WorldWideScience

Sample records for cottonwood populus trichocarpa

  1. The genome of black cottonwood, Populus trichocarpa (Torr.&Gray)

    Energy Technology Data Exchange (ETDEWEB)

    Tuskan, G.A.; DiFazio, S.; Jansson, S.; Bohlmann, J.; Grigoriev,I.; Hellsten, U.; Putnam, N.; Ralph, S.; Rombauts, S.; Salamov, A.; Schein, J.; Sterck, L.; Aerts, A.; Bhalerao, R.R.; Bhalerao, R.P.; Blaudez, D.; Boerjan, W.; Brun, A.; Brunner, A.; Busov, V.; Campbell, M.; Carlson, J.; Chalot, M.; Chapman, J.; Chen, G.-L.; Cooper, D.; Coutinho,P.M.; Couturier, J.; Covert, S.; Cronk, Q.; Cunningham, R.; Davis, J.; Degroeve, S.; Dejardin, A.; dePamphillis, C.; Detter, J.; Dirks, B.; Dubchak, I.; Duplessis, S.; Ehiting, J.; Ellis, B.; Gendler, K.; Goodstein, D.; Gribskov, M.; Grimwood, J.; Groover, A.; Gunter, L.; Hamberger, B.; Heinze, B.; Helariutta, Y.; Henrissat, B.; Holligan, D.; Holt, R.; Huang, W.; Islam-Faridi, N.; Jones, S.; Jones-Rhoades, M.; Jorgensen, R.; Joshi, C.; Kangasjarvi, J.; Karlsson, J.; Kelleher, C.; Kirkpatrick, R.; Kirst, M.; Kohler, A.; Kalluri, U.; Larimer, F.; Leebens-Mack, J.; Leple, J.-C.; Locascio, P.; Lou, Y.; Lucas, S.; Martin,F.; Montanini, B.; Napoli, C.; Nelson, D.R.; Nelson, D.; Nieminen, K.; Nilsson, O.; Peter, G.; Philippe, R.; Pilate, G.; Poliakov, A.; Razumovskaya, J.; Richardson, P.; Rinaldi, C.; Ritland, K.; Rouze, P.; Ryaboy, D.; Schmutz, J.; Schrader, J.; Segerman, B.; Shin, H.; Siddiqui,A.; Sterky, F.; Terry, A.; Tsai, C.; Uberbacher, E.; Unneberg, P.; Vahala, J.; Wall, K.; Wessler, S.; Yang, G.; Yin, T.; Douglas, C.; Marra,M.; Sandberg, G.; Van der Peer, Y.; Rokhsar, D.

    2006-09-01

    We report the draft genome of the black cottonwood tree, Populus trichocarpa. Integration of shotgun sequence assembly with genetic mapping enabled chromosome-scale reconstruction of the genome. Over 45,000 putative protein-coding genes were identified. Analysis of the assembled genome revealed a whole-genome duplication event, with approximately 8,000 pairs of duplicated genes from that event surviving in the Populus genome. A second, older duplication event is indistinguishably coincident with the divergence of the Populus and Arabidopsis lineages. Nucleotide substitution, tandem gene duplication and gross chromosomal rearrangement appear to proceed substantially slower in Populus relative to Arabidopsis. Populus has more protein-coding genes than Arabidopsis, ranging on average between 1.4-1.6 putative Populus homologs for each Arabidopsis gene. However, the relative frequency of protein domains in the two genomes is similar. Overrepresented exceptions in Populus include genes associated with disease resistance, meristem development, metabolite transport and lignocellulosic wall biosynthesis.

  2. The Genome of Black Cottonwood, Populus trichocarpa (Torr. & Gray)

    Energy Technology Data Exchange (ETDEWEB)

    Tuskan, Gerald A [ORNL; DiFazio, Stephen P [ORNL; Jansson, Bo S [ORNL; Bohlmann, J. [University of British Columbia, Vancouver; Grigoriev, I. [U.S. Department of Energy, Joint Genome Institute; Hellsten, U. [U.S. Department of Energy, Joint Genome Institute; Putman, N. [U.S. Department of Energy, Joint Genome Institute; Ralph, S. [University of British Columbia, Vancouver; Rombauts, S. [Ghent University, Belgium; Salamov, A. [U.S. Department of Energy, Joint Genome Institute; Schein, J. [Genome Sciences Centre, Vancouver, BC, Canada; Sterck, L. [Ghent University, Belgium; Aerts, A. [U.S. Department of Energy, Joint Genome Institute; Bhalerao, R. R. [Umea Plant Science Centre, Dept. of Plant Physiology, Sweden; Bhalerao, Rishikesh P [ORNL; Blaudez, D. [Institut National de la Recherche Agronomique, France; Boerjan, W. [Ghent University, Belgium; Brun, A. [Institut National de la Recherche Agronomique, France; Brunner, A. [Virginia Polytechnic Institute and State University (Virginia Tech); Busov, V. [Michigan Technological University; Campbell, M. [University of Toronto; Larimer, Frank W [ORNL; Detter, J C [U.S. Department of Energy, Joint Genome Institute; Richardson, P M [U.S. Department of Energy, Joint Genome Institute; Chen, Gwo-Liang [ORNL; Gunter, Lee E [ORNL; Kalluri, Udaya C [ORNL; LoCascio, Philip F [ORNL; Uberbacher, Edward C [ORNL; Yin, Tongming [ORNL

    2006-01-01

    We report the draft genome of the black cottonwood tree, Populus trichocarpa. Integration of shotgun sequence assembly with genetic mapping enabled chromosome-scale reconstruction of the genome. More than 45,000 putative protein-coding genes were identified. Analysis of the assembled genome revealed a whole-genome duplication event; about 8000 pairs of duplicated genes from that event survived in the Populus genome. A second, older duplication event is indistinguishably coincident with the divergence of the Populus and Arabidopsis lineages. Nucleotide substitution, tandem gene duplication, and gross chromosomal rearrangement appear to proceed substantially more slowly in Populus than in Arabidopsis. Populus has more protein-coding genes than Arabidopsis, ranging on average from 1.4 to 1.6 putative Populus homologs for each Arabidopsis gene. However, the relative frequency of protein domains in the two genomes is similar. Overrepresented exceptions in Populus include genes associated with lignocellulosic wall biosynthesis, meristem development, disease resistance, and metabolite transport.

  3. Molecular and biochemical characterization of the jasmonic acid methyltransferase gene from black cottonwood (Populus trichocarpa)

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Nan [ORNL; Yao, Jianzhuang [University of Tennessee, Knoxville (UTK); Chaiprasongsuk, Minta [University of Tennessee, Knoxville (UTK); Li, Guanglin [University of Tennessee, Knoxville (UTK); Guan, Ju [University of Tennessee, Knoxville (UTK); Tschaplinski, Timothy J [ORNL; Guo, Hong [University of Tennessee, Knoxville (UTK); Chen, Feng [University of Tennessee, Knoxville (UTK)

    2013-01-01

    Methyl jasmonate is a metabolite known to be produced by many plants and has roles in diverse biological processes. It is biosynthesized by the action of S-adenosyl-L-methionine:jasmonic acid carboxyl methyltransferase (JMT), which belongs to the SABATH family of methyltransferases. Herein is reported the isolation and biochemical characterization of a JMT gene from black cottonwood (Populus trichocarpa). The genome of P. trichocarpa contains 28 SABATH genes (PtSABATH1 to PtSABATH28). Recombinant PtSABATH3 expressed in Escherichia coli showed the highest level of activity with jasmonic acid (JA) among carboxylic acids tested. It was therefore renamed PtJMT1. PtJMT1 also displayed activity with benzoic acid (BA), with which the activity was about 22% of that with JA. PtSABATH2 and PtSABATH4 were most similar to PtJMT1 among all PtSABATHs. However, neither of them had activity with JA. The apparent Km values of PtJMT1 using JA and BA as substrate were 175 lM and 341 lM, respectively. Mutation of Ser-153 and Asn-361, two residues in the active site of PtJMT1, to Tyr and Ser respectively, led to higher specific activity with BA than with JA. Homology-based structural modeling indicated that substrate alignment, in which Asn-361 is involved, plays a role in determining the substrate specificity of PtJMT1. In the leaves of young seedlings of black cottonwood, the expression of PtJMT1 was induced by plant defense signal molecules methyl jasmonate and salicylic acid and a fungal elicitor alamethicin, suggesting that PtJMT1 may have a role in plant defense against biotic stresses. Phylogenetic analysis suggests that PtJMT1 shares a common ancestor with the Arabidopsis JMT, and functional divergence of these two apparent JMT orthologs has occurred since the split of poplar and Arabidopsis lineages.

  4. Targeted enrichment of the black cottonwood (Populus trichocarpa gene space using sequence capture

    Directory of Open Access Journals (Sweden)

    Zhou Lecong

    2012-12-01

    Full Text Available Abstract Background High-throughput re-sequencing is rapidly becoming the method of choice for studies of neutral and adaptive processes in natural populations across taxa. As re-sequencing the genome of large numbers of samples is still cost-prohibitive in many cases, methods for genome complexity reduction have been developed in attempts to capture most ecologically-relevant genetic variation. One of these approaches is sequence capture, in which oligonucleotide baits specific to genomic regions of interest are synthesized and used to retrieve and sequence those regions. Results We used sequence capture to re-sequence most predicted exons, their upstream regulatory regions, as well as numerous random genomic intervals in a panel of 48 genotypes of the angiosperm tree Populus trichocarpa (black cottonwood, or ‘poplar’. A total of 20.76Mb (5% of the poplar genome was targeted, corresponding to 173,040 baits. With 12 indexed samples run in each of four lanes on an Illumina HiSeq instrument (2x100 paired-end, 86.8% of the bait regions were on average sequenced at a depth ≥10X. Few off-target regions (>250bp away from any bait were present in the data, but on average ~80bp on either side of the baits were captured and sequenced to an acceptable depth (≥10X to call heterozygous SNPs. Nucleotide diversity estimates within and adjacent to protein-coding genes were similar to those previously reported in Populus spp., while intergenic regions had higher values consistent with a relaxation of selection. Conclusions Our results illustrate the efficiency and utility of sequence capture for re-sequencing highly heterozygous tree genomes, and suggest design considerations to optimize the use of baits in future studies.

  5. The genome sequence of black cottonwood (Populus trichocarpa) reveals 18 conserved cellulose synthase (CesA) genes.

    Science.gov (United States)

    Djerbi, Soraya; Lindskog, Mats; Arvestad, Lars; Sterky, Fredrik; Teeri, Tuula T

    2005-07-01

    The genome sequence of Populus trichocarpa was screened for genes encoding cellulose synthases by using full-length cDNA sequences and ESTs previously identified in the tissue specific cDNA libraries of other poplars. The data obtained revealed 18 distinct CesA gene sequences in P. trichocarpa. The identified genes were grouped in seven gene pairs, one group of three sequences and one single gene. Evidence from gene expression studies of hybrid aspen suggests that both copies of at least one pair, CesA3-1 and CesA3-2, are actively transcribed. No sequences corresponding to the gene pair, CesA6-1 and CesA6-2, were found in Arabidopsis or hybrid aspen, while one homologous gene has been identified in the rice genome and an active transcript in Populus tremuloides. A phylogenetic analysis suggests that the CesA genes previously associated with secondary cell wall synthesis originate from a single ancestor gene and group in three distinct subgroups. The newly identified copies of CesA genes in P. trichocarpa give rise to a number of new questions concerning the mechanism of cellulose synthesis in trees.

  6. Taxonomy Icon Data: black cottonwood [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available black cottonwood Populus trichocarpa Populus_trichocarpa_L.png Populus_trichocarpa_...NL.png Populus_trichocarpa_S.png Populus_trichocarpa_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i...=Populus+trichocarpa&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Populus+trichocarpa&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Populus+trichocarpa&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Populus+trichocarpa&t=NS ...

  7. Genomic and functional approaches reveal a case of adaptive introgression from Populus balsamifera (balsam poplar) in P. trichocarpa (black cottonwood).

    Science.gov (United States)

    Suarez-Gonzalez, Adriana; Hefer, Charles A; Christe, Camille; Corea, Oliver; Lexer, Christian; Cronk, Quentin C B; Douglas, Carl J

    2016-06-01

    Natural hybrid zones in forest trees provide systems to study the transfer of adaptive genetic variation by introgression. Previous landscape genomic studies in Populus trichocarpa, a keystone tree species, indicated genomic footprints of admixture with its sister species Populus balsamifera and identified candidate genes for local adaptation. Here, we explored the patterns of introgression and signals of local adaptation in P. trichocarpa and P. balsamifera, employing genome resequencing data from three chromosomes in pure species and admixed individuals from wild populations. Local ancestry analysis in admixed P. trichocarpa revealed a telomeric region in chromosome 15 with P. balsamifera ancestry, containing several candidate genes for local adaptation. Genomic analyses revealed signals of selection in certain genes in this region (e.g. PRR5, COMT1), and functional analyses based on gene expression variation and correlations with adaptive phenotypes suggest distinct functions of the introgressed alleles. In contrast, a block of genes in chromosome 12 paralogous to the introgressed region showed no signs of introgression or signatures of selection. We hypothesize that the introgressed region in chromosome 15 has introduced modular or cassette-like variation into P. trichocarpa. These linked adaptive mutations are associated with a block of genes in chromosome 15 that appear to have undergone neo- or subfunctionalization relative to paralogs in a duplicated region on chromosome 12 that show no signatures of adaptive variation. The association between P. balsamifera introgressed alleles with the expression of adaptive traits in P. trichocarpa supports the hypothesis that this is a case of adaptive introgression in an ecologically important foundation species.

  8. Evolutionary Quantitative Genomics of Populus trichocarpa.

    Science.gov (United States)

    Porth, Ilga; Klápště, Jaroslav; McKown, Athena D; La Mantia, Jonathan; Guy, Robert D; Ingvarsson, Pär K; Hamelin, Richard; Mansfield, Shawn D; Ehlting, Jürgen; Douglas, Carl J; El-Kassaby, Yousry A

    2015-01-01

    Forest trees generally show high levels of local adaptation and efforts focusing on understanding adaptation to climate will be crucial for species survival and management. Here, we address fundamental questions regarding the molecular basis of adaptation in undomesticated forest tree populations to past climatic environments by employing an integrative quantitative genetics and landscape genomics approach. Using this comprehensive approach, we studied the molecular basis of climate adaptation in 433 Populus trichocarpa (black cottonwood) genotypes originating across western North America. Variation in 74 field-assessed traits (growth, ecophysiology, phenology, leaf stomata, wood, and disease resistance) was investigated for signatures of selection (comparing QST-FST) using clustering of individuals by climate of origin (temperature and precipitation). 29,354 SNPs were investigated employing three different outlier detection methods and marker-inferred relatedness was estimated to obtain the narrow-sense estimate of population differentiation in wild populations. In addition, we compared our results with previously assessed selection of candidate SNPs using the 25 topographical units (drainages) across the P. trichocarpa sampling range as population groupings. Narrow-sense QST for 53% of distinct field traits was significantly divergent from expectations of neutrality (indicating adaptive trait variation); 2,855 SNPs showed signals of diversifying selection and of these, 118 SNPs (within 81 genes) were associated with adaptive traits (based on significant QST). Many SNPs were putatively pleiotropic for functionally uncorrelated adaptive traits, such as autumn phenology, height, and disease resistance. Evolutionary quantitative genomics in P. trichocarpa provides an enhanced understanding regarding the molecular basis of climate-driven selection in forest trees and we highlight that important loci underlying adaptive trait variation also show relationship to climate

  9. Evolutionary Quantitative Genomics of Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Ilga Porth

    Full Text Available Forest trees generally show high levels of local adaptation and efforts focusing on understanding adaptation to climate will be crucial for species survival and management. Here, we address fundamental questions regarding the molecular basis of adaptation in undomesticated forest tree populations to past climatic environments by employing an integrative quantitative genetics and landscape genomics approach. Using this comprehensive approach, we studied the molecular basis of climate adaptation in 433 Populus trichocarpa (black cottonwood genotypes originating across western North America. Variation in 74 field-assessed traits (growth, ecophysiology, phenology, leaf stomata, wood, and disease resistance was investigated for signatures of selection (comparing QST-FST using clustering of individuals by climate of origin (temperature and precipitation. 29,354 SNPs were investigated employing three different outlier detection methods and marker-inferred relatedness was estimated to obtain the narrow-sense estimate of population differentiation in wild populations. In addition, we compared our results with previously assessed selection of candidate SNPs using the 25 topographical units (drainages across the P. trichocarpa sampling range as population groupings. Narrow-sense QST for 53% of distinct field traits was significantly divergent from expectations of neutrality (indicating adaptive trait variation; 2,855 SNPs showed signals of diversifying selection and of these, 118 SNPs (within 81 genes were associated with adaptive traits (based on significant QST. Many SNPs were putatively pleiotropic for functionally uncorrelated adaptive traits, such as autumn phenology, height, and disease resistance. Evolutionary quantitative genomics in P. trichocarpa provides an enhanced understanding regarding the molecular basis of climate-driven selection in forest trees and we highlight that important loci underlying adaptive trait variation also show

  10. Partitioning of Multivariate Phenotypes using Regression Trees Reveals Complex Patterns of Adaptation to Climate across the Range of Black Cottonwood (Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Regis Wendpouire Oubida

    2015-03-01

    Full Text Available Local adaptation to climate in temperate forest trees involves the integration of multiple physiological, morphological, and phenological traits. Latitudinal clines are frequently observed for these traits, but environmental constraints also track longitude and altitude. We combined extensive phenotyping of 12 candidate adaptive traits, multivariate regression trees, quantitative genetics, and a genome-wide panel of SNP markers to better understand the interplay among geography, climate, and adaptation to abiotic factors in Populus trichocarpa. Heritabilities were low to moderate (0.13 to 0.32 and population differentiation for many traits exceeded the 99th percentile of the genome-wide distribution of FST, suggesting local adaptation. When climate variables were taken as predictors and the 12 traits as response variables in a multivariate regression tree analysis, evapotranspiration (Eref explained the most variation, with subsequent splits related to mean temperature of the warmest month, frost-free period (FFP, and mean annual precipitation (MAP. These grouping matched relatively well the splits using geographic variables as predictors: the northernmost groups (short FFP and low Eref had the lowest growth, and lowest cold injury index; the southern British Columbia group (low Eref and intermediate temperatures had average growth and cold injury index; the group from the coast of California and Oregon (high Eref and FFP had the highest growth performance and the highest cold injury index; and the southernmost, high-altitude group (with high Eref and low FFP performed poorly, had high cold injury index, and lower water use efficiency. Taken together, these results suggest variation in both temperature and water availability across the range shape multivariate adaptive traits in poplar.

