been established, high-resolution genetic maps constructed and large EST databases generated. Collaborative efforts have been initiated for the integration of diverse genomic projects and will provide the framework for future research including exploiting the sequence of the entire eucalypt genome which is currently being sequenced. This review summarises the current position of genomic research in Eucalyptus and discusses the direction of future research.

  9. Dragon TIS Spotter: An Arabidopsis-derived predictor of translation initiation sites in plants

    KAUST Repository

    Magana-Mora, Arturo

    2012-10-30

    In higher eukaryotes, the identification of translation initiation sites (TISs) has been focused on finding these signals in cDNA or mRNA sequences. Using Arabidopsis thaliana (A.t.) information, we developed a prediction tool for signals within genomic sequences of plants that correspond to TISs. Our tool requires only genome sequence, not expressed sequences. Its sensitivity/specificity is for A.t. (90.75%/92.2%), for Vitis vinifera (66.8%/94.4%) and for Populus trichocarpa (81.6%/94.4%), which suggests that our tool can be used in annotation of different plant genomes. We provide a list of features used in our model. Further study of these features may improve our understanding of mechanisms of the translation initiation. The Author(s) 2012. Published by Oxford University Press.

  10. The Eucalyptus grandis R2R3-MYB transcription factor family: evidence for woody growth-related evolution and function.

    Science.gov (United States)

    Soler, Marçal; Camargo, Eduardo Leal Oliveira; Carocha, Victor; Cassan-Wang, Hua; San Clemente, Hélène; Savelli, Bruno; Hefer, Charles A; Paiva, Jorge A Pinto; Myburg, Alexander A; Grima-Pettenati, Jacqueline

    2015-06-01

    The R2R3-MYB family, one of the largest transcription factor families in higher plants, controls a wide variety of plant-specific processes including, notably, phenylpropanoid metabolism and secondary cell wall formation. We performed a genome-wide analysis of this superfamily in Eucalyptus, one of the most planted hardwood trees world-wide. A total of 141 predicted R2R3-MYB sequences identified in the Eucalyptus grandis genome sequence were subjected to comparative phylogenetic analyses with Arabidopsis thaliana, Oryza sativa, Populus trichocarpa and Vitis vinifera. We analysed features such as gene structure, conserved motifs and genome location. Transcript abundance patterns were assessed by RNAseq and validated by high-throughput quantitative PCR. We found some R2R3-MYB subgroups with expanded membership in E. grandis, V. vinifera and P. trichocarpa, and others preferentially found in woody species, suggesting diversification of specific functions in woody plants. By contrast, subgroups containing key genes regulating lignin biosynthesis and secondary cell wall formation are more conserved across all of the species analysed. In Eucalyptus, R2R3-MYB tandem gene duplications seem to disproportionately affect woody-preferential and woody-expanded subgroups. Interestingly, some of the genes belonging to woody-preferential subgroups show higher expression in the cambial region, suggesting a putative role in the regulation of secondary growth. © 2014 The Authors New Phytologist © 2014 New Phytologist Trust.

  11. PtrWRKY73, a salicylic acid-inducible poplar WRKY transcription factor, is involved in disease resistance in Arabidopsis thaliana.

    Science.gov (United States)

    Duan, Yanjiao; Jiang, Yuanzhong; Ye, Shenglong; Karim, Abdul; Ling, Zhengyi; He, Yunqiu; Yang, Siqi; Luo, Keming

    2015-05-01

    A salicylic acid-inducible WRKY gene, PtrWRKY73, from Populus trichocarpa , was isolated and characterized. Overexpression of PtrWRKY73 in Arabidopsis thaliana increased resistance to biotrophic pathogens but reduced resistance against necrotrophic pathogens. WRKY transcription factors are commonly involved in plant defense responses. However, limited information is available about the roles of the WRKY genes in poplar defense. In this study, we isolated a salicylic acid (SA)-inducible WRKY gene, PtrWRKY73, from Populus trichocarpa, belonging to group I family and containing two WRKY domains, a D domain and an SP cluster. PtrWRKY73 was expressed predominantly in roots, old leaves, sprouts and stems, especially in phloem and its expression was induced in response to treatment with exogenous SA. PtrWRKY73 was localized to the nucleus of plant cells and exhibited transcriptional activation. Overexpression of PtrWRKY73 in Arabidopsis thaliana resulted in increased resistance to a virulent strain of the bacterial pathogen Pseudomonas syringae (PstDC3000), but more sensitivity to the necrotrophic fungal pathogen Botrytis cinerea. The SA-mediated defense-associated genes, such as PR1, PR2 and PAD4, were markedly up-regulated in transgenic plants overexpressing PtrWRKY73. Arabidopsis non-expressor of PR1 (NPR1) was not affected, whereas a defense-related gene PAL4 had reduced in PtrWRKY73 overexpressor plants. Together, these results indicated that PtrWRKY73 plays a positive role in plant resistance to biotrophic pathogens but a negative effect on resistance against necrotrophic pathogens.