  11. Genome-wide association implicates numerous genes and pleiotropy underlying ecological trait variation in natural populations of Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    McKown, Athena [University of British Columbia, Vancouver; Klapste, Jaroslav [University of British Columbia, Vancouver; Guy, Robert [University of British Columbia, Vancouver; Geraldes, Armando [University of British Columbia, Vancouver; Porth, Ilga [University of British Columbia, Vancouver; Hannemann, Jan [University of Victoria, Canada; Friedmann, Michael [University of British Columbia, Vancouver; Muchero, Wellington [ORNL; Tuskan, Gerald A [ORNL; Ehlting, Juergen [University of Victoria, Canada; Cronk, Quentin [University of British Columbia, Vancouver; El-Kassaby, Yousry [University of British Columbia, Vancouver; Mansfield, Shawn [University of British Columbia, Vancouver; Douglas, Carl [University of British Columbia, Vancouver

    2014-01-01

    To uncover the genetic basis of phenotypic trait variation, we used 448 unrelated wild accessions of black cottonwood (Populus trichocarpa Torr. & Gray) from natural populations throughout western North America. Extensive information from large-scale trait phenotyping (with spatial and temporal replications within a common garden) and genotyping (with a 34K Populus SNP array) of all accessions were used for gene discovery in a genome-wide association study (GWAS).

  12. RepPop: a database for repetitive elements in Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Xu Ying

    2009-01-01

    Full Text Available Abstract Background Populus trichocarpa is the first tree genome to be completed, and its whole genome is currently being assembled. No functional annotation about the repetitive elements in the Populus trichocarpa genome is currently available. Results We predicted 9,623 repetitive elements in the Populus trichocarpa genome, and assigned functions to 3,075 of them (31.95%. The 9,623 repetitive elements cover ~40% of the current (partially assembled genome. Among the 9,623 repetitive elements, 668 have copies only in the contigs that have not been assigned to one of the 19 chromosome while the rest all have copies in the partially assembled chromosomes. Conclusion All the predicted data are organized into an easy-to-use web-browsable database, RepPop. Various search capabilities are provided against the RepPop database. A Wiki system has been set up to facilitate functional annotation and curation of the repetitive elements by a community rather than just the database developer. The database RepPop will facilitate the assembling and functional characterization of the Populus trichocarpa genome.

  13. Genome-wide association implicates numerous genes underlying ecological trait variation in natural populations of Populus trichocarpa.

    Science.gov (United States)

    McKown, Athena D; Klápště, Jaroslav; Guy, Robert D; Geraldes, Armando; Porth, Ilga; Hannemann, Jan; Friedmann, Michael; Muchero, Wellington; Tuskan, Gerald A; Ehlting, Jürgen; Cronk, Quentin C B; El-Kassaby, Yousry A; Mansfield, Shawn D; Douglas, Carl J

    2014-07-01

    In order to uncover the genetic basis of phenotypic trait variation, we used 448 unrelated wild accessions of black cottonwood (Populus trichocarpa) from much of its range in western North America. Extensive data from large-scale trait phenotyping (with spatial and temporal replications within a common garden) and genotyping (with a 34 K Populus single nucleotide polymorphism (SNP) array) of all accessions were used for gene discovery in a genome-wide association study (GWAS). We performed GWAS with 40 biomass, ecophysiology and phenology traits and 29,355 filtered SNPs representing 3518 genes. The association analyses were carried out using a Unified Mixed Model accounting for population structure effects among accessions. We uncovered 410 significant SNPs using a Bonferroni-corrected threshold (P<1.7×10(-6)). Markers were found across 19 chromosomes, explained 1-13% of trait variation, and implicated 275 unique genes in trait associations. Phenology had the largest number of associated genes (240 genes), followed by biomass (53 genes) and ecophysiology traits (25 genes). The GWAS results propose numerous loci for further investigation. Many traits had significant associations with multiple genes, underscoring their genetic complexity. Genes were also identified with multiple trait associations within and/or across trait categories. In some cases, traits were genetically correlated while in others they were not.

  14. Cottonwood Leaf Beetle (Coleoptera: Chrysomelidae) Larval Performance on Eight Populus Clones

    Science.gov (United States)

    David R. Coyle; Joel D. McMillin; Richard B. Hall; Elwood R. Hart

    2001-01-01

    Abstract: The cottonwood leaf beetle, Chrysomela scripta F., is the most serious defoliator of young plantation-grown Populus in the eastern United States, yet there is a paucity of data on larval feeding performance across Populus clones used in tree breeding. Field experiments were conducted in 1998 and 1999...

  15. Cytogenetic analysis of Populus trichocarpa--ribosomal DNA, telomere repeat sequence, and marker-selected BACs.

    Science.gov (United States)

    Islam-Faridi, M N; Nelson, C D; DiFazio, S P; Gunter, L E; Tuskan, G A

    2009-01-01

    The 18S-28S rDNA and 5S rDNA loci in Populus trichocarpa were localized using fluorescent in situ hybridization (FISH). Two 18S-28S rDNA sites and one 5S rDNA site were identified and located at the ends of 3 different chromosomes. FISH signals from the Arabidopsis-type telomere repeat sequence were observed at the distal ends of each chromosome. Six BAC clones selected from 2 linkage groups based on genome sequence assembly (LG-I and LG-VI) were localized on 2 chromosomes, as expected. BACs from LG-I hybridized to the longest chromosome in the complement. All BAC positions were found to be concordant with sequence assembly positions. BAC-FISH will be useful for delineating each of the Populus trichocarpa chromosomes and improving the sequence assembly of this model angiosperm tree species.

  16. Cytogenetic Analysis of Populus trichocarpa - Ribosomal DNA, Telomere Repeat Sequence, and Marker-selected BACs

    Energy Technology Data Exchange (ETDEWEB)

    Tuskan, Gerald A [ORNL; Gunter, Lee E [ORNL; DiFazio, Stephen P [West Virginia University

    2009-01-01

    The 18S-28S rDNA and 5S rDNA loci in Populus trichocarpa were localized using fluorescent in situ hybridization (FISH). Two 18S-28S rDNA sites and one 5S rDNA site were identified and located at the ends of 3 different chromosomes. FISH signals from the Arabidopsis -type telomere repeat sequence were observed at the distal ends of each chromosome. Six BAC clones selected from 2 linkage groups based on genome sequence assembly (LG-I and LG-VI) were localized on 2 chromosomes, as expected. BACs from LG-I hybridized to the longest chromosome in the complement. All BAC positions were found to be concordant with sequence assembly positions. BAC-FISH will be useful for delineating each of the Populus trichocarpa chromosomes and improving the sequence assembly of this model angiosperm tree species.

  17. Dynamic DNA cytosine methylation in the Populus trichocarpa genome: tissue-level variation and relationship to gene expression

    Directory of Open Access Journals (Sweden)

    Vining Kelly J

    2012-01-01

    Full Text Available Abstract Background DNA cytosine methylation is an epigenetic modification that has been implicated in many biological processes. However, large-scale epigenomic studies have been applied to very few plant species, and variability in methylation among specialized tissues and its relationship to gene expression is poorly understood. Results We surveyed DNA methylation from seven distinct tissue types (vegetative bud, male inflorescence [catkin], female catkin, leaf, root, xylem, phloem in the reference tree species black cottonwood (Populus trichocarpa. Using 5-methyl-cytosine DNA immunoprecipitation followed by Illumina sequencing (MeDIP-seq, we mapped a total of 129,360,151 36- or 32-mer reads to the P. trichocarpa reference genome. We validated MeDIP-seq results by bisulfite sequencing, and compared methylation and gene expression using published microarray data. Qualitative DNA methylation differences among tissues were obvious on a chromosome scale. Methylated genes had lower expression than unmethylated genes, but genes with methylation in transcribed regions ("gene body methylation" had even lower expression than genes with promoter methylation. Promoter methylation was more frequent than gene body methylation in all tissues except male catkins. Male catkins differed in demethylation of particular transposable element categories, in level of gene body methylation, and in expression range of genes with methylated transcribed regions. Tissue-specific gene expression patterns were correlated with both gene body and promoter methylation. Conclusions We found striking differences among tissues in methylation, which were apparent at the chromosomal scale and when genes and transposable elements were examined. In contrast to other studies in plants, gene body methylation had a more repressive effect on transcription than promoter methylation.

  18. A 34K SNP genotyping array for Populus trichocarpa: design, application to the study of natural populations and transferability to other Populus species

    Energy Technology Data Exchange (ETDEWEB)

    Geraldes, Armando [University of British Columbia, Vancouver; Hannemann, Jan [University of Victoria, Canada; Grassa, Chris [University of British Columbia, Vancouver; Farzaneh, Nima [University of British Columbia, Vancouver; Porth, Ilga [University of British Columbia, Vancouver; McKown, Athena [University of British Columbia, Vancouver; Skyba, Oleksandr [University of British Columbia, Vancouver; Li, Eryang [University of British Columbia, Vancouver; Mike, Fujita [University of British Columbia, Vancouver; Friedmann, Michael [University of British Columbia, Vancouver; Wasteneys, Geoffrey [University of British Columbia, Vancouver; Guy, Robert [University of British Columbia, Vancouver; El-Kassaby, Yousry [University of British Columbia, Vancouver; Mansfield, Shawn [University of British Columbia, Vancouver; Cronk, Quentin [University of British Columbia, Vancouver; Ehlting, Juergen [University of Victoria, Canada; Douglas, Carl [University of British Columbia, Vancouver; DiFazio, Stephen P [West Virginia University, Morgantown; Slavov, Gancho [West Virginia University, Morgantown; Ranjan, Priya [ORNL; Muchero, Wellington [ORNL; Gunter, Lee E [ORNL; Wymore, Ann [ORNL; Tuskan, Gerald A [ORNL; Martin, Joel [U.S. Department of Energy, Joint Genome Institute; Schackwitz, Wendy [U.S. Department of Energy, Joint Genome Institute; Pennacchio, Christa [U.S. Department of Energy, Joint Genome Institute; Rokhsar, Daniel [U.S. Department of Energy, Joint Genome Institute

    2013-01-01

    Genetic mapping of quantitative traits requires genotypic data for large numbers of markers in many individuals. Despite the declining costs of genotyping by sequencing, for most studies, the use of large SNP genotyping arrays still offers the most cost-effective solution for large-scale targeted genotyping. Here we report on the design and performance of a SNP genotyping array for Populus trichocarpa (black cottonwood). This genotyping array was designed with SNPs pre-ascertained in 34 wild accessions covering most of the species range. Due to the rapid decay of linkage disequilibrium in P. trichocarpa we adopted a candidate gene approach to the array design that resulted in the selection of 34,131 SNPs, the majority of which are located in, or within 2 kb, of 3,543 candidate genes. A subset of the SNPs (539) was selected based on patterns of variation among the SNP discovery accessions. We show that more than 95% of the loci produce high quality genotypes and that the genotyping error rate for these is likely below 2%, indicating that high-quality data are generated with this array. We demonstrate that even among small numbers of samples (n=10) from local populations over 84% of loci are polymorphic. We also tested the applicability of the array to other species in the genus and found that due to ascertainment bias the number of polymorphic loci decreases rapidly with genetic distance, with the largest numbers detected in other species in section Tacamahaca (P. balsamifera and P. angustifolia). Finally, we provide evidence for the utility of the array for intraspecific studies of genetic differentiation and for species assignment and the detection of natural hybrids.

  19. A 34K SNP genotyping array for Populus trichocarpa: design, application to the study of natural populations and transferability to other Populus species.

    Science.gov (United States)

    Geraldes, A; Difazio, S P; Slavov, G T; Ranjan, P; Muchero, W; Hannemann, J; Gunter, L E; Wymore, A M; Grassa, C J; Farzaneh, N; Porth, I; McKown, A D; Skyba, O; Li, E; Fujita, M; Klápště, J; Martin, J; Schackwitz, W; Pennacchio, C; Rokhsar, D; Friedmann, M C; Wasteneys, G O; Guy, R D; El-Kassaby, Y A; Mansfield, S D; Cronk, Q C B; Ehlting, J; Douglas, C J; Tuskan, G A

    2013-03-01

    Genetic mapping of quantitative traits requires genotypic data for large numbers of markers in many individuals. For such studies, the use of large single nucleotide polymorphism (SNP) genotyping arrays still offers the most cost-effective solution. Herein we report on the design and performance of a SNP genotyping array for Populus trichocarpa (black cottonwood). This genotyping array was designed with SNPs pre-ascertained in 34 wild accessions covering most of the species latitudinal range. We adopted a candidate gene approach to the array design that resulted in the selection of 34 131 SNPs, the majority of which are located in, or within 2 kb of, 3543 candidate genes. A subset of the SNPs on the array (539) was selected based on patterns of variation among the SNP discovery accessions. We show that more than 95% of the loci produce high quality genotypes and that the genotyping error rate for these is likely below 2%. We demonstrate that even among small numbers of samples (n = 10) from local populations over 84% of loci are polymorphic. We also tested the applicability of the array to other species in the genus and found that the number of polymorphic loci decreases rapidly with genetic distance, with the largest numbers detected in other species in section Tacamahaca. Finally, we provide evidence for the utility of the array to address evolutionary questions such as intraspecific studies of genetic differentiation, species assignment and the detection of natural hybrids.

  20. Association genetics, geography and ecophysiology link stomatal patterning in Populus trichocarpa with carbon gain and disease resistance trade-offs.

    Science.gov (United States)

    McKown, Athena D; Guy, Robert D; Quamme, Linda; Klápště, Jaroslav; La Mantia, Jonathan; Constabel, C P; El-Kassaby, Yousry A; Hamelin, Richard C; Zifkin, Michael; Azam, M S

    2014-12-01

    Stomata are essential for diffusive entry of gases to support photosynthesis, but may also expose internal leaf tissues to pathogens. To uncover trade-offs in range-wide adaptation relating to stomata, we investigated the underlying genetics of stomatal traits and linked variability in these traits with geoclimate, ecophysiology, condensed foliar tannins and pathogen susceptibility in black cottonwood (Populus trichocarpa). Upper (adaxial) and lower (abaxial) leaf stomatal traits were measured from 454 accessions collected throughout much of the species range. We calculated broad-sense heritability (H(2) ) of stomatal traits and, using SNP data from a 34K Populus SNP array, performed a genome-wide association studies (GWAS) to uncover genes underlying stomatal trait variation. H(2) values for stomatal traits were moderate (average H(2) = 0.33). GWAS identified genes associated primarily with adaxial stomata, including polarity genes (PHABULOSA), stomatal development genes (BRASSINOSTEROID-INSENSITIVE 2) and disease/wound-response genes (GLUTAMATE-CYSTEINE LIGASE). Stomatal traits correlated with latitude, gas exchange, condensed tannins and leaf rust (Melampsora) infection. Latitudinal trends of greater adaxial stomata numbers and guard cell pore size corresponded with higher stomatal conductance (gs ) and photosynthesis (Amax ), faster shoot elongation, lower foliar tannins and greater Melampsora susceptibility. This suggests an evolutionary trade-off related to differing selection pressures across the species range. In northern environments, more adaxial stomata and larger pore sizes reflect selection for rapid carbon gain and growth. By contrast, southern genotypes have fewer adaxial stomata, smaller pore sizes and higher levels of condensed tannins, possibly linked to greater pressure from natural leaf pathogens, which are less significant in northern ecosystems.

  1. Genome-Wide Analysis of BURP Domain-Containing Genes in Populus trichocarpa

    Institute of Scientific and Technical Information of China (English)

    Yuanhua Shao; Guo Wei; Ling Wang; Qing Dong; Yang Zhao; Beijiu Chen; Yan Xiang

    2011-01-01

    BURP domain-containing proteins have a conserved structure and are found extensively in plants.The functions of the proteins in this family are diverse,but remain unknown in Populus trichocarpa.In the present study,a complete genome of P.trichocarpa was analyzed bioinformatically.A total of 18 BURP family genes,named PtBURPs,were identified and characterized according to their physical positions on the P.trichocarpa chromosomes.A phylogenetic tree was generated from alignments of PtBURP protein sequences,while phylogenetic relationships were also examined between PtBURPs and BURP family genes in other plants,including rice,soybean,maize and sorghum.BURP genes in P.trichocarpa were classified into five classes,namely PG1β-Iike,BNM2-like,USP-like,RD22-like and BURP V.The multiple expectation maximization for motif elicitation (MEME) and multiple protein sequence alignments of PtBURPs were also performed.Results from the transcript level analyses of 10 PtBURP genes under different stress conditions revealed the expression patterns in poplar and led to a discussion on genome duplication and evolution,expression profiles and function of PtBURP genes.

  2. Isolation and characterization of cDNAs encoding leucoanthocyanidin reductase and anthocyanidin reductase from Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Lijun Wang

    Full Text Available Proanthocyanidins (PAs contribute to poplar defense mechanisms against biotic and abiotic stresses. Transcripts of PA biosynthetic genes accumulated rapidly in response to infection by the fungus Marssonina brunnea f.sp. multigermtubi, treatments of salicylic acid (SA and wounding, resulting in PA accumulation in poplar leaves. Anthocyanidin reductase (ANR and leucoanthocyanidin reductase (LAR are two key enzymes of the PA biosynthesis that produce the main subunits: (+-catechin and (--epicatechin required for formation of PA polymers. In Populus, ANR and LAR are encoded by at least two and three highly related genes, respectively. In this study, we isolated and functionally characterized genes PtrANR1 and PtrLAR1 from P. trichocarpa. Phylogenetic analysis shows that Populus ANR1 and LAR1 occurr in two distinct phylogenetic lineages, but both genes have little difference in their tissue distribution, preferentially expressed in roots. Overexpression of PtrANR1 in poplar resulted in a significant increase in PA levels but no impact on catechin levels. Antisense down-regulation of PtrANR1 showed reduced PA accumulation in transgenic lines, but increased levels of anthocyanin content. Ectopic expression of PtrLAR1 in poplar positively regulated the biosynthesis of PAs, whereas the accumulation of anthocyanin and flavonol was significantly reduced (P<0.05 in all transgenic plants compared to the control plants. These results suggest that both PtrANR1 and PtrLAR1 contribute to PA biosynthesis in Populus.

  3. Population genomics of Populus trichocarpa identifies signatures of selection and adaptive trait associations

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Luke M [West Virginia University, Morgantown; Slavov, Gancho [West Virginia University, Morgantown; Rodgers-Melnick, Eli [West Virginia University, Morgantown; Martin, Joel [U.S. Department of Energy, Joint Genome Institute; Ranjan, Priya [ORNL; Muchero, Wellington [ORNL; Brunner, Amy M. [Virginia Polytechnic Institute and State University; Schackwitz, Wendy [U.S. Department of Energy, Joint Genome Institute; Gunter, Lee E [ORNL; Chen, Jay [ORNL; Tuskan, Gerald A [ORNL; Difazio, Stephen P. [West Virginia University, Morgantown

    2014-01-01

    Forest trees are dominant components of terrestrial ecosystems that have global ecological and economic importance. Despite distributions that span wide environmental gradients, many tree populations are locally adapted, and mechanisms underlying this adaptation are poorly understood. Here we use a combination of whole-genome selection scans and association analyses of 544 Populus trichocarpa trees to reveal genomic bases of adaptive variation across a wide latitudinal range. Three hundred ninety-seven genomic regions showed evidence of recent positive and/or divergent selection and enrichment for associations with adaptive traits that also displayed patterns consistent with natural selection. These regions also provide unexpected insights into the evolutionary dynamics of duplicated genes and their roles in adaptive trait variation.

  4. Comprehensive analysis of trihelix genes and their expression under biotic and abiotic stresses in Populus trichocarpa

    Science.gov (United States)

    Wang, Zhanchao; Liu, Quangang; Wang, Hanzeng; Zhang, Haizhen; Xu, Xuemei; Li, Chenghao; Yang, Chuanping

    2016-01-01

    Trihelix genes play important roles in plant growth and development and responses to biotic and abiotic stresses. Here, we identified 56 full-length trihelix genes in Populus trichocarpa and classified them into five groups. Most genes within a given group had similar gene structures and conserved motifs. The trihelix genes were unequally distributed across 19 different linkage groups. Fifteen paralogous pairs were identified, 14 of which have undergone segmental duplication events. Promoter cis-element analysis indicated that most trihelix genes contain stress- or phytohormone-related cis-elements. The expression profiles of the trihelix genes suggest that they are primarily expressed in leaves and roots. Quantitative real-time reverse transcription polymerase chain reaction analysis indicated that members of the trihelix gene family are significantly induced in response to osmotic, abscisic acid, salicylic acid, methyl jasmonate and pathogen infection. PtrGT10 was identified as a target gene of miR172d, which is involved in the osmotic response. Repression of PtrGT10 could increase reactive oxygen species scavenging ability and decrease cell death. This study provides novel insights into the phylogenetic relationships and functions of the P. trichocarpa trihelix genes, which will aid future functional studies investigating the divergent roles of trihelix genes belonging to other species. PMID:27782188

  5. Gene Structures, Classification, and Expression Models of the DREB Transcription Factor Subfamily in Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Yunlin Chen

    2013-01-01

    Full Text Available We identified 75 dehydration-responsive element-binding (DREB protein genes in Populus trichocarpa. We analyzed gene structures, phylogenies, domain duplications, genome localizations, and expression profiles. The phylogenic construction suggests that the PtrDREB gene subfamily can be classified broadly into six subtypes (DREB A-1 to A-6 in Populus. The chromosomal localizations of the PtrDREB genes indicated 18 segmental duplication events involving 36 genes and six redundant PtrDREB genes were involved in tandem duplication events. There were fewer introns in the PtrDREB subfamily. The motif composition of PtrDREB was highly conserved in the same subtype. We investigated expression profiles of this gene subfamily from different tissues and/or developmental stages. Sixteen genes present in the digital expression analysis had high levels of transcript accumulation. The microarray results suggest that 18 genes were upregulated. We further examined the stress responsiveness of 15 genes by qRT-PCR. A digital northern analysis showed that the PtrDREB17, 18, and 32 genes were highly induced in leaves under cold stress, and the same expression trends were shown by qRT-PCR. Taken together, these observations may lay the foundation for future functional analyses to unravel the biological roles of Populus’ DREB genes.

  6. Populus trichocarpa cell wall chemistry and ultrastructure trait variation, genetic control and genetic correlations.

    Science.gov (United States)

    Porth, Ilga; Klápště, Jaroslav; Skyba, Oleksandr; Lai, Ben S K; Geraldes, Armando; Muchero, Wellington; Tuskan, Gerald A; Douglas, Carl J; El-Kassaby, Yousry A; Mansfield, Shawn D

    2013-02-01

    The increasing ecological and economical importance of Populus species and hybrids has stimulated research into the investigation of the natural variation of the species and the estimation of the extent of genetic control over its wood quality traits for traditional forestry activities as well as the emerging bioenergy sector. A realized kinship matrix based on informative, high-density, biallelic single nucleotide polymorphism (SNP) genetic markers was constructed to estimate trait variance components, heritabilities, and genetic and phenotypic correlations. Seventeen traits related to wood chemistry and ultrastructure were examined in 334 9-yr-old Populus trichocarpa grown in a common-garden plot representing populations spanning the latitudinal range 44° to 58.6°. In these individuals, 9342 SNPs that conformed to Hardy-Weinberg expectations were employed to assess the genomic pair-wise kinship to estimate narrow-sense heritabilities and genetic correlations among traits. The range-wide phenotypic variation in all traits was substantial and several trait heritabilities were > 0.6. In total, 61 significant genetic and phenotypic correlations and a network of highly interrelated traits were identified. The high trait variation, the evidence for moderate to high heritabilities and the identification of advantageous trait combinations of industrially important characteristics should aid in providing the foundation for the enhancement of poplar tree breeding strategies for modern industrial use.

  7. Dendroclimatic potential of plains cottonwood (Populus deltoides subsp. monilifera) from the Northern Great Plains, USA

    Science.gov (United States)

    Edmonson, Jesse; Friedman, Jonathan; Meko, David; Touchan, Ramzi; Scott, Julian; Edmonson, Alan

    2014-01-01

    A new 368-year tree-ring chronology (A.D. 1643–2010) has been developed in western North Dakota using plains cottonwood (Populus deltoides subsp. monilifera) growing on the relatively undisturbed floodplain of the Little Missouri River in the North Unit of Theodore Roosevelt National Park. We document many slow-growing living trees between 150–370 years old that contradict the common understanding that cottonwoods grow fast and die young. In this northern location, cottonwood produces distinct annual rings with dramatic interannual variability that strongly crossdate. The detrended tree-ring chronology is significantly positively correlated with local growing season precipitation and soil moisture conditions (r  =  0.69). This time series shows periods of prolonged low radial tree growth during the known droughts of the instrumental record (e.g. 1931–1939 and 1980–1981) and also during prehistory (e.g. 1816–1823 and 1856–1865) when other paleoclimate studies have documented droughts in this region. Tree rings of cottonwood will be a useful tool to help reconstruct climate, streamflow, and the floodplain history of the Little Missouri River and other northern river systems.

  8. Economic injury level for second-generation cottonwood leaf beetle (Coleoptera: Chrysomelidae) in two-year-old Populus.

    Science.gov (United States)

    Fang, Ying; Pedigo, Larry P; Colletti, Joe P; Hart, Elwood R

    2002-04-01

    The cottonwood leaf beetle, Chrysomela scripta F., is a major defoliating pest of Populus in North America. As the use of Populus in short-rotation woody crop plantations continues to increase, there are increasing economic and environmental needs to develop rational pest management programs to reduce the impact of this insect. Our objective was to determine the economic injury levels for the second generation of the cottonwood leaf beetle during plantation establishment. Integrating the cost of the management, market value, insect injury, and host response to the injury, the economic injury levels for second generation cottonwood leaf beetle on 2-yr-old Populus were determined to be from 0.2 to 0.9 egg masses per actively growing terminal.

  9. A cost-effective colorimetric assay for phenolic O-methyltransferases and characterization of caffeate 3-O-methyltranferases from Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Bhuiya, M.W.; Liu, C.

    2009-01-01

    S-Adenosyl-L-methionine (AdoMet)-dependent O-methyltransferases (OMTs) catalyze the transmethylation of a variety of phenolics in bacteria, plants, and humans. To rapidly characterize phenolic OMT activities, we adapted Gibbs reagent, the dye originally used for detecting phenols, to develop a convenient assay method for measuring the catalytic properties of enzymatic transmethylation of phenolics. We demonstrated that Gibbs reagent reacted with phenolics yielding distinct absorptive characters that we used to further develop the assay to monitor the reactivities of phenolic OMTs. To validate the method, we identified two caffeate/5-hydroxyferulate 3/5-O-methyltransferases (COMTs) from the black cottonwood, Populus trichocarpa. Together with a few other plant type I OMTs, we demonstrated that our Gibbs reagent-mediated colorimetric assay could reliably determine the functions and kinetic parameters of phenolic OMTs. Because Gibbs reagent reacting with different regioselectively modified phenolics displays different colorimetric properties, the assay method can be used to monitor both substrate specificity and the regioselectivity of phenolic OMTs.

  10. Comparative Genomic Study of the Thioredoxin Family in Photosynthetic Organisms with Emphasis on Populus trichocarpa

    Institute of Scientific and Technical Information of China (English)

    Kamel Chibani; Gunnar Wingsle; Jean-Pierre Jacquot; Eric Gelhaye; Nicolas Rouhier

    2009-01-01

    The recent genome sequencing of Populus trichocarpa and Vitis vinifera, two models of woody plants, of Sorghum bicolor, a model of monocot using C4 metabolism, and of the moss Physcomitrella patens, together with the availability of photosynthetic organism genomes allows performance of a comparative genomic study with organisms having different ways of life, reproduction modes, biological traits, and physiologies. Thioredoxins (Trxs) are small ubiq-uitous proteins involved in the reduction of disulfide bridges in a variety of target enzymes present in all sub-cellular compartments and involved in many biochemical reactions. The genes coding for these enzymes have been identified in these newly sequenced genomes and annotated. The gene content, organization and distribution were compared to other photosynthetic organisms, leading to a refined classification. This analysis revealed that higher plants and bryo-phytes have a more complex family compared to algae and cyanobacteria and to non-photosynthetic organisms, since poplar exhibits 49 genes coding for typical and atypical thioredoxins and thioredoxin reductases, namely one-third more than monocots such as Oryza sativa and S. bicolor. The higher number of Trxs in poplar is partially explained by gene duplication in the Trx m, h, and nucleoredoxin classes. Particular attention was paid to poplar genes with emphasis on Trx-like classes called Clot, thioredoxin-like, thioredoxins of the lilium type and nucleoredoxins, which were not described in depth in previous genomic studies.

  11. Evapotranspiration in a cottonwood (Populus fremontii) restoration plantation estimated by sap flow and remote sensing methods

    Science.gov (United States)

    Nagler, P.; Jetton, A.; Fleming, J.; Didan, K.; Glenn, E.; Erker, J.; Morino, K.; Milliken, J.; Gloss, S.

    2007-01-01

    Native tree plantations have been proposed for the restoration of wildlife habitat in human-altered riparian corridors of western U.S. rivers. Evapotranspiration (ET) by riparian vegetation is an important, but poorly quantified, term in river water budgets. Native tree restoration plots will potentially increase ET. We used sap flow sensors and satellite imagery to estimate ET in a 8 ha, cottonwood (Populus fremontii) restoration plot on the Lower Colorado River. Biometric methods were used to scale leaf area to whole trees and stands of trees. This technique was used to validate our estimates of ET obtained by scaling from branch level to stand (or plot) level measurements of ET. Cottonwood trees used 6-10 mm day-1 of water during the peak of the growing season as determined by sap flow sensors, and annual rates scaled by time-series MODIS satellite imagery were approximately 1.2 m year-1. Although irrigation was not quantified, the field had been flood irrigated at 2 week intervals during the 3 years prior to the study, receiving approximately 2 m year-1 of water. A frequency-domain electromagnetic induction survey of soil moisture content showed that the field was saturated (26-28% gravimetric water content) at the 90-150 cm soil depth under the field. Trees were apparently rooted into the saturated soil, and considerable saving of water could potentially be achieved by modifying the irrigation regime to take into account that cottonwoods are phreatophytes. The study showed that cottonwood ET can be monitored by remote sensing methods calibrated with ground measurements with an accuracy or uncertainty of 20-30% in western riparian corridors. ?? 2007 Elsevier B.V. All rights reserved.

  12. Physico-Chemical Properties and Biodegradability of Genetically Modified Populus trichocarpa and Pinus taeda

    Science.gov (United States)

    Edmunds, Charles Warren

    Increasing concerns over greenhouse gas emissions and the finite supply of fossil fuels lead to the goal of utilizing lignocellulosic feedstocks for biofuels, platform chemicals, and biocomposites. Lignin is responsible for the recalcitrance of lignocellulosic biomass and is a major barrier to its deconstruction. Great progress has been made in mapping and modifying the lignin biosynthetic pathway. However, the link between the genetic modification, resulting chemical and physical properties of the wood, and how these properties influence the thermomechanical and recalcitrance to biological and chemical degradation needs further investigation. In this dissertation, the study of modified Populus trichocarpa and Pinus taeda were utilized to accomplish this goal. Thermo-mechanical properties of genetically modified P. trichocarpa with altered lignin content and/or lignin structure were measured with a series of tools including; dynamic mechanical analysis, nuclear magnetic resonance, and wet chemistry techniques. Results demonstrated lignin content and lignin structure likely influence the glass transition temperature (Tg), and that decreased lignin content and the corresponding higher proportion of cell wall carbohydrates may contribute to increased molecular mobility in the wood polymer structure. The effect of lignin biosynthetic pathway modification on biological degradation of these transgenic wood specimens was of interest. However, experimental methods for fungal treatment on small young greenhouse-grown wood specimens are not well established. Therefore, a project was undertaken to develop a method for fungal inoculation and incubation for these unique specimens. Several parameters were tested, and a fungal treatment method was identified with sufficient weight loss after decay and significant reduction in variation of weight loss between replicates compared to previous experiments by direct inoculation of wood with liquid malt extract fungal culture

  13. Overexpression of Populus trichocarpa CYP85A3 promotes growth and biomass production in transgenic trees.

    Science.gov (United States)

    Jin, Yan-Li; Tang, Ren-Jie; Wang, Hai-Hai; Jiang, Chun-Mei; Bao, Yan; Yang, Yang; Liang, Mei-Xia; Kong, Fanjing; Li, Bei; Zhang, Hong-Xia

    2017-03-04

    Brassinosteroids (BRs) are essential hormones that play crucial roles in plant growth, reproduction and response to abiotic and biotic stress. In Arabidopsis, AtCYP85A2 works as a bifunctional cytochrome P450 monooxygenase to catalyze the conversion of castasterone (CS) to brassinolide (BL), a final rate-limiting step in the BR biosynthetic pathway. Here, we report the functional characterizations of PtCYP85A3, one of the three AtCYP85A2 homologous genes from Populus trichocarpa. PtCYP85A3 shares the highest similarity with AtCYP85A2 and can rescue the retarded-growth phenotype of the Arabidopsis cyp85a2-2 and tomato d(x) mutants. Constitutive expression of PtCYP85A3, driven by the cauliflower mosaic virus 35S promoter, increased the endogenous BR levels and significantly promoted the growth and biomass production in both transgenic tomato and poplar. Compared to the wild type (WT), plant height, shoot fresh weight and fruit yield increased 50%, 56% and 43%, respectively, in transgenic tomato plants. Similarly, plant height and stem diameter increased 15% and 25%, respectively, in transgenic poplar plants. Further study revealed that overexpression of PtCYP85A3 enhanced xylem formation without affecting the composition of cellulose and lignin, as well as the cell wall thickness in transgenic poplar. Our finding suggest that PtCYP85A3 could be used as a potential candidate gene for engineering fast growing trees with improved wood production. This article is protected by copyright. All rights reserved.

  14. Elucidation of Xylem-Specific Transcription Factors and Absolute Quantification of Enzymes Regulating Cellulose Biosynthesis in Populus trichocarpa.