  12. River flow and riparian vegetation dynamics - implications for management of the Yampa River through Dinosaur National Monument

    Science.gov (United States)

    Scott, Michael L; Friedman, Jonathan M.

    2018-01-01

    This report addresses the relation between flow of the Yampa River and occurrence of herbaceous and woody riparian vegetation in Dinosaur National Monument (DINO) with the goal of informing management decisions related to potential future water development. The Yampa River in DINO flows through diverse valley settings, from the relatively broad restricted meanders of Deerlodge Park to narrower canyons, including debris fan-affected reaches in the upper Yampa Canyon and entrenched meanders in Harding Hole and Laddie Park. Analysis of occurrence of all plant species measured in 1470 quadrats by multiple authors over the last 24 years shows that riparian vegetation along the Yampa River is strongly related to valley setting and geomorphic surfaces, defined here as active channel, active floodplain, inactive floodplain, and upland. Principal Coordinates Ordination arrayed quadrats and species along gradients of overall cover and moisture availability, from upland and inactive floodplain quadrats and associated xeric species like western wheat grass (Pascopyrum smithii), cheatgrass (Bromus tectorum), and saltgrass (Distichlis spicata) to active channel and active floodplain quadrats supporting more mesic species including sandbar willow (Salix exigua), wild licorice (Glycyrrhiza lepidota), and cordgrass (Spartina spp.). Indicator species analysis identified plants strongly correlated with geomorphic surfaces. These species indicate state changes in geomorphic surfaces, such as the conversion of active channel to floodplain during channel narrowing. The dominant woody riparian species along the Yampa River are invasive tamarisk (Tamarix ramosissima), and native Fremont cottonwood (Populus deltoides ssp. wislizenii), box elder (Acer negundo L. var. interius), and sandbar willow (Salix exigua). These species differ in tolerance of drought, salinity, inundation, flood disturbance and shade, and in seed size, timing of seed dispersal and ability to form root sprouts. These

  13. Variation in experimental flood impacts and ecogeomorphic feedbacks among native and exotic riparian tree seedlings

    Science.gov (United States)

    Kui, L.; Stella, J. C.; Skorko, K.; Lightbody, A.; Wilcox, A. C.; Bywater-Reyes, S.

    2012-12-01

    Flooding interacts with riparian plants on a variety of scales, resulting in coevolution of geomorphic surfaces with plant vegetation communities. Our research aims to develop a mechanistic understanding of riparian seedling damage from small floods, with a focus on differential responses among species (native and non-native), ecogeomorphic feedbacks, and implications for riparian restoration. We tested the effects of controlled flood events on cottonwood (Populus fremontii) and tamarisk (Tamarix spp.) seedlings in an experimental meandering stream channel. We hypothesized that seedling dislodgement and burial would be influenced by individual plant height, species-specific morphology, patch density, and differences in hydraulic forces (as a function of location on the bar). Four experimental floods were tested, with different combinations of plant species and seedling densities. For each flood run, rooted seedlings were installed within a 1.5-m-wide sandbar during low flow conditions and stream discharge was increased to a constant flood level for approximately 8 hours, after which seedling response was assessed. Seedling damage was analyzed within a logistic regression framework that predicted the probability of dislodgement or burial as a function of the explanatory variables. Plant dislodgement depended on root length and the location on the sandbar, whereas burial depended on plant height, species-specific morphology, and location. For every centimeter increase in plant height, the odds of plant burial decreased by 10 percent, illustrating the rate at which plants developed flood resistance as they grow taller. With every meter closer to the thalweg, plant dislodgement was four times more likely, and plant burial was 2.6 times more likely. The probability of burial was twice as great for tamarisk seedlings as for cottonwood. The increased sedimentation within tamarisk patches was associated with a denser foliage and a more compact crown for this species. The

  14. Factors Influencing the Tissue Culture and the Agrobacterium tumefaciens-Mediated Transformation of Hybrid Aspen and Poplar Clones.

    Science.gov (United States)

    De Block, M

    1990-07-01

    Tissue culture conditions and transformation have been established for both aspen and poplar. The use of previously described culture conditions resulted in shoot tip necrosis in the shoot cultures and necrosis of stem and leaf explants. Shoot tip necrosis could be overcome by buffering the medium with 2-(N-morpholino)ethanesulfonic acid and Ca-gluconate and by growing the shoots below 25 degrees C. Necrosis of the explants was probably due to an accumulation of ammonium in the explants and could be overcome by adapting the NO(3) (-)/NH(4) (+) ratio of the media. Stem explants of established shoot cultures of the aspen hybrid Populus alba x P. tremula and of the poplar hybrid Populus trichocarpa x P. deltoides were cocultivated with Agrobacterium strains having chimeric bar and neo genes on their disarmed tDNAs. Transformed aspen shoots were obtained from 30 to 40% of the explants, while transformed poplar shoots were obtained from 10% of the explants. Extracts from the transformed trees contained high phosphinotricin acetyltransferase and neomycin phosphotransferase activities, and the trees contained one to three copies of the chimeric genes. The transformed trees were completely resistant to the commercial preparations of the herbicide phosphinotricin (glufosinate), while control trees were not.

  15. Tamarisk control, water salvage, and wildlife habitat restoration along rivers in the western United States

    Science.gov (United States)

    Shafroth, Patrick B.

    2006-01-01

    In the latter part of the 19th century, species of the nonnative shrub tamarisk (also called saltcedar; for example, Tamarix ramosissima, T. chinensis) were introduced to the United States for use as ornamental plants for erosion control. By 1877, some naturalized populations had become established, and by the 1960s, tamarisk was present along most rivers in the semi-arid and arid parts of the West and was quite abundant along downstream ranches of the major southwest rivers such as the Colorado, Rio Grande, Gila, and Pecos. The principal period of tamarisk invasion coincided with changing physical conditions along western rivers associated with the construction and operation of dams. In many cases, these altered physical conditions appear to have been more favorable for tamarisk than native riparian competitors like cottonwoods and willows (Populus and Salix; Glenn and Nagler, 2005).

  16. When do plants modify fluvial processes? Plant-hydraulic interactions under variable flow and sediment supply rates

    Science.gov (United States)

    Manners, Rebecca B.; Wilcox, Andrew C.; Kui, Li; Lightbody, Anne F.; Stella, John C.; Sklar, Leonard S.

    2015-02-01

    Flow and sediment regimes shape alluvial river channels; yet the influence of these abiotic drivers can be strongly mediated by biotic factors such as the size and density of riparian vegetation. We present results from an experiment designed to identify when plants control fluvial processes and to investigate the sensitivity of fluvial processes to changes in plant characteristics versus changes in flow rate or sediment supply. Live seedlings of two species with distinct morphologies, tamarisk (Tamarix spp.) and cottonwood (Populus fremontii), were placed in different configurations in a mobile sand-bed flume. We measured the hydraulic and sediment flux responses of the channel at different flow rates and sediment supply conditions representing equilibrium (sediment supply = transport rate) and deficit (sediment supply plant species and configuration. Species-specific traits controlled the hydraulic response: compared to cottonwood, which has a more tree-like morphology, the shrubby morphology of tamarisk resulted in less pronation and greater reductions in near-bed velocities, Reynolds stress, and sediment flux rates. Under sediment-deficit conditions, on the other hand, abiotic factors dampened the effect of variations in plant characteristics on the hydraulic response. We identified scenarios for which the highest stem-density patch, independent of abiotic factors, dominated the fluvial response. These results provide insight into how and when plants influence fluvial processes in natural systems.

  17. Are cicadas (Diceroprocta apache) both a "keystone" and a "critical-link" species in lower Colorado River riparian communities?

    Science.gov (United States)

    Andersen, Douglas C.

    1994-01-01

    Apache cicada (Homoptera: Cicadidae: Diceroprocta apache Davis) densities were estimated to be 10 individuals/m2 within a closed-canopy stand of Fremont cottonwood (Populus fremontii) and Goodding willow (Salix gooddingii) in a revegetated site adjacent to the Colorado River near Parker, Arizona. Coupled with data drawn from the literature, I estimate that up to 1.3 cm (13 1/m2) of water may be added to the upper soil layers annually through the feeding activities of cicada nymphs. This is equivalent to 12% of the annual precipitation received in the study area. Apache cicadas may have significant effects on ecosystem functioning via effects on water transport and thus act as a critical-link species in this southwest desert riverine ecosystem. Cicadas emerged later within the cottonwood-willow stand than in relatively open saltcedar-mesquite stands; this difference in temporal dynamics would affect their availability to several insectivorous bird species and may help explain the birds' recent declines. Resource managers in this region should be sensitive to the multiple and strong effects that Apache cicadas may have on ecosystem structure and functioning.

  18. Where the Rubber Meets the Road; Varied Techniques for Measuring the Land-Atmosphere Exchange of Water and Energy in a California Watershed and the Driving Influences on this Exchange

    Science.gov (United States)

    Kochendorfer, J.; Viers, J.; Niswonger, R.; Paw U, K.; Haas, E.; Reck, R. A.