    Science.gov (United States)

    Loziuk, Philip L; Parker, Jennifer; Li, Wei; Lin, Chien-Yuan; Wang, Jack P; Li, Quanzi; Sederoff, Ronald R; Chiang, Vincent L; Muddiman, David C

    2015-10-02

    Cellulose, the main chemical polymer of wood, is the most abundant polysaccharide in nature.1 The ability to perturb the abundance and structure of cellulose microfibrils is of critical importance to the pulp and paper industry as well as for the textile, wood products, and liquid biofuels industries. Although much has been learned at the transcript level about the biosynthesis of cellulose, a quantitative understanding at the proteome level has yet to be established. The study described herein sought to identify the proteins directly involved in cellulose biosynthesis during wood formation in Populus trichocarpa along with known xylem-specific transcription factors involved in regulating these key proteins. Development of an effective discovery proteomic strategy through a combination of subcellular fractionation of stem differentiating xylem tissue (SDX) with recently optimized FASP digestion protocols, StageTip fractionation, as well as optimized instrument parameters for global proteomic analysis using the quadrupole-orbitrap mass spectrometer resulted in the deepest proteomic coverage of SDX protein from P. trichocarpa with 9,146 protein groups being identified (1% FDR). Of these, 20 cellulosic/hemicellulosic enzymes and 43 xylem-specific transcription factor groups were identified. Finally, selection of surrogate peptides led to an assay for absolute quantification of 14 cellulosic proteins in SDX of P. trichocarpa.

  15. Comparative physiology and transcriptional networks underlying the heat shock response in Populus trichocarpa, Arabidopsis thaliana and Glycine max

    Energy Technology Data Exchange (ETDEWEB)

    Weston, David [ORNL; Wullschleger, Stan D [ORNL; Yang, Xiaohan [ORNL; Karve, Abhijit A [ORNL; Gunter, Lee E [ORNL; Jawdy, Sara [ORNL; Allen, Sara M [ORNL

    2011-01-01

    The heat shock response continues to be layered with additional complexity as interactions and crosstalk among heat shock proteins (HSPs), the reactive oxygen network and hormonal signalling are discovered. However, comparative analyses exploring variation in each of these processes among species remain relatively unexplored. In controlled environment experiments, photosynthetic response curves were conducted from 22 to 42 C and indicated that temperature optimum of light-saturated photosynthesis was greater for Glycine max relative to Arabidopsis thaliana or Populus trichocarpa. Transcript profiles were taken at defined states along the temperature response curves, and inferred pathway analysis revealed species-specific variation in the abiotic stress and the minor carbohydrate raffinose/galactinol pathways. A weighted gene co-expression network approach was used to group individual genes into network modules linking biochemical measures of the antioxidant system to leaf-level photosynthesis among P. trichocarpa, G. max and A. thaliana. Network-enabled results revealed an expansion in the G. max HSP17 protein family and divergence in the regulation of the antioxidant and heat shock modules relative to P. trichocarpa and A. thaliana. These results indicate that although the heat shock response is highly conserved, there is considerable species-specific variation in its regulation.

  16. Flow regime effects on mature Populus fremontii (Fremont cottonwood) productivity on two contrasting dryland river floodplains

    Science.gov (United States)

    Andersen, Douglas C.

    2016-01-01

    I compared riparian cottonwood (Populus fremontii) productivity-discharge relationships in a relictual stand along the highly regulated Green River and in a naturally functioning stand along the unregulated Yampa River in semiarid northwest Colorado. I used multiple regression to model flow effects on annual basal area increment (BAI) from 1982 to 2011, after removing any autocorrelation present. Each BAI series was developed from 20 trees whose mean size (67 cm diameter at breast height [DBH]) was equivalent in the two stands. BAI was larger in the Yampa River stand except in 2 y when defoliating leaf beetles were present there. I found no evidence for a Yampa flood-magnitude threshold above which BAI declined. Flow variables explained ∼45% of residual BAI variability, with most explained by current-year maximum 90-d discharge (QM90) in the Yampa River stand and by a measure of the year-to-year change in QM90 in the Green River stand. The latter reflects a management-imposed ceiling on flood magnitude—Flaming Gorge Dam power plant capacity—infrequently exceeded during the study period. BAI in the relictual stand began to trend upward in 1992 when flows started to mimic a natural flow regime. Mature Fremont cottonwoods appear to be ecologically resilient. Their productivity along regulated rivers might be optimized using multiyear environmental flow designs.

  17. Genome-wide analysis and heavy metal-induced expression profiling of the HMA gene family in Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Dandan eLi

    2015-12-01

    Full Text Available The heavy metal ATPase (HMA family plays an important role in transition metal transport in plants. However, this gene family has not been extensively studied in Populus trichocarpa. We identified 17 HMA genes in P. trichocarpa (PtHMAs, of which PtHMA1–PtHMA4 belonged to the zinc (Zn/cobalt (Co/cadmium (Cd/lead (Pb subgroup, and PtHMA5–PtHMA8 were members of the copper (Cu/silver (Ag subgroup. Most of the genes were localized to chromosomes I and III. Gene structure, gene chromosomal location, and synteny analyses of PtHMAs indicated that tandem and segmental duplications likely contributed to the expansion and evolution of the PtHMAs. Most of the HMA genes contained abiotic stress-related cis-elements. Tissue-specific expression of PtHMA genes showed that PtHMA1 and PtHMA4 had relatively high expression levels in the leaves, whereas Cu/Ag subgroup (PtHMA5.1- PtHMA8 genes were upregulated in the roots. High concentrations of Cu, Ag, Zn, Cd, Co, Pb and Mn differentially regulated the expression of PtHMAs in various tissues. The preliminary results of the present study generated basic information on the HMA family of Populus that may serve as foundation for future functional studies.

  18. Down-regulation of glycosyltransferase 8D genes in Populus trichocarpa caused reduced mechanical strength and xylan content in wood.

    Science.gov (United States)

    Li, Quanzi; Min, Douyong; Wang, Jack Peng-Yu; Peszlen, Ilona; Horvath, Laszlo; Horvath, Balazs; Nishimura, Yufuko; Jameel, Hasan; Chang, Hou-Min; Chiang, Vincent L

    2011-02-01

    Members of glycosyltransferase protein families GT8, GT43 and GT47 are implicated in the biosynthesis of xylan in the secondary cell walls of Arabidopsis. The Arabidopsis mutant irx8 has a 60% reduction in xylan. However, over-expression of an ortholog of Arabidopsis IRX8, poplar PoGT8D, in Arabidopsis irx8 mutant could not restore xylan synthesis. The functions of tree GT8D genes remain unclear. We identified two GT8 gene homologs, PtrGT8D1 and PtrGT8D2, in Populus trichocarpa. They are the only two GT8D members and are abundantly and specifically expressed in the differentiating xylem of P. trichocarpa. PtrGT8D1 transcript abundance was >7 times that of PtrGT8D2. To elucidate the genetic function of GT8D in P. trichocarpa, the expression of PtrGT8D1 and PtrGT8D2 was simultaneously knocked down through RNAi. Four transgenic lines had 85-94% reduction in transcripts of PtrGT8D1 and PtrGT8D2, resulting in 29-36% reduction in stem wood xylan content. Xylan reduction had essentially no effect on cellulose quantity but caused an 11-25% increase in lignin. These transgenics exhibit a brittle wood phenotype, accompanied by increased vessel diameter and thinner fiber cell walls in stem xylem. Stem modulus of elasticity and modulus of rupture were reduced by 17-29% and 16-23%, respectively, and were positively correlated with xylan content but negatively correlated with lignin quantity. These results suggest that PtrGT8Ds play key roles in xylan biosynthesis in wood. Xylan may be a more important factor than lignin affecting the stiffness and fracture strength of wood.

  19. Effects of in vitro ozone treatment on proteolysis of purified rubisco from two hybrid poplar clones. [Populus maximowizii x trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Landry, L.G.; Pell, E.J. (Pennsylvania State Univ., University Park (USA))

    1989-04-01

    Plants exposed to ozone (O{sub 3}) exhibited symptoms of premature senescence, including early decline in quantity of rubisco. O{sub 3}-induced oxidation may cause changes in protein conformation of rubisco, resulting in enhanced proteolysis. To test this hypothesis, rubisco was purified from two hybrid clones of Populus maximowizii x trichocarpa, clones 388 and 245, and treated in vitro with O{sub 3} or air. Rubisco was then challenged with bromelain, papain, chymotrypsin, carboxypeptidase A, or endoproteinase Glu-C and percent degradation measured by SDS-PAGE and densitometric scanning of the gels. Degree of rubisco sensitivity to oxidation may be related to available sulfhydryl (SH) groups on the protein. The number of SH groups in native and denatured rubisco was measured for purified rubisco of both clones by DTNB titration method. The relationship between sensitivity to proteolysis and number and availability of SH groups is discussed.

  20. Network analysis reveals the relationship among wood properties, gene expression levels and genotypes of natural Populus trichocarpa accessions.

    Science.gov (United States)

    Porth, Ilga; Klápště, Jaroslav; Skyba, Oleksandr; Friedmann, Michael C; Hannemann, Jan; Ehlting, Juergen; El-Kassaby, Yousry A; Mansfield, Shawn D; Douglas, Carl J

    2013-11-01

    High-throughput approaches have been widely applied to elucidate the genetic underpinnings of industrially important wood properties. Wood traits are polygenic in nature, but gene hierarchies can be assessed to identify the most important gene variants controlling specific traits within complex networks defining the overall wood phenotype. We tested a large set of genetic, genomic, and phenotypic information in an integrative approach to predict wood properties in Populus trichocarpa. Nine-yr-old natural P. trichocarpa trees including accessions with high contrasts in six traits related to wood chemistry and ultrastructure were profiled for gene expression on 49k Nimblegen (Roche NimbleGen Inc., Madison, WI, USA) array elements and for 28,831 polymorphic single nucleotide polymorphisms (SNPs). Pre-selected transcripts and SNPs with high statistical dependence on phenotypic traits were used in Bayesian network learning procedures with a stepwise K2 algorithm to infer phenotype-centric networks. Transcripts were pre-selected at a much lower logarithm of Bayes factor (logBF) threshold than SNPs and were not accommodated in the networks. Using persistent variables, we constructed cross-validated networks for variability in wood attributes, which contained four to six variables with 94-100% predictive accuracy. Accommodated gene variants revealed the hierarchy in the genetic architecture that underpins substantial phenotypic variability, and represent new tools to support the maximization of response to selection.

  1. Identification of quantitative trait loci affecting ectomycorrhizal symbiosis in an interspecific F1 poplar cross and differential expression of genes in ectomycorrhizas of the two parents: Populus deltoides and Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Labbe, Jessy L [ORNL; Jorge, Veronique [INRA, Nancy, France; Vion, Patrice [INRA, Nancy, France; Marcais, Benoit [INRA, Nancy, France; Bastien, Catherine [INRA, Orleans, France; Tuskan, Gerald A [ORNL; Martin, Francis [INRA, Nancy, France; Le Tacon, F [UMR, France

    2011-01-01

    A Populus deltoides Populus trichocarpa F1 pedigree was analyzed for quantitative trait loci (QTLs) affecting ectomycorrhizal development and for microarray characterization of gene networks involved in this symbiosis. A 300 genotype progeny set was evaluated for its ability to form ectomycorrhiza with the basidiomycete Laccaria bicolor. The percentage of mycorrhizal root tips was determined on the root systems of all 300 progeny and their two parents. QTL analysis identified four significant QTLs, one on the P. deltoides and three on the P. trichocarpa genetic maps. These QTLs were aligned to the P. trichocarpa genome and each contained several megabases and encompass numerous genes. NimbleGen whole-genome microarray, using cDNA from RNA extracts of ectomycorrhizal root tips from the parental genotypes P. trichocarpa and P. deltoides, was used to narrow the candidate gene list. Among the 1,543 differentially expressed genes (p value 0.05; 5.0-fold change in transcript level) having different transcript levels in mycorrhiza of the two parents, 41 transcripts were located in the QTL intervals: 20 in Myc_d1, 14 in Myc_t1, and seven in Myc_t2, while no significant differences among transcripts were found in Myc_t3. Among these 41 transcripts, 25 were overrepresented in P. deltoides relative to P. trichocarpa; 16 were overrepresented in P. trichocarpa. The transcript showing the highest overrepresentation in P. trichocarpa mycorrhiza libraries compared to P. deltoides mycorrhiza codes for an ethylene-sensitive EREBP-4 protein which may repress defense mechanisms in P. trichocarpa while the highest overrepresented transcripts in P. deltoides code for proteins/genes typically associated with pathogen resistance.

  2. A cell wall-bound anionic peroxidase, PtrPO21, is involved in lignin polymerization in Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Chien-Yuan; Li, Quanzi; Tunlaya-Anukit, Sermsawat; Shi, Rui; Sun, Ying-Hsuan; Wang, Jack P.; Liu, Jie; Loziuk, Philip; Edmunds, Charles W.; Miller, Zachary D.; Peszlen, Ilona; Muddiman, David C.; Sederoff, Ronald R.; Chiang, Vincent L.

    2016-03-11

    Class III peroxidases are members of a large plant-specific sequence-heterogeneous protein family. Several sequence-conserved homologs have been associated with lignin polymerization in Arabidopsis thaliana, Oryza sativa, Nicotiana tabacum, Zinnia elegans, Picea abies, and Pinus sylvestris. In Populus trichocarpa, a model species for studies of wood formation, the peroxidases involved in lignin biosynthesis have not yet been identified. To do this, we retrieved sequences of all PtrPOs from Peroxibase and conducted RNA-seq to identify candidates. Transcripts from 42 PtrPOs were detected in stem differentiating xylem (SDX) and four of them are the most xylem-abundant (PtrPO12, PtrPO21, PtrPO42, and PtrPO64). PtrPO21 shows xylem-specific expression similar to that of genes encoding the monolignol biosynthetic enzymes. Using protein cleavage-isotope dilution mass spectrometry, PtrPO21 is detected only in the cell wall fraction and not in the soluble fraction. Downregulated transgenics of PtrPO21 have a lignin reduction of ~20% with subunit composition (S/G ratio) similar to wild type. The transgenics show a growth reduction and reddish color of stem wood. The modulus of elasticity (MOE) of the stems of the downregulated PtrPO21-line 8 can be reduced to ~60% of wild type. Differentially expressed gene (DEG) analysis of PtrPO21 downregulated transgenics identified a significant overexpression of PtPrx35, suggesting a compensatory effect within the peroxidase family. No significant changes in the expression of the 49 P. trichocarpa laccases (PtrLACs) were observed.

  3. Genome-wide analysis of Aux/IAA and ARF gene families in Populus trichocarpa

    Energy Technology Data Exchange (ETDEWEB)

    Kalluri, Udaya C [ORNL; DiFazio, Stephen P [West Virginia University; Brunner, A. [Virginia Polytechnic Institute and State University (Virginia Tech); Tuskan, Gerald A [ORNL

    2007-01-01

    Auxin/Indole-3-Acetic Acid (Aux/IAA) and Auxin Response Factor (ARF) transcription factors are key regulators of auxin responses in plants. A total of 35 Aux/IAA and 39 ARF genes were identified in the Populus genome. Comparative phylogenetic analysis revealed that the subgroups PoptrARF2, 6, 9 and 16 and PoptrIAA3, 16, 27 and 29 have differentially expanded in Populus relative to Arabidopsis. Activator ARFs were found to be two fold-overrepresented in the Populus genome. PoptrIAA and PoptrARF gene families appear to have expanded due to high segmental and low tandem duplication events. Furthermore, expression studies showed that genes in the expanded PoptrIAA3 subgroup display differential expression. The gene-family analysis reported here will be useful in conducting future functional genomics studies to understand how the molecular roles of these large gene families translate into a diversity of biologically meaningful auxin effects.

  4. On the irrigation requirements of cottonwood (Populus fremontii and Populus deltoides var. wislizenii) and willow (Salix gooddingii) grown in a desert environment

    Science.gov (United States)

    Hartwell, S.; Morino, K.; Nagler, P.L.; Glenn, E.P.

    2010-01-01

    Native tree plots have been established in river irrigation districts in the western U.S. to provide habitat for threatened and endangered birds. Information is needed on the effective irrigation requirements of the target species. Cottonwood (Populus spp.) and willow (Salix gooddingii) trees were grown for seven years in an outdoor plot in a desert environment in Tucson, Arizona. Plants were allowed to achieve a nearly complete canopy cover over the first four years, then were subjected to three daily summer irrigation schedules of 6.20??mm??d-1; 8.26??mm??d-1 and 15.7??mm??d-1. The lowest irrigation rate was sufficient to maintain growth and high leaf area index for cottonwoods over three years, while willows suffered considerable die-back on this rate in years six and seven. These irrigation rates were applied April 15-September 15, but only 0.88??mm??d-1 was applied during the dormant period of the year. Expressed as a fraction of reference crop evapotranspiration (ETo), recommended annual water applications plus precipitation (and including some deep drainage) were 0.83 ETo for cottonwood and 1.01 ETo for willow. Current practices tend to over-irrigate restoration plots, and this study can provide guidelines for more efficient water use. ?? 2010 Elsevier Ltd.

  5. Genome-wide analysis of basic leucine zipper transcription factor families in Arabidopsis thaliana, Oryza saliva and Populus trichocarpa

    Institute of Scientific and Technical Information of China (English)

    JI Qian; ZHANG Liang-sheng; WANG Yi-fei; WANG Jian

    2009-01-01

    The basic leucine zipper (bZIP) transcription factors form a large gene family that is important in pathogen defense, light and stress signaling, etc. The Completed whole genome sequences of model plants Arabidopsis (Arabidopsis thaliana), rice (Oryza saliva) and poplar (Populus trichocarpa) constitute a valuable resource for genome-wide analysis and genomic comparative analysis, as they are representatives of the two major evolutionary lineages within the angiosperms: the monocotyledons and the dicotyledons. In this study, bioinformatics analysis identified 74, 89 and 88 bZIP genes respectively in Arabidopsis, rice and poplar. Moreover, a comprehensive overview of this gene family is presented, including the gene structure, phylogeny, chromosome distribution, conserved motifs. As a result, the plant bZIPs were organized into 10 subfamilies on basis of phylogenetic relationship. Gene duplication events during the family evolution history were also investigated. And it was further concluded that chromosomal/segmental duplication might have played a key role in gene expansion of bZIP gene family.

  6. The role of water channel proteins in facilitating recovery of leaf hydraulic conductance from water stress in Populus trichocarpa.

    Directory of Open Access Journals (Sweden)

    Joan Laur

    Full Text Available Gas exchange is constrained by the whole-plant hydraulic conductance (Kplant. Leaves account for an important fraction of Kplant and may therefore represent a major determinant of plant productivity. Leaf hydraulic conductance (Kleaf decreases with increasing water stress, which is due to xylem embolism in leaf veins and/or the properties of the extra-xylary pathway. Water flow through living tissues is facilitated and regulated by water channel proteins called aquaporins (AQPs. Here we assessed changes in the hydraulic conductance of Populus trichocarpa leaves during a dehydration-rewatering episode. While leaves were highly sensitive to drought, Kleaf recovered only 2 hours after plants were rewatered. Recovery of Kleaf was absent when excised leaves were bench-dried and subsequently xylem-perfused with a solution containing AQP inhibitors. We examined the expression patterns of 12 highly expressed AQP genes during a dehydration-rehydration episode to identify isoforms that may be involved in leaf hydraulic adjustments. Among the AQPs tested, several genes encoding tonoplast intrinsic proteins (TIPs showed large increases in expression in rehydrated leaves, suggesting that TIPs contribute to reversing drought-induced reductions in Kleaf. TIPs were localized in xylem parenchyma, consistent with a role in facilitating water exchange between xylem vessels and adjacent living cells. Dye uptake experiments suggested that reversible embolism formation in minor leaf veins contributed to the observed changes in Kleaf.

  7. Cottonwood leaf beetle (Coleoptera: Chrysomelidae) defoliation impact on Populus growth and above-ground volume in a short-rotation woody crop plantation

    Science.gov (United States)

    David R. Coyle; Joel D. McMillin; Richard B. Hall; Elwood R. Hart

    2002-01-01

    AbstractThe impact of cottonwood leaf beetle Chrysomela scripta F. defoliation on four plantation-grown Populus clones was examined over three growing seasons. We used a split-plot design with two treatments: protected (by insecticides) and an unprotected control. Tree height and...

  8. Structure and Expression Profile of the Phosphate Pht1 Transporter Gene Family in Mycorrhizal Populus trichocarpa1[W

    Science.gov (United States)

    Loth-Pereda, Verónica; Orsini, Elena; Courty, Pierre-Emmanuel; Lota, Frédéric; Kohler, Annegret; Diss, Loic; Blaudez, Damien; Chalot, Michel; Nehls, Uwe; Bucher, Marcel; Martin, Francis

    2011-01-01

    Gene networks involved in inorganic phosphate (Pi) acquisition and homeostasis in woody perennial species able to form mycorrhizal symbioses are poorly known. Here, we describe the features of the 12 genes coding for Pi transporters of the Pht1 family in poplar (Populus trichocarpa). Individual Pht1 transporters play distinct roles in acquiring and translocating Pi in different tissues of mycorrhizal and nonmycorrhizal poplar during different growth conditions and developmental stages. Pi starvation triggered the up-regulation of most members of the Pht1 family, especially PtPT9 and PtPT11. PtPT9 and PtPT12 showed a striking up-regulation in ectomycorrhizas and endomycorrhizas, whereas PtPT1 and PtPT11 were strongly down-regulated. PtPT10 transcripts were highly abundant in arbuscular mycorrhiza (AM) roots only. PtPT8 and PtPT10 are phylogenetically associated to the AM-inducible Pht1 subfamily I. The analysis of promoter sequences revealed conserved motifs similar to other AM-inducible orthologs in PtPT10 only. To gain more insight into gene regulatory mechanisms governing the AM symbiosis in woody plant species, the activation of the poplar PtPT10 promoter was investigated and detected in AM of potato (Solanum tuberosum) roots. These results indicated that the regulation of AM-inducible Pi transporter genes is conserved between perennial woody and herbaceous plant species. Moreover, poplar has developed an alternative Pi uptake pathway distinct from AM plants, allowing ectomycorrhizal poplar to recruit PtPT9 and PtPT12 to cope with limiting Pi concentrations in forest soils. PMID:21705655

  9. Identification of genes regulated by histone acetylation during root development in Populus trichocarpa.

    Science.gov (United States)

    Ma, Xujun; Zhang, Chao; Zhang, Bing; Yang, Chuanping; Li, Shujuan

    2016-02-04

    Histone deacetylases (HDACs) are key enzymes catalyzing the removal of acetyl groups from histones. HDACs act in concert with histone acetyltransferases (HATs) to regulate histone acetylation status, which modifies chromatin structure, affecting gene transcription and thus regulating multiple biological processes such as plant growth and development. Over a decade, certain HDACs in herbaceous plants have been deeply studied. However, functions of HDACs in woody plants are not well understood. Histone deacetylase specific inhibitor trichostatin A (TSA) was used to investigate the role of HDACs in organogenesis of roots and root development in Populus trochocarpa. The adventitious roots were regenerated and grown on medium supplemented with 0, 1, and 2.5 μM TSA. TSA treatment delayed root regeneration and inhibited primary root growth. To examine the genes modified by TSA in the regenerated roots, tag-based digital gene expression (DGE) analysis was performed using Illumina HiSeqTM 2000. Approximately 4.5 million total clean tags were mapped per library. The distinct clean tags for the three libraries corresponding to 0, 1 and 2.5 μM TSA treatment were 166167, 143103 and 153507, from which 38.45%, 31.84% and 38.88% were mapped unambiguously to the unigene database, respectively. Most of the tags were expressed at similar levels, showing a histone acetylation during root growth and development, which will lead to a better understanding of the mechanism controlling root development.

  10. In Silico Identification and Characterization of N-Terminal Acetyltransferase Genes of Poplar (Populus trichocarpa

    Directory of Open Access Journals (Sweden)

    Hang-Yong Zhu

    2014-01-01

    Full Text Available N-terminal acetyltransferase (Nats complex is responsible for protein N-terminal acetylation (Nα-acetylation, which is one of the most common covalent modifications of eukaryotic proteins. Although genome-wide investigation and characterization of Nat catalytic subunits (CS and auxiliary subunits (AS have been conducted in yeast and humans they remain unexplored in plants. Here we report on the identification of eleven genes encoding eleven putative Nat CS polypeptides, and five genes encoding five putative Nat AS polypeptides in Populus. We document that the expansion of Nat CS genes occurs as duplicated blocks distributed across 10 of the 19 poplar chromosomes, likely only as a result of segmental duplication events. Based on phylogenetic analysis, poplar Nat CS were assigned to six subgroups, which corresponded well to the Nat CS types (CS of Nat A–F, being consistent with previous reports in humans and yeast. In silico analysis of microarray data showed that in the process of normal development of the poplar, their Nat CS and AS genes are commonly expressed at one relatively low level but share distinct tissue-specific expression patterns. This exhaustive survey of Nat genes in poplar provides important information to assist future studies on their functional role in poplar.

  11. Germination and establishment of the native plains cottonwood (Populus deltoides Marshall subsp. monilifera) and the exotic Russian-olive (Elaeagnus angustifolia L.)

    Science.gov (United States)

    Shafroth, Patrick B.; Auble, Gregor T.; Scott, Michael L.

    1995-01-01

    Russian-olive (Elaeagnus angustifolia) is a small Eurasian tree that has escaped from cultivation and become naturalized, primarily along watercourses throughout the western United States. We examined germination and establishment of Russian-olive and plains cottonwood (Populus deltoides), the principal native riparian tree of the Great Plains, under a range of experimental moisture and light conditions. The fewest seedings established under the driest conditions; seedling biomass was predictably lower in the shade; root-to-shoot ratios were higher for cottonwood, higher in the sun, and higher under drier conditions. Several interactions were also significant. The timing of germination and mortality varied between plains cottonwood and Russian-olive: cottonwood germinated in mid-June in all treatments in a single pulse with subsequent mortality; the timing and amount of Russian-olive germination differed substantially across treatments with little net mortality. Differences in life-history traits of these species, including seed size, viability, and dispersal, help explain treatment differences. Russian-olive will likely remain an important component of riparian communities along both unregulated and regulated western rivers because it succeeds under conditions optimal for cottonwood establishment and under many conditions unfavorable for cottonwood. Furthermore, many western states still encourage planting of Russian-olive, and control techniques tend to be labor-intensive and expensive.

  12. Systems biology of lignin biosynthesis in Populus trichocarpa: heteromeric 4-coumaric acid:coenzyme A ligase protein complex formation, regulation, and numerical modeling.

    Science.gov (United States)

    Chen, Hsi-Chuan; Song, Jina; Wang, Jack P; Lin, Ying-Chung; Ducoste, Joel; Shuford, Christopher M; Liu, Jie; Li, Quanzi; Shi, Rui; Nepomuceno, Angelito; Isik, Fikret; Muddiman, David C; Williams, Cranos; Sederoff, Ronald R; Chiang, Vincent L

    2014-03-01

    As a step toward predictive modeling of flux through the pathway of monolignol biosynthesis in stem differentiating xylem of Populus trichocarpa, we discovered that the two 4-coumaric acid:CoA ligase (4CL) isoforms, 4CL3 and 4CL5, interact in vivo and in vitro to form a heterotetrameric protein complex. This conclusion is based on laser microdissection, coimmunoprecipitation, chemical cross-linking, bimolecular fluorescence complementation, and mass spectrometry. The tetramer is composed of three subunits of 4CL3 and one of 4CL5. 4CL5 appears to have a regulatory role. This protein-protein interaction affects the direction and rate of metabolic flux for monolignol biosynthesis in P. trichocarpa. A mathematical model was developed for the behavior of 4CL3 and 4CL5 individually and in mixtures that form the enzyme complex. The model incorporates effects of mixtures of multiple hydroxycinnamic acid substrates, competitive inhibition, uncompetitive inhibition, and self-inhibition, along with characteristic of the substrates, the enzyme isoforms, and the tetrameric complex. Kinetic analysis of different ratios of the enzyme isoforms shows both inhibition and activation components, which are explained by the mathematical model and provide insight into the regulation of metabolic flux for monolignol biosynthesis by protein complex formation.

  13. Transcriptome profiles of hybrid poplar (Populus trichocarpa × deltoides) reveal rapid changes in undamaged, systemic sink leaves after simulated feeding by forest tent caterpillar (Malacosoma disstria).

    Science.gov (United States)

    Philippe, Ryan N; Ralph, Steven G; Mansfield, Shawn D; Bohlmann, Jörg

    2010-11-01

    • Poplar has been established as a model tree system for genomic research of the response to biotic stresses. This study describes a series of induced transcriptome changes and the associated physiological characterization of local and systemic responses in hybrid poplar (Populus trichocarpa × deltoides) after simulated herbivory. • Responses were measured in local source (LSo), systemic source (SSo), and systemic sink (SSi) leaves following application of forest tent caterpillar (Malacosoma disstria) oral secretions to mechanically wounded leaves. • Transcriptome analyses identified spatially and temporally dynamic, distinct patterns of local and systemic gene expression in LSo, SSo and SSi leaves. Galactinol synthase was strongly and rapidly upregulated in SSi leaves. Genome analyses and full-length cDNA cloning established an inventory of poplar galactinol synthases. Induced changes of galactinol and raffinose oligosaccharides were detected by anion-exchange high-pressure liquid chromatography. • The LSo leaves showed a rapid and strong transcriptome response compared with a weaker and slower response in adjacent SSo leaves. Surprisingly, the transcriptome response in distant, juvenile SSi leaves was faster and stronger than that observed in SSo leaves. Systemic transcriptome changes of SSi leaves have signatures of rapid change of metabolism and signaling, followed by later induction of defense genes.

  14. Leaf wax n-alkane δD values are determined early in the ontogeny of Populus trichocarpa leaves when grown under controlled environmental conditions.

    Science.gov (United States)

    Kahmen, Ansgar; Dawson, Todd E; Vieth, Andrea; Sachse, Dirk

    2011-10-01

    The stable hydrogen isotope ratios (δD) of leaf wax n-alkanes record valuable information on plant and ecosystem water relations. It remains, however, unknown if leaf wax n-alkane δD values record only environmental variation during the brief period of time of leaf growth or if leaf wax n-alkane δD values are affected by environmental variability throughout the entire lifespan of a leaf. To resolve these uncertainties, we irrigated Populus trichocarpa trees with a pulse of deuterium-enriched water and used compound-specific stable hydrogen isotope analyses to test if the applied tracer could be recovered from leaf wax n-alkanes of leaves that were at different stages of their development during the tracer application. Our experiment revealed that only leaf wax n-alkanes from leaves that had developed during the time of the tracer application were affected, while leaves that were already fully matured at the time of the tracer application were not. We conclude from our study that under controlled environmental conditions, leaf wax n-alkanes are synthesized only early in the ontogeny of a leaf. Our experiment has implications for the interpretation of leaf wax n-alkane δD values in an environmental context, as it suggests that these compounds record only a brief period of the environmental variability that a leaf experiences throughout its life.

  15. Structural and enzymatic insights into Lambda glutathione transferases from Populus trichocarpa, monomeric enzymes constituting an early divergent class specific to terrestrial plants.

    Science.gov (United States)

    Lallement, Pierre-Alexandre; Meux, Edgar; Gualberto, José M; Prosper, Pascalita; Didierjean, Claude; Saul, Frederick; Haouz, Ahmed; Rouhier, Nicolas; Hecker, Arnaud

    2014-08-15

    GSTs represent a superfamily of multifunctional proteins which play crucial roles in detoxification processes and secondary metabolism. Instead of promoting the conjugation of glutathione to acceptor molecules as do most GSTs, members of the Lambda class (GSTLs) catalyse deglutathionylation reactions via a catalytic cysteine residue. Three GSTL genes (Pt-GSTL1, Pt-GSTL2 and Pt-GSTL3) are present in Populus trichocarpa, but two transcripts, differing in their 5' extremities, were identified for Pt-GSTL3. Transcripts for these genes were primarily found in flowers, fruits, petioles and buds, but not in leaves and roots, suggesting roles associated with secondary metabolism in these organs. The expression of GFP-fusion proteins in tobacco showed that Pt-GSTL1 is localized in plastids, whereas Pt-GSTL2 and Pt-GSTL3A and Pt-GSTL3B are found in both the cytoplasm and the nucleus. The resolution of Pt-GSTL1 and Pt-GSTL3 structures by X-ray crystallography indicated that, although these proteins adopt a canonical GST fold quite similar to that found in dimeric Omega GSTs, their non-plant counterparts, they are strictly monomeric. This might explain some differences in the enzymatic properties of both enzyme types. Finally, from competition experiments between aromatic substrates and a fluorescent probe, we determined that the recognition of glutathionylated substrates is favoured over non-glutathionylated forms.

  16. Overexpression of PtrMYB119, a R2R3-MYB transcription factor from Populus trichocarpa, promotes anthocyanin production in hybrid poplar.

    Science.gov (United States)

    Cho, Jin-Seong; Nguyen, Van Phap; Jeon, Hyung-Woo; Kim, Min-Ha; Eom, Seok Hyun; Lim, You Jin; Kim, Won-Chan; Park, Eung-Jun; Choi, Young-Im; Ko, Jae-Heung

    2016-09-01

    Anthocyanins are a group of colorful and bioactive natural pigments with important physiological and ecological functions in plants. We found an MYB transcription factor (PtrMYB119) from Populus trichocarpa that positively regulates anthocyanin production when expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis Amino acid sequence analysis revealed that PtrMYB119 is highly homologous to Arabidopsis PAP1 (PRODUCTION OF ANTHOCYANIN PIGMENT1), a well-known transcriptional activator of anthocyanin biosynthesis. Independently produced transgenic poplars overexpressing PtrMYB119 or PtrMYB120 (a paralogous gene to PtrMYB119) (i.e., 35S::PtrMYB119 and 35S::PtrMYB120, respectively) showed elevated accumulation of anthocyanins in the whole plants, including leaf, stem and even root tissues. Using a reverse-phase high-performance liquid chromatography, we confirmed that the majority of the accumulated anthocyanin in our transgenic poplar is cyanidin-3-O-glucoside. Gene expression analyses revealed that most of the genes involved in the anthocyanin biosynthetic pathway were highly upregulated in 35S::PtrMYB119 poplars compared with the nontransformed control poplar. Among these genes, expression of PtrCHS1 (Chalcone Synthase1) and PtrANS2 (Anthocyanin Synthase2), which catalyze the initial and last steps of anthocyanin biosynthesis, respectively, was upregulated by up to 350-fold. Subsequent transient activation assays confirmed that PtrMYB119 activated the transcription of both PtrCHS1 and PtrANS2 Interestingly, expression of MYB182, a repressor of both anthocyanin and proanthocyanidin (PA) biosynthesis, was largely suppressed in 35S::PtrMYB119 poplars, while expression of MYB134, an activator of PA biosynthesis, was not changed significantly. More interestingly, high-level accumulation of anthocyanins in 35S::PtrMYB119 poplars did not have an adverse effect on plant growth. Taken together, our results demonstrate that PtrMYB119 and PtrMYB120

  17. The influence of alternative plant propagation and stand establishment techniques on survival and growth of eastern cottonwood (Populus deltoides Bartr.) clones.