    2005-12-01

    In conjunction with the Cosumnes Research Group, we performed a field study along the Cosumnes River in California's Central Valley. The study included tower-based evapotranspiration estimates, continuous hydrologic measurements, and analysis of remote sensing data. We estimated the effects of phreatophytic evapotranspiration on groundwater from scales as small as an individual stand of trees to as large as the watershed and explored the climactic and hydrologic controls over riparian evapotranspiration. Tower-based evapotranspiration measurements included one eddy covariance tower within a cottonwood forest (Populus fremontii), and one surface temperature/micrometeorological evapotranspiration tower within a willow stand (Salix lasiolepis). The technique used on the surface temperature/micrometeorological evapotranspiration tower was developed and chosen in preference to eddy covariance for a site where a considerable quantity of the riparian ecosystem to atmosphere exchange is advective. Hydrologic techniques included measurements of groundwater depth and volumetric soil moisture. We also examined multitemporal, multiresolution remotely sensed imagery to correlate evapotranspiration rates for a restored cottonwood forest with derived vegetation indices. These indices were evaluated for applicability to other restored riparian habitats within the Cosumnes River Preserve and to help guide future restoration actions as a function of hydrologic connectivity and water demand.

  19. Genome Enabled Discovery of Carbon Sequestration Genes in Poplar

    Energy Technology Data Exchange (ETDEWEB)

    Filichkin, Sergei; Etherington, Elizabeth; Ma, Caiping; Strauss, Steve

    2007-02-22

    The goals of the S.H. Strauss laboratory portion of 'Genome-enabled discovery of carbon sequestration genes in poplar' are (1) to explore the functions of candidate genes using Populus transformation by inserting genes provided by Oakridge National Laboratory (ORNL) and the University of Florida (UF) into poplar; (2) to expand the poplar transformation toolkit by developing transformation methods for important genotypes; and (3) to allow induced expression, and efficient gene suppression, in roots and other tissues. As part of the transformation improvement effort, OSU developed transformation protocols for Populus trichocarpa 'Nisqually-1' clone and an early flowering P. alba clone, 6K10. Complete descriptions of the transformation systems were published (Ma et. al. 2004, Meilan et. al 2004). Twenty-one 'Nisqually-1' and 622 6K10 transgenic plants were generated. To identify root predominant promoters, a set of three promoters were tested for their tissue-specific expression patterns in poplar and in Arabidopsis as a model system. A novel gene, ET304, was identified by analyzing a collection of poplar enhancer trap lines generated at OSU (Filichkin et. al 2006a, 2006b). Other promoters include the pGgMT1 root-predominant promoter from Casuarina glauca and the pAtPIN2 promoter from Arabidopsis root specific PIN2 gene. OSU tested two induction systems, alcohol- and estrogen-inducible, in multiple poplar transgenics. Ethanol proved to be the more efficient when tested in tissue culture and greenhouse conditions. Two estrogen-inducible systems were evaluated in transgenic Populus, neither of which functioned reliably in tissue culture conditions. GATEWAY-compatible plant binary vectors were designed to compare the silencing efficiency of homologous (direct) RNAi vs. heterologous (transitive) RNAi inverted repeats. A set of genes was targeted for post transcriptional silencing in the model Arabidopsis system; these include the floral

  20. Nesting ecology of Greater Sandhill Cranes (Grus canadensis tabida) in riparian and palustrine wetlands of eastern Idaho

    Science.gov (United States)

    McWethy, D.B.; Austin, J.E.

    2009-01-01

    Little information exists on breeding Greater Sandhill Cranes (Grus canadensis tabida) in riparian wetlands of the Intermountain West. We examined the nesting ecology of Sandhill Cranes associated with riparian and palustrine wetlands in the Henry's Fork Watershed in eastern Idaho in 2003. We located 36 active crane nests, 19 in riparian wetlands and 17 in palustrine wetlands. Nesting sites were dominated by rushes (Juncus spp.), sedges (Carex spp.), Broad-leaved Cattail (Typha latifolia) and willow (Salix spp.), and adjacent foraging areas were primarily composed of sagebrush (Artemisia spp.), cinquefoil (Potentilla spp.),Rabbitbrush (Ericameria bloomeri) bunch grasses, upland forbs, Quaking Aspen (Populus tremuloides) and cottonwood (Populus spp.). Mean water depth surrounding nests was 23 cm (SD = 22). A majority of nests (61%) were surrounded by vegetation between 3060 cm, 23% by vegetation 60 cm in height. We were able to determine the fate of 29 nests, of which 20 were successful (69%). Daily nest survival was 0.986 (95% LCI 0.963, UCI 0.995), equivalent to a Mayfield nest success of 0.654 (95% LCI 0.324, UCI 0.853). Model selection favored models with the covariates vegetation type, vegetation height, and water depth. Nest survival increased with increasing water depth surrounding nest sites. Mean water depth was higher around successful nests (30 cm, SD = 21) than unsuccessful nests (15 cm, SD 22). Further research is needed to evaluate the relative contribution of cranes nesting in palustrine and riparian wetlands distributed widely across the Intermountain West.