    Energy Technology Data Exchange (ETDEWEB)

    Kaczmarek, Donald J.; et. al.,

    2014-02-09

    Four eastern cottonwood clones, including standard operational clone ST66 and three advanced clonal selections were produced and included in a test utilizing five different plant propagation methods. Despite relatively large first-year growth differences among clones, all clones demonstrated similar responses to the treatments and clone 9 cutting treatment interactions were generally non-significant. The effects of changing cutting lengths are consistent with previous studies which indicated the potential for increased plant survival and growth with increased cutting lengths. Differences in stored carbohydrate reserves alone do not appear to completely control first-year growth and development of cuttings. First-year growth of 51 cm long cuttings planted 30.5 cm deep was greater than the same cuttings planted 48 cm deep. Stem form of plants derived from whip-tip propagation did not differ from plants derived from standard, unrooted cuttings. This propagation method offers the potential of far greater production capacity from a cutting orchard and rapid bulk-up of new or limited clones. Stand uniformity assessments suggest that surviving trees of each individual cutting treatment exhibit similar levels of growth variation. Optimization of plantation establishment techniques has the potential to increase growth of young Populus plantations.

  18. 杨树环化酶基因组织表达模式和蛋白定位%Gene Expression Pattern and Subcellular Localization of Populus Trichocarpa Cyclase

    Institute of Scientific and Technical Information of China (English)

    贾志刚; 夏德安; 李淑娟

    2016-01-01

    Semi-quantitative RT-PCR analysis showed thatPotri.006G237100 gene transcripts are very low in cambium, young leaf and apical bud ofPopulus trichocarpa, but high in xylem, petiole and root. Also, high abundance ofPotri.006G237100 gene transcripts was detected in lignifying stems. These data suggest thatPotri.006G237100 gene is speciifcally and abundantly expressed in the lignifying tissues ofP. trichocarpa. In addition, the DNA fragement ofPotri.006G237100gene was constructed into plant expression vector pGWB5 and transformed into Arabidopsis plant. Five transgenic plants were attained through molecular identiifcation. Confocal laser scanning microscope analysis suggested that Potri.006G237100-GFP fusion protein is located in the cytoplasm of transgenic plants.%半定量RT-PCR显示,毛果杨形成层、幼叶和顶芽中的Potri.006G237100转录产物极低,但在木质部、叶柄和根中其转录水平却较髙,在木质化茎节其转录产物也呈现高丰度积累,这表明Potri.006G237100在毛果杨木质化组织中特异地、高丰度转录表达。实验构建pGWB5-Potri.006G237100载体,转化拟南芥、分子鉴定得到5个过量表达转基因植株,激光共聚焦分析显示融合蛋白Potri.006G237100-GFP定位在转基因植株的细胞质。

  19. Genetic improvement and evaluation of black cottonwood for short- rotation biomass production. Final report, 1987--1992

    Energy Technology Data Exchange (ETDEWEB)

    Stettler, R.F.; Hinckley, T.M. [Washington Univ., Seattle, WA (United States). Coll. of Forest Resources; Heilman, P.E. [Washington State Univ., Puyallup, WA (United States). Research and Extension Center; Bradshaw, H.D. Jr. [Washington Univ., Seattle, WA (United States). Dept. of Biochemistry

    1993-04-30

    This project was initiated in 1978 to serve three objectives: (1) develop genetically improved poplar cultivars offering increased productivity under short-rotation culture; (2) identify the major components of productivity in poplar and determine ways in which they can be manipulated, genetically and culturally; and (3) engage in technology transfer to regional industry and agencies so as to make poplar culture in the Pacific Northwest economically feasible. The project is aimed at capturing natural variation in the native black cottonwood. Populus trichocarpa T & G, and enhancing it through selective breeding. Major emphasis has been placed on hybridization of black cottonwood with P deltoides and P maximowiczii, more recently with p nigra. First-generation (F{sub 1}) hybrids have consistently outperformed black cottonwood by a factor of 1.5.-2. The high yields of woody biomass obtained from these clonally propagated hybrids, in rotations of 4-7 years, have fostered the establishment of large-scale plantations by the pulp and paper industry in the region. Physiological studies have helped to elucidate hybrid superiority and several of the underlying mechanisms.

  20. Genetic Variation Among Open-Pollinated Progeny of Eastern Cottonwood

    Science.gov (United States)

    R. E. Farmer

    1970-01-01

    Improvement programs in eastern cottonwood (Populus deltoides Bartr.) are most frequently designed to produce genetically superior clones for direct commercial use. This paper describes a progeny test to assess genetic variability on which selection might be based.

  1. Evaluating growth effects from an imidacloprid treatment in black willow and eastern cottonwood cuttings

    Science.gov (United States)

    Luciano de Sene Fernandes; Ray A. Souter; Theodor D. Leininger

    2015-01-01

    Black willow (Salix nigra Marsh.) and eastern cottonwood (Populus deltoides Bartram ex Marsh.), two species native in the Lower Mississippi Alluvial Valley, have importance in short rotation woody crop (SRWC) systems for biomass production (Ruark 2006).

  2. Growing cottonwoods for biomass: results of a ten-year irrigation study

    Science.gov (United States)

    H. Christoph Stuhlinger; Paul F. Doruska; Jeffery A. Earl; Matthew H. Pelkki

    2010-01-01

    Eastern cottonwood (Populus deltoides Bartr.) has potential as a short rotation alternate crop on marginal farmlands in the South to meet increasing biomass demands for pulp and bioenergy applications. Potlatch Corporation supported this study to investigate the effect of irrigation on the growth of cottonwood trees. The study was installed in the...

  3. Assessment of Populus wood chemistry following the introduction of a Bt toxin gene

    Energy Technology Data Exchange (ETDEWEB)

    Tschaplinski, Timothy J [ORNL; Davis, M F [National Energy Renewable Laboratory; Tuskan, Gerald A [ORNL; Payne, M M [Boise Cascade LLC; Meilan, R [Purdue University

    2006-01-01

    Unintended changes in plant physiology, anatomy and metabolism as a result of genetic engineering are a concern as more transgenic plants are commercially deployed in the ecosystem. We compared the cell wall chemical composition of three Populus lines (Populus trichocarpa Torr. & A. Gray x Populus trichocarpa Bartr. ex Marsh., Populus trichocarpa x Populus nigra L. and Populus deltoides x Populus nigra) genetically modified to express the Cry3A or Cry3B2 protein of Bacillus thuringiensis (Bt) with the cell wall chemistry of non-transformed isogenic control lines. Three genetically modified clones, each represented by 10 independent transgenic lines, were analyzed by pyrolysis molecular beam mass spectrometry, gas chromatography/mass spectrometry and traditional wet chemical analytical methods to assess changes in cell wall composition. Based on the outcome of these techniques, there were no comprehensive differences in chemical composition between the transgenic and control lines for any of the studied clones.

  4. Bioinformatics Analysis of 4-hydroxy-3-methyl-2- buten1yl diphosphate synthase (HDS) in Populus trichocarpa%毛果杨1-羟基-2-甲基-2-(E)-丁烯基-4-二磷酸合酶(HDS)基因的生物信息学分析

    Institute of Scientific and Technical Information of China (English)

    刘立辉; 李成浩; 杨静莉; 夏德安

    2012-01-01

    [目的]研究HDS基因间的同源性及其进化关系.[方法]以毛果杨的HDS基因为研究对象,利用生物信息学软件及网站对其进行碱基分布、氨基酸组成、亲疏水性、保守区以及二级结构和三级结构的预测与分析.,并与其他10个物种的HDS基因序列进行多重比对与进化分析.[结果]毛果杨HDS基因的单链mRNA序列长1 956 bp,编码由656个氨基酸组成的蛋白质,该蛋白质相对分子质量为72 937.03,其中含量最高的是Leu,为10.50%;整个多肽中疏水性氨基酸只占39.63%,有10个亲水区和6个疏水区;与其他10个物种同源性多重比对发现同源性最高达99%.[结论]毛果杨HDS基因处于稳定状态,编码的蛋白为亲水性蛋白,在进化过程中是保守的;试验中获得的保守区段序列信息为新基因的克隆奠定了基础.%[ Objective] The aim was to study the homology and evolutionary relationship among HAD genes. [ Method] Based on HDS gene of Populus trichocarpa, bioinformatics software and website were used to predict and analyze base distribution, amino acids composition, hydrophil-city or hydrophobicity, hyperconservative region, secondary structure, and three-level structure. The results were used to compare with HDS gene sequences of other ten species and related evolution analysis was followed. [ Result ] mRNA, single chain of HDS gene of Populus trichocarpa , was 1 956 bp in length, code was made up of proteins containing amino acids of 656, and relative molecular mass of protein was 72 937.03 with Leu of 10. 50% involume; in polypeptide, hydrophobic amino acid was only of 39.63% with hydrophilc region of 10 and hy-drophobic region of 6; after many comparisons with other ten species, homology was found as high as 99%. [ Conclusion ] HDS gene of Populus trichocarpa was quite stable and coded albumen was hydrophilic protein which was quite conservative in evolution; sequence information in conservative region gained in the

  5. Eastern cottonwood clonal mixing study: intergenotypic competition effects

    Science.gov (United States)

    G. Sam Foster; R.J. Rousseau; W.L Nance

    1998-01-01

    Intergenotypic competition of seven clones of eastern cottonwood (Populus deltoides) was evaluated in a replacement series experiment. A partial diallel competition design was used to choose pairs (binary sets) of clones for plot type treatments. Two separate treatments were established for each pair of clones, namely (1) 75 percent clone A: 25 percent clone B and (2)...

  6. Assessment of Populus Wood Chemistry Following the Introduction of a Bt Toxin Gene

    Energy Technology Data Exchange (ETDEWEB)

    Davis, M. F.; Tuskan, G. A.; Payne, P.; Tschaplinski, T. J.; Meilan, R.

    2006-01-01

    Unintended changes in plant physiology, anatomy and metabolism as a result of genetic engineering are a concern as more transgenic plants are commercially deployed in the ecosystem. We compared the cell wall chemical composition of three Populus lines (Populus trichocarpa Torr. and A. Gray x Populus deltoides Bartr. ex Marsh., Populus trichocarpa x Populus nigra L. and Populus deltoides x Populus nigra) genetically modified to express the Cry3A or Cry3B2 protein of Bacillus thuringiensis (Bt) with the cellwall chemistry of non-transformed isogenic control lines. Three genetically modified clones, each represented by 10 independent transgenic lines, were analyzed by pyrolysis molecular beam mass spectrometry, gas chromatography/mass spectrometry and traditional wet chemical analytical methods to assess changes in cell wall composition. Based on the outcome of these techniques, there were no comprehensive differences in chemical composition between the transgenic and control lines for any of the studied clones.

  7. Intron-mediated alternative splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B regulates cell wall thickening during fiber development in Populus species.

    Science.gov (United States)

    Zhao, Yunjun; Sun, Jiayan; Xu, Peng; Zhang, Rui; Li, Laigeng

    2014-02-01

    Alternative splicing is an important mechanism involved in regulating the development of multicellular organisms. Although many genes in plants undergo alternative splicing, little is understood of its significance in regulating plant growth and development. In this study, alternative splicing of black cottonwood (Populus trichocarpa) wood-associated NAC domain transcription factor (PtrWNDs), PtrWND1B, is shown to occur exclusively in secondary xylem fiber cells. PtrWND1B is expressed with a normal short-transcript PtrWND1B-s as well as its alternative long-transcript PtrWND1B-l. The intron 2 structure of the PtrWND1B gene was identified as a critical sequence that causes PtrWND1B alternative splicing. Suppression of PtrWND1B expression specifically inhibited fiber cell wall thickening. The two PtrWND1B isoforms play antagonistic roles in regulating cell wall thickening during fiber cell differentiation in Populus spp. PtrWND1B-s overexpression enhanced fiber cell wall thickening, while overexpression of PtrWND1B-l repressed fiber cell wall thickening. Alternative splicing may enable more specific regulation of processes such as fiber cell wall thickening during wood formation.

  8. Epigenomics of Development in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, Steve; Freitag, Michael; Mockler, Todd

    2013-01-10

    We conducted research to determine the role of epigenetic modifications during tree development using poplar (Populus trichocarpa), a model woody feedstock species. Using methylated DNA immunoprecipitation (MeDIP) or chromatin immunoprecipitation (ChIP), followed by high-throughput sequencing, we are analyzed DNA and histone methylation patterns in the P. trichocarpa genome in relation to four biological processes: bud dormancy and release, mature organ maintenance, in vitro organogenesis, and methylation suppression. Our project is now completed. We have 1) produced 22 transgenic events for a gene involved in DNA methylation suppression and studied its phenotypic consequences; 2) completed sequencing of methylated DNA from eleven target tissues in wildtype P. trichocarpa; 3) updated our customized poplar genome browser using the open-source software tools (2.13) and (V2.2) of the P. trichocarpa genome; 4) produced summary data for genome methylation in P. trichocarpa, including distribution of methylation across chromosomes and in and around genes; 5) employed bioinformatic and statistical methods to analyze differences in methylation patterns among tissue types; and 6) used bisulfite sequencing of selected target genes to confirm bioinformatics and sequencing results, and gain a higher-resolution view of methylation at selected genes 7) compared methylation patterns to expression using available microarray data. Our main findings of biological significance are the identification of extensive regions of the genome that display developmental variation in DNA methylation; highly distinctive gene-associated methylation profiles in reproductive tissues, particularly male catkins; a strong whole genome/all tissue inverse association of methylation at gene bodies and promoters with gene expression; a lack of evidence that tissue specificity of gene expression is associated with gene methylation; and evidence that genome methylation is a significant impediment to tissue

  9. Mixed, short rotation culture of red alder and black cottonwood: growth, coppicing, nitrogen fixation, and allelopathy

    Energy Technology Data Exchange (ETDEWEB)

    Heilman, P.; Stettler, R.F.

    1985-01-01

    Alnus rubra seedlings were grown in a 1:1 mixture at a spacing of 1.2 x 1.2 m with 28 Populus clones (25 clones pf P. trichocarpa, 2 of P. deltoides x P. trichocarpa, and one P. deltoides x P. nigra) in a study established in W. Washington in March 1979. Trees were harvested at 4 yr old. At harvest, average heights were: pure Populus, 10.2 m; Populus in the mixed stand 11.0 m; and alder 8.4 m. Most Populus sprouted satisfactorily after harvest (6.6 shoots/plant when pure, 7.6 shoots/plant in the mixture), but alder sprouted poorly (3.6 shoots/plant). Above-ground biomass at harvest was 15.9 t/ha p.a. for the mixture and 16.7 t/ha p.a. for pure Populus, although the mixture had been more productive at 2 yr. Nitrogenase activity (nitrogen fixation as measured by acetylene reduction) of alder declines in the 4th season; competition was the most important factor influencing this decline. Soil N content had no effect on fixation. A pot study showed that ground Populus leaf and litter material inhibited the growth of red alder seedlings, although soil collected from Populus plots had no effect. Results indicated that allelopathy is probably a minor factor under field conditions, at most, and that growing mixed stands may, on balance, be beneficial. 20 references.

  10. Cottonwood management at Theodore Roosevelt National Park, North Dakota

    Science.gov (United States)

    Friedman, Jonathan M.; Griffin, Eleanor R.

    2017-01-01

    This data release consists of the following components:Sex ratio data from cottonwood trees at random points on the floodplain in the North and South units of Theodore Roosevelt National Park, ND. These data were used to investigate the effects of age, height above, and distance from the channel on mortality of male and female trees of plains cottonwood (Populus deltoides subsp. monilifera) as described in the Friedman and Griffin (2017) report.Tree core and tree ring data from the North and South Units of Theodore Roosevelt National Park, North Dakota. South Unit data was collected in April 2012, North Unit data was collected in the summer and fall of 2010. The trees are located on the floodplain of the Little Missouri River in Theodore Roosevelt National Park. These data were used to reconstruct flow and climate as described in the Friedman and Griffin (2017) report and in other documents cited by that report. The tree ring data is presented in Standard Tucson format.Floodplain and riparian cottonwood forest areas in the South Unit were digitized as separate shapefiles using 2010 NAIP imagery. They were mapped to assist management of cottonwood forests by increasing understanding of the relation between geomorphic setting, flow, precipitation, temperature, and other factors.Edges of water, channel centerline, valley bottom centerline, extent of valley bottom, and estimated bankfull channel data for the Little Missouri River in the North and South Units were mapped as separate shapefiles from 2010 NAIP imagery as well.

  11. Increasing the productivity of short-rotation Populus plantations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    DeBell, D.S.; Harrington, C.A.; Clendenen, G.W.; Radwan, M.A.; Zasada, J.C. [Forest Service, Olympia, WA (United States). Pacific Northwest Research Station

    1997-12-31

    This final report represents the culmination of eight years of biological research devoted to increasing the productivity of short rotation plantations of Populus trichocarpa and Populus hybrids in the Pacific Northwest. Studies provide an understanding of tree growth, stand development and biomass yield at various spacings, and how patterns differ by Populus clone in monoclonal and polyclonal plantings. Also included is some information about factors related to wind damage in Populus plantings, use of leaf size as a predictor of growth potential, and approaches for estimating tree and stand biomass and biomass growth. Seven research papers are included which provide detailed methods, results, and interpretations on these topics.

  12. Comparative analysis of the transcriptomes of Populus

    Energy Technology Data Exchange (ETDEWEB)

    Tuskan, Gerald A [ORNL; Davis, John M [University of Florida

    2008-01-01

    Sequencing of the Populus trichocarpa genome creates an opportunity to describe the transcriptome of a woody perennial species and establish an atlas of gene expression. A comparison with the transcriptomes of other species can also define genes that are conserved or diverging in plant species. Here, the transcriptome in vegetative organs of the P. trichocarpa reference genotype Nisqually-1 was characterized. A comparison with Arabidopsis thaliana orthologs was used to distinguish gene functional categories that may be evolving differently in a woody perennial and an annual herbaceous species. A core set of genes expressed in common among vegetative organs was detected, as well as organ-specific genes. Statistical tests identified chromatin domains, where adjacent genes were expressed more frequently than expected by chance. Extensive divergence was detected in the expression patterns of A. thaliana and P. trichocarpa orthologs, but transcription of a small number of genes appeared to have remained conserved in the two species. Despite separation of lineages for over 100 million yr, these results suggest that selection has limited transcriptional divergence of genes associated with some essential functions in A. thaliana and P. trichocarpa. However, extensive remodeling of transcriptional networks indicates that expression regulation may be a key determinant of plant diversity.

  13. Geographic origin of cottonwood from the southeast affects Melampsora infection in 3-year-old clonal trials

    Science.gov (United States)

    Samuel B. Land; Jonathan Paul Jeffreys

    2006-01-01

    Open-pollinated seeds were collected separately by mother tree from several trees in each of 64 natural stands of eastern cottonwood (Populus deltoides J. Bartram ex Marsh. var. deltoides) in the Southeastern United States. Rooted cuttings from the seedlings were grown at four sites (North Carolina, Florida, Alabama, and Missouri...

  14. Protease gene families in Populus and Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jansson Stefan

    2006-12-01

    Full Text Available Abstract Background Proteases play key roles in plants, maintaining strict protein quality control and degrading specific sets of proteins in response to diverse environmental and developmental stimuli. Similarities and differences between the proteases expressed in different species may give valuable insights into their physiological roles and evolution. Results We have performed a comparative analysis of protease genes in the two sequenced dicot genomes, Arabidopsis thaliana and Populus trichocarpa by using genes coding for proteases in the MEROPS database 1 for Arabidopsis to identify homologous sequences in Populus. A multigene-based phylogenetic analysis was performed. Most protease families were found to be larger in Populus than in Arabidopsis, reflecting recent genome duplication. Detailed studies on e.g. the DegP, Clp, FtsH, Lon, rhomboid and papain-Like protease families showed the pattern of gene family expansion and gene loss was complex. We finally show that different Populus tissues express unique suites of protease genes and that the mRNA levels of different classes of proteases change along a developmental gradient. Conclusion Recent gene family expansion and contractions have made the Arabidopsis and Populus complements of proteases different and this, together with expression patterns, gives indications about the roles of the individual gene products or groups of proteases.

  15. UPTAKE AND TRANSFORMATION OF EXPLOSIVES BY EASTERN COTTONWOOD (POPULUS DELTOIDES)

    Science.gov (United States)

    The explosives 2,4,6-trinitrotoluene (TNT), hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX), and octahydro-1,3,5,7-tetranitro-1,3,5,7-tetraazocine (HMX) have been extensively used by the United States military to manufacture munitions. Since World War II, both the commissioning an...

  16. Identification and Characterization of the Populus AREB/ABF Subfamily

    Institute of Scientific and Technical Information of China (English)

    Lexiang Ji; Jia Wang; Meixia Ye; Ying Li; Bin Guo; Zhong Chen; Hao Li; Xinmin An

    2013-01-01

    Abscisic acid (ABA) is a major plant hormone that plays an important role in responses to abiotic stresses.The ABA-responsive element binding proteinlABRE-binding factor (AREB/ABF) gene subfamily contains crucial transcription factors in the ABA-mediated signaling pathway.In this study,a total of 14 putative AREB/ABF members were identified in the Populus trichocarpa Torr.& Gray.genome using five AREB/ABF amino acid sequences from Arabidopsis thaliana L.as probes.The 14 putative Populus subfamily members showed high protein similarities,especially in the basic leucine zipper (bZlP) domain region.A neighbor-joining analysis combined with gene structure data revealed homology among the 14 genes.The expression patterns of the Populus AREB/ABF subfamily suggested that the most abundant transcripts of 11 genes occurred in leaf tissues,while two genes were most transcribed in root tissues.Significantly,eight Populus AREB/ABF gene members were upregulated after treatment with 100 μM exogenous ABA,while the other six members were downregulated.We identified the expression profiles of the subfamily members in Populus tissues and elucidated different response patterns of Populus AREB/ABF members to ABA stress.This study provided insight into the roles of Populus AREB/ABF homologues in plant response to abiotic stresses.

  17. Characterization of MORE AXILLARY GROWTH genes in Populus.

    Directory of Open Access Journals (Sweden)

    Olaf Czarnecki

    Full Text Available Strigolactones are a new class of plant hormones that play a key role in regulating shoot branching. Studies of branching mutants in Arabidopsis, pea, rice and petunia have identified several key genes involved in strigolactone biosynthesis or signaling pathway. In the model plant Arabidopsis, MORE AXILLARY GROWTH1 (MAX1, MAX2, MAX3 and MAX4 are four founding members of strigolactone pathway genes. However, little is known about the strigolactone pathway genes in the woody perennial plants.Here we report the identification of MAX homologues in the woody model plant Populus trichocarpa. We identified the sequence homologues for each MAX protein in P. trichocarpa. Gene expression analysis revealed that Populus MAX paralogous genes are differentially expressed across various tissues and organs. Furthermore, we showed that Populus MAX genes could complement or partially complement the shoot branching phenotypes of the corresponding Arabidopsis max mutants.This study provides genetic evidence that strigolactone pathway genes are likely conserved in the woody perennial plants and lays a foundation for further characterization of strigolactone pathway and its functions in the woody perennial plants.

  18. Weed Control Trials in Cottonwood Plantations

    Science.gov (United States)

    R. M. Krinard

    1964-01-01

    Weed control in the first year is essential for establishing a cottonwood plantation, for the young trees can neither survive nor grow well if they must compete with other plants. Once the light and moisture conditions are established in its favor, cottonwood becomes the fastest growing tree in the South.

  19. Plains cottonwood's last stand: can it survive invasion of Russian olive onto the Milk River, Montana floodplain?

    Science.gov (United States)

    Pearce, C M; Smith, D G

    2001-11-01

    Russian olive (Elaeagnus angustifolia L.) was introduced in 1950 onto one site on the Milk River floodplain, northern Montana, 10 km downstream from the Canada/United States border. To analyze dispersal of Russian olive from the point source between 1950 and 1999, we compared distribution, numbers, size structure, and mortality of Russian olive and plains cottonwood (Populus deltoides Marsh:) on an unregulated reach of the Milk River floodplain in southeastern Alberta and north-central Montana. Within 50 years, Russian olive in this reach has moved upriver into Alberta and downriver to the Fresno Reservoir. It is now present on 69 of the 74 meander lobes sampled, comprising 34%, 62%, and 61% of all Russian olive and plains cottonwood seedlings, saplings, and trees, respectively. On some meander lobes, Russian olive has colonized similar elevations on the floodplain as plains cottonwood and is oriented in rows paralleling the river channel, suggesting that recruitment may be related to river processes. Breakup ice had killed 400 Russian olive saplings and trees and damaged >1000 others on 30 of the meander lobes in 1996. Nevertheless, Russian olive now outnumbers cottonwood on many sites on the Milk River floodplain because its seeds can be dispersed by wildlife (particularly birds) and probably by flood water and ice rafts; seeds are viable for up to 3 years and germination can take place on bare and well-vegetated soils; and saplings and trees are less palatable to livestock and beaver than plains cottonwood. Without control, Russian olive could be locally dominant on the Milk River floodplain in all age classes within 10 years and replace plains cottonwood within this century.

  20. Cavity turnover and equilibrium cavity densities in a cottonwood bottomland

    Science.gov (United States)

    Sedgwick, James A.; Knopf, Fritz L.

    1992-01-01

    A fundamental factor regulating the numbers of secondary cavity nesting (SCN) birds is the number of extant cavities available for nesting. The number of available cavities may be thought of as being in an approximate equilibrium maintained by a very rough balance between recruitment and loss of cavities. Based on estimates of cavity recruitment and loss, we ascertained equilibrium cavity densities in a mature plains cottonwood (Populus sargentii) bottomland along the South Platte River in northeastern Colorado. Annual cavity recruitment, derived from density estimates of primary cavity nesting (PCN) birds and cavity excavation rates, was estimated to be 71-86 new cavities excavated/100 ha. Of 180 active cavities of 11 species of cavity-nesting birds found in 1985 and 1986, 83 were no longer usable by 1990, giving an average instantaneous rate of cavity loss of r = -0.230. From these values of cavity recruitment and cavity loss, equilibrium cavity density along the South Platte is 238-289 cavities/100 ha. This range of equilibrium cavity density is only slightly above the minimum of 205 cavities/100 ha required by SCN's and suggests that cavity availability may be limiting SCN densities along the South Platte River. We submit that snag management alone does not adequately address SCN habitat needs, and that cavity management, expressed in terms of cavity turnover and cavity densities, may be more useful.

  1. Evaluation of a novel promoter from Populus trichocarpa for mature xylem tissue specific gene delivery.

    Science.gov (United States)

    Nguyen, Van Phap; Cho, Jin-Seong; Choi, Young-Im; Lee, Sang-Won; Han, Kyung-Hwan; Ko, Jae-Heung

    2016-07-01

    Wood (i.e., secondary xylem) is an important raw material for many industrial applications. Mature xylem (MX) tissue-specific genetic modification offers an effective means to improve the chemical and physical properties of the wood. Here, we describe a promoter that drives strong gene expression in a MX tissue-specific manner. Using whole-transcriptome genechip analyses of different tissue types of poplar, we identified five candidate genes that had strong expression in the MX tissue. The putative promoter sequences of the five MX-specific genes were evaluated for their promoter activity in both transgenic Arabidopsis and poplar. Among them, we found the promoter of Potri.013G007900.1 (called the PtrMX3 promoter) had the strongest activity in MX and thus was further characterized. In the stem and root tissues of transgenic Arabidopsis plants, the PtrMX3 promoter activity was found exclusively in MX tissue. MX-specific activity of the promoter was reproduced in the stem tissue of transgenic poplar plants. The PtrMX3 promoter activity was not influenced by abiotic stresses or exogenously applied growth regulators, indicating the PtrMX3 promoter is bona fide MX tissue-specific. Our study provides a strong MX-specific promoter for MX-specific modifications of woody biomass.

  2. Variable Nitrogen Fixation in Wild Populus.

    Directory of Open Access Journals (Sweden)

    Sharon L Doty

    Full Text Available The microbiome of plants is diverse, and like that of animals, is important for overall health and nutrient acquisition. In legumes and actinorhizal plants, a portion of essential nitrogen (N is obtained through symbiosis with nodule-inhabiting, N2-fixing microorganisms. However, a variety of non-nodulating plant species can also thrive in natural, low-N settings. Some of these species may rely on endophytes, microorganisms that live within plants, to fix N2 gas into usable forms. Here we report the first direct evidence of N2 fixation in the early successional wild tree, Populus trichocarpa, a non-leguminous tree, from its native riparian habitat. In order to measure N2 fixation, surface-sterilized cuttings of wild poplar were assayed using both 15N2 incorporation and the commonly used acetylene reduction assay. The 15N label was incorporated at high levels in a subset of cuttings, suggesting a high level of N-fixation. Similarly, acetylene was reduced to ethylene in some samples. The microbiota of the cuttings was highly variable, both in numbers of cultured bacteria and in genetic diversity. Our results indicated that associative N2-fixation occurred within wild poplar and that a non-uniformity in the distribution of endophytic bacteria may explain the variability in N-fixation activity. These results point to the need for molecular studies to decipher the required microbial consortia and conditions for effective endophytic N2-fixation in trees.

  3. Elements in cottonwood trees as an indicator of ground water contaminated by landfill leachate

    Science.gov (United States)

    Erdman, James A.; Christenson, Scott

    2000-01-01

    Ground water at the Norman Landfill Research Site is contaminated by a leachate plume emanating from a closed, unlined landfill formerly operated by the city of Norman, Oklahoma, Ground water contaminated by the leachate plume is known to be elevated in the concentration of many, organic and inorganic constituents. Specific conductance, alkalinity, chloride, dissolved organic carbon, boron, sodium, strontium, and deuterium in ground water are considered to be indicators of the leachate plume at this site. Leaf samples of broad-leafed cottonwood, Populus deltoides, were collected from 57 sites around the closed landfill. Cottonwood, a phreatophyte or “well plant,” functions as a & surrogate well and serves as a ground water quality sampler. The leaf samples were combusted to ash and analyzed by instrumental neutron activation for 35 elements and by prompt-gamma instrumental neutron activation, for boron. A monitoring well was located within a few meters of a sampled cottonwood tree at 15 of the 57 sites, and ground water samples were collected from these monitoring wells simultaneously with a leaf sample. The chemical analyses of the ground water and leaf samples from these 15 sites indicated that boron, bromine, sodium, and strontium concentrations in leaves were significantly correlated with leachate indicator constituents in ground water. A point-plot map of selected percentiles indicated high concentrations of boron, bromine, and sodium in leaf ash from sites downgradient of the most recent landfill and from older landfills nearby. Data from leaf analysis greatly extended the known areal extent of the leachate plume previously determined from a network of monitoring wells and geophysical surveys. This phytosgeochemical study provided a cost-effective method for assessing the extent of a leachate plume from an old landfill. Such a method may be useful as a preliminary sampling tool to guide the design of hydrogeochemical and geophysical studies.

  4. Protein (Viridiplantae): 224129758 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available predicted protein Populus trichocarpa MAKEMPAMKRALCEWMIVEEFPSWFKADNEWKAELCRLCNLESTEDLELGWRDMVNKFELVWKGEPRKKYKKPRPKVRVGLPKKICQYFDDRIGREENEVIVVLGSRGDSFCLALRFLNSNWVQKPGKHNQGQQQKLK ...

  5. Protein (Viridiplantae): 224138986 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available icted protein Populus trichocarpa MALDIKTFETIIPSCFLSFTIPNPVLPTHLLRVAVLDSSIQFTESPQIATLLVSQTREPDWIFSTESGHLQLLLSSPEISQLILIGNNRINGSDSSLLTYHKRDNTQYVKSLENSLKPLFFALSPKVSVKDGIFDCSVLDDALIHLH ...

  6. Genome anchored QTLs for biomass productivity in hybrid Populus grown under contrasting environments.

    Directory of Open Access Journals (Sweden)

    Wellington Muchero

    Full Text Available Traits related to biomass production were analyzed for the presence of quantitative trait loci (QTLs in a Populus trichocarpa × P. deltoides F(2 population. A genetic linkage map composed of 841 SSR, AFLP, and RAPD markers and phenotypic data from 310 progeny were used to identify genomic regions harboring biomass QTLs. Twelve intervals were identified, of which BM-1, BM-2, and BM-7 were identified in all three years for both height and diameter. One putative QTL, BM-7, and one suggestive QTL exhibited significant evidence of over-dominance in all three years for both traits. Conversely, QTLs BM-4 and BM-6 exhibited evidence of under-dominance in both environments for height and diameter. Seven of the nine QTLs were successfully anchored, and QTL peak positions were estimated for each one on the P. trichocarpa genome assembly using flanking SSR markers with known physical positions. Of the 3,031 genes located in genome-anchored QTL intervals, 1,892 had PFAM annotations. Of these, 1,313, representing 255 unique annotations, had at least one duplicate copy in a QTL interval identified on a separate scaffold. This observation suggests that some QTLs identified in this study may have shared the same ancestral sequence prior to the salicoid genome duplication in Populus.

  7. Nucleotide diversity among natural populations of a North American poplar (Populus balsamifera, Salicaceae).

    Science.gov (United States)

    Breen, Amy L; Glenn, Elise; Yeager, Adam; Olson, Matthew S

    2009-01-01

    Poplars (Populus spp.) comprise an important component of circumpolar boreal forest ecosystems and are the model species for tree genomics. In this study, we surveyed genetic variation and population differentiation in three nuclear genes among populations of balsam poplar (Populus balsamifera) in North America. We examined nucleotide sequence variation in alcohol dehydrogenase 1 (Adh1) and glyceraldehyde 3-phosphate dehydrogenase (G3pdh), two well-studied nuclear loci in plants, and abscisic acid insensitivity 1B (ABI1B), a locus coincident with timing of seasonal dormancy in quantitative trait locus (QTL) studies of hybrid poplars. We compared estimates of baseline population genetic parameters for these loci with those obtained in studies of other poplar species, particularly European aspen (Populus tremula). Average pairwise nucleotide diversity (pi(tot) = 0.00216-0.00353) was equivalent to that in Populus trichocarpa, but markedly less than that in P. tremula. Elevated levels of population structure were observed in ABI1B between the northern and southern regions (F(CT) = 0.184, P boreal plant species.

  8. Identification of quantitative trait loci and candidate genes for cadmium tolerance in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Induri, Brahma R [West Virginia University; Ellis, Danielle R [West Virginia University; Slavov, Goncho T. [West Virginia University; Yin, Tongming [ORNL; Zhang, Xinye [ORNL; Tuskan, Gerald A [ORNL; DiFazio, Steven P [West Virginia University

    2012-01-01

    Understanding genetic variation for the response of Populus to heavy metals like cadmium (Cd) is an important step in elucidating the underlying mechanisms of tolerance. In this study, a pseudo-backcross pedigree of Populus trichocarpa Torr. & Gray and Populus deltoides Bart. was characterized for growth and performance traits after Cd exposure. A total of 16 quantitative trait loci (QTL) at logarithm of odds (LOD) ratio 2.5 were detected for total dry weight, its components and root volume. Major QTL for Cd responses were mapped to two different linkage groups and the relative allelic effects were in opposing directions on the two chromosomes, suggesting differential mechanisms at these two loci. The phenotypic variance explained by Cd QTL ranged from 5.9 to 11.6% and averaged 8.2% across all QTL. A whole-genome microarray study led to the identification of nine Cd-responsive genes from these QTL. Promising candidates for Cd tolerance include an NHL repeat membrane-spanning protein, a metal transporter and a putative transcription factor. Additional candidates in the QTL intervals include a putative homolog of a glutamate cysteine ligase, and a glutathione-S-transferase. Functional characterization of these candidate genes should enhance our understanding of Cd metabolism and transport and phytoremediation capabilities of Populus.

  9. The glutamine synthetase gene family in Populus

    Directory of Open Access Journals (Sweden)

    Cánovas Francisco M

    2011-08-01

    Full Text Available Abstract Background Glutamine synthetase (GS; EC: 6.3.1.2, L-glutamate: ammonia ligase ADP-forming is a key enzyme in ammonium assimilation and metabolism of higher plants. The current work was undertaken to develop a more comprehensive understanding of molecular and biochemical features of GS gene family in poplar, and to characterize the developmental regulation of GS expression in various tissues and at various times during the poplar perennial growth. Results The GS gene family consists of 8 different genes exhibiting all structural and regulatory elements consistent with their roles as functional genes. Our results indicate that the family members are organized in 4 groups of duplicated genes, 3 of which code for cytosolic GS isoforms (GS1 and 1 which codes for the choroplastic GS isoform (GS2. Our analysis shows that Populus trichocarpa is the first plant species in which it was observed the complete GS family duplicated. Detailed expression analyses have revealed specific spatial and seasonal patterns of GS expression in poplar. These data provide insights into the metabolic function of GS isoforms in poplar and pave the way for future functional studies. Conclusions Our data suggest that GS duplicates could have been retained in order to increase the amount of enzyme in a particular cell type. This possibility could contribute to the homeostasis of nitrogen metabolism in functions associated to changes in glutamine-derived metabolic products. The presence of duplicated GS genes in poplar could also contribute to diversification of the enzymatic properties for a particular GS isoform through the assembly of GS polypeptides into homo oligomeric and/or hetero oligomeric holoenzymes in specific cell types.

  10. Populus seed fibers as a natural source for production of oil super absorbents.

    Science.gov (United States)

    Likon, Marko; Remškar, Maja; Ducman, Vilma; Švegl, Franc

    2013-01-15

    The genus Populus, which includes poplars, cottonwoods and aspen trees, represents a huge natural source of fibers with exceptional physical properties. In this study, the oil absorption properties of poplar seed hair fibers obtained from Populus nigra italica when tested with high-density motor oil and diesel fuel are reported. Poplar seed hair fibers are hollow hydrophobic microtubes with an external diameter between 3 and 12 μm, an average length of 4±1 mm and average tube wall thickness of 400±100 nm. The solid skeleton of the hollow fibers consists of lignocellulosic material coated by a hydrophobic waxy coating. The exceptional chemical, physical and microstructural properties of poplar seed hair fibers enable super-absorbent behavior with high absorption capacity for heavy motor oil and diesel fuel. The absorption values of 182-211 g heavy oil/g fiber and 55-60 g heavy oil/g fiber for packing densities of 0.005 g/cm(3) and 0.02 g/cm(3), respectively, surpass all known natural absorbents. Thus, poplar seed hair fibers obtained from Populus nigra italica and other trees of the genus Populus are an extremely promising natural source for the production of oil super absorbents.

  11. Aldehyde Dehydrogenase Gene Superfamily in Populus: Organization and Expression Divergence between Paralogous Gene Pairs.

    Directory of Open Access Journals (Sweden)

    Feng-Xia Tian

    Full Text Available Aldehyde dehydrogenases (ALDHs constitute a superfamily of NAD(P+-dependent enzymes that catalyze the irreversible oxidation of a wide range of reactive aldehydes to their corresponding nontoxic carboxylic acids. ALDHs have been studied in many organisms from bacteria to mammals; however, no systematic analyses incorporating genome organization, gene structure, expression profiles, and cis-acting elements have been conducted in the model tree species Populus trichocarpa thus far. In this study, a comprehensive analysis of the Populus ALDH gene superfamily was performed. A total of 26 Populus ALDH genes were found to be distributed across 12 chromosomes. Genomic organization analysis indicated that purifying selection may have played a pivotal role in the retention and maintenance of PtALDH gene families. The exon-intron organizations of PtALDHs were highly conserved within the same family, suggesting that the members of the same family also may have conserved functionalities. Microarray data and qRT-PCR analysis indicated that most PtALDHs had distinct tissue-specific expression patterns. The specificity of cis-acting elements in the promoter regions of the PtALDHs and the divergence of expression patterns between nine paralogous PtALDH gene pairs suggested that gene duplications may have freed the duplicate genes from the functional constraints. The expression levels of some ALDHs were up- or down-regulated by various abiotic stresses, implying that the products of these genes may be involved in the adaptation of Populus to abiotic stresses. Overall, the data obtained from our investigation contribute to a better understanding of the complexity of the Populus ALDH gene superfamily and provide insights into the function and evolution of ALDH gene families in vascular plants.

  12. Identification of Quantitative Trait Loci (QTL) and Candidate Genes for Cadmium Tolerance in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Induri, Brahma R [West Virginia University; Ellis, Danielle R [West Virginia University; Slavov, Gancho [West Virginia University; Yin, Tongming [ORNL; Muchero, Wellington [ORNL; Tuskan, Gerald A [ORNL; DiFazio, Stephen P [West Virginia University

    2012-01-01

    Knowledge of genetic variation in response of Populus to heavy metals like cadmium (Cd) is an important step in understanding the underlying mechanisms of tolerance. In this study, a pseudo-backcross pedigree of Populus trichocarpa and Populus deltoides was characterized for Cd exposure. The pedigree showed significant variation for Cd tolerance thus enabling the identification of relatively tolerant and susceptible genotypes for intensive characterization. A total of 16 QTLs at logarithm of odds (LOD) ratio > 2.5, were found to be associated with total dry weight, its components, and root volume. Four major QTLs for total dry weight were mapped to different linkage groups in control (LG III) and Cd conditions (LG XVI) and had opposite allelic effects on Cd tolerance, suggesting that these genomic regions were differentially controlled. The phenotypic variation explained by Cd QTL for all traits under study varied from 5.9% to 11.6% and averaged 8.2% across all QTL. Leaf Cd contents also showed significant variation suggesting the phytoextraction potential of Populus genotypes, though heritability of this trait was low (0.22). A whole-genome microarray study was conducted by using two genotypes with extreme responses for Cd tolerance in the above study and differentially expressed genes were identified. Candidate genes including CAD2 (CADMIUM SENSITIVE 2), HMA5 (HEAVY METAL ATPase5), ATGTST1 (Arabidopsis thaliana Glutathione S-Transferase1), ATGPX6 (Glutathione peroxidase 6), and ATMRP 14 (Arabidopsis thaliana Multidrug Resistance associated Protein 14) were identified from QTL intervals and microarray study. Functional characterization of these candidate genes could enhance phytoremediation capabilities of Populus.

  13. Genome Sequences of Populus tremula Chloroplast and Mitochondrion: Implications for Holistic Poplar Breeding.

    Directory of Open Access Journals (Sweden)

    Birgit Kersten

    Full Text Available Complete Populus genome sequences are available for the nucleus (P. trichocarpa; section Tacamahaca and for chloroplasts (seven species, but not for mitochondria. Here, we provide the complete genome sequences of the chloroplast and the mitochondrion for the clones P. tremula W52 and P. tremula x P. alba 717-1B4 (section Populus. The organization of the chloroplast genomes of both Populus clones is described. A phylogenetic tree constructed from all available complete chloroplast DNA sequences of Populus was not congruent with the assignment of the related species to different Populus sections. In total, 3,024 variable nucleotide positions were identified among all compared Populus chloroplast DNA sequences. The 5-prime part of the LSC from trnH to atpA showed the highest frequency of variations. The variable positions included 163 positions with SNPs allowing for differentiating the two clones with P. tremula chloroplast genomes (W52, 717-1B4 from the other seven Populus individuals. These potential P. tremula-specific SNPs were displayed as a whole-plastome barcode on the P. tremula W52 chloroplast DNA sequence. Three of these SNPs and one InDel in the trnH-psbA linker were successfully validated by Sanger sequencing in an extended set of Populus individuals. The complete mitochondrial genome sequence of P. tremula is the first in the family of Salicaceae. The mitochondrial genomes of the two clones are 783,442 bp (W52 and 783,513 bp (717-1B4 in size, structurally very similar and organized as single circles. DNA sequence regions with high similarity to the W52 chloroplast sequence account for about 2% of the W52 mitochondrial genome. The mean SNP frequency was found to be nearly six fold higher in the chloroplast than in the mitochondrial genome when comparing 717-1B4 with W52. The availability of the genomic information of all three DNA-containing cell organelles will allow a holistic approach in poplar molecular breeding in the future.

  14. Cottonwood data collection protocol : Great Sand Dunes National Park : Elk/Bison grazing ecology study

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This protocol/SOP is from USGS to estimate percent consumption of cottonwood saplings, seedlings, and resprouts and recruitment rates of cottonwood subjected to...

  15. Ambrosia Beetle (Coleoptera: Scolytidae) Species, Flight, and Attack on Living Eastern Cottonwood Trees.

    Energy Technology Data Exchange (ETDEWEB)

    Coyle, D R; D.C. Booth: M.S. Wallace

    2005-12-01

    ABSTRACT In spring 2002, ambrosia beetles (Coleoptera: Scolytidae) infested an intensively managed 22-ha tree plantation on the upper coastal plain of South Carolina. Nearly 3,500 scolytids representing 28 species were captured in ethanol-baited traps from 18 June 2002 to 18 April 2004. More than 88% of total captures were exotic species. Five species [Dryoxylon onoharaensum (Murayama), Euwallacea validus (Eichhoff), Pseudopityophthorus minutissimus (Zimmermann), Xyleborus atratus Eichhoff, and Xyleborus impressus Eichhoff]) were collected in South Carolina for the first time. Of four tree species in the plantation, eastern cottonwood, Populus deltoides Bartram, was the only one attacked, with nearly 40% of the trees sustaining ambrosia beetle damage. Clone ST66 sustained more damage than clone S7C15. ST66 trees receiving fertilization were attacked more frequently than trees receiving irrigation, irrigation_fertilization, or controls, although the number of S7C15 trees attacked did not differ among treatments. The study location is near major shipping ports; our results demonstrate the necessity for intensive monitoring programs to determine the arrival, spread, ecology, and impact of exotic scolytids.

  16. Tree mortality in mature riparian forest: Implications for Fremont cottonwood conservation in the American southwest

    Science.gov (United States)

    Andersen, Douglas

    2015-01-01

    Mature tree mortality rates are poorly documented in desert riparian woodlands. I monitored deaths and calculated annual survivorship probability (Ps) in 2 groups of large (27–114 cm DBH), old (≥40 years old) Fremont cottonwood (Populus fremontii Wats.) in a stand along the free-flowing Yampa River in semiarid northwestern Colorado. Ps = 0.993 year-1 in a group (n = 126) monitored over 2003–2013, whereas Ps = 0.985 year-1 in a group (n = 179) monitored over the same period plus 3 earlier years (2000–2003) that included drought and a defoliating insect outbreak. Assuming Ps was the same for both groups during the 10-year postdrought period, the data indicate that Ps = 0.958 year-1 during the drought. I found no difference in canopy dieback level between male and female survivors. Mortality was equal among size classes, suggesting Ps is independent of age, but published longevity data imply that either Ps eventually declines with age or, as suggested in this study, periods with high Ps are interrupted by episodes of increased mortality. Stochastic population models featuring episodes of low Ps suggest a potential for an abrupt decline in mature tree numbers where recruitment is low. The modeling results have implications for woodland conservation, especially for relictual stands along regulated desert rivers.

  17. Spatial distribution of leaf morphological and physiological characteristics in relation to local radiation regime within the canopies of 3-year-old Populus clones in coppice culture.

    Science.gov (United States)

    Casella, E; Ceulemans, R

    2002-12-01

    Spatial distributions of leaf characteristics relevant to photosynthesis were compared within high-density coppice canopies of Populus spp. of contrasting genetic origin. We studied three clones representative of the range in growth potential, leaf morphology, coppice and canopy structure: Clone Hoogvorst (Hoo) (Populus trichocarpa Torr. & Gray x Populus deltoides Bartr. & Marsh), Clone Fritzi Pauley (Fri) (Populus trichocarpa Torr. & Gray) and Clone Wolterson (Wol) (Populus nigra L.). Leaf area index ranged from 2.7 (Fri and Wol) to 3.8 (Hoo). The clones exhibited large vertical variation in leaf area density (0.02-1.42 m2 m-3). Leaf dry mass per unit leaf area (DM(A)) increased with increasing light in Clones Hoo and Fri, from about 56 g m-2 at the bottom of the canopy to 162 g m-2 at the top. In Clone Wol, DM(A) varied only from 65 to 100 g m-2, with no consistent relationship with respect to light. Conversely, nitrogen concentration on a mass basis was nearly constant (around 1.3-2.1%) within the canopies of Clones Hoo and Fri, but increased strongly with light in Clone Wol, from 1.4% at the bottom of the canopy to 4.1% at the top. As a result, nitrogen per unit leaf area (N(A)) increased with light in the canopies of all clones, from 0.9 g m-2 at the bottom to 2.9 g m-2 at the top. Although a single linear relationship described the dependence of maximum carboxylation rate (17-93 micromol CO2 m-2 s-1) or electron transport capacity (45-186 micromol electrons m-2 s-1) on N(A), for all clones, Clone Wol differed from Clones Hoo and Fri by exhibiting a higher dark respiration rate at low N(A) (1.8 versus 0.8 micromol CO2 m-2 s-1).

  18. Populus (Salicaceae plantations

    Directory of Open Access Journals (Sweden)

    Gonzalo M. Romano

    2013-01-01

    Full Text Available Aunque los cultivos forestales son comunidades artificiales, modifican condiciones ambientales que pueden alterar la diversidad fúngica nativa. Se estudiaron los efectos del manejo forestal de una plantación de sauces (Salix y álamos (Populus sobre la biodiversidad de Agaromycetes durante un año en una isla del Delta del Paraná, Argentina. Se midieron el peso seco y el número de basidiomas. Se identificaron 28 especies pertenecientes a los Agaricomycetes: 26 especies de Agaricales, una de Polyporales y una de Russulales. Nuestros resultados sugieren que el manejo forestal de dicha plantación no afecta la abundancia ni la diversidad de basidiomas de Agaricomycetes.

  19. Increasing the productivity of biomass plantations of Populus species and hybrids in the Pacific Northwest. Final report, September 14, 1981--December 31, 1996

    Energy Technology Data Exchange (ETDEWEB)

    DeBell, D.S.; Harrington, C.A.; Clendenen, G.W. [USDA Forest Service, Olympia, WA (United States)] [and others

    1997-08-01

    This final report represents the culmination of eight years of biological research devoted to increasing the productivity of short rotation plantations of Populus trichocarpa and Populus hybrids in the Pacific Northwest. Studies described herein provide an understanding of tree growth, stand development and biomass yield at various spacings, and how patterns thereof differ by Populus clone in monoclonal and polyclonal plantings. Also included is some information about factors related to wind damage in Populus plantings, use of leaf size as a predictor of growth potential, and approaches for estimating tree and stand biomass and biomass growth. The work was accomplished in three research plantations, all established cooperatively with the Washington State Department of Natural Resources (DNR) and located at the DNR Tree Improvement Center near Olympia. The first plantation was established in Spring 1986 to evaluate the highly touted {open_quotes}woodgrass{close_quotes} concept and compare it with more conventional short-rotation management regimes, using two Populus hybrid clones planted at five spacings. Besides providing scientific data to resolve the politicized {open_quotes}wood-grass{close_quotes} dispute, this plantation has furnished excellent data on stand dynamics and woody biomass yield. A second plantation was established at the same time; groups of trees therein received two levels of irrigation and different amounts of four fertilizer amendments, resulting in microsites with diverse moisture and nutrient conditions.

  20. Insights into ascorbate regeneration in plants: investigating the redox and structural properties of dehydroascorbate reductases from Populus trichocarpa.

    Science.gov (United States)

    Lallement, Pierre-Alexandre; Roret, Thomas; Tsan, Pascale; Gualberto, José M; Girardet, Jean-Michel; Didierjean, Claude; Rouhier, Nicolas; Hecker, Arnaud

    2016-03-15

    Dehydroascorbate reductases (DHARs), enzymes belonging to the GST superfamily, catalyse the GSH-dependent reduction of dehydroascorbate into ascorbate in plants. By maintaining a reduced ascorbate pool, they notably participate to H2O2 detoxification catalysed by ascorbate peroxidases (APXs). Despite this central role, the catalytic mechanism used by DHARs is still not well understood and there is no supportive 3D structure. In this context, we have performed a thorough biochemical and structural analysis of the three poplar DHARs and coupled this to the analysis of their transcript expression patterns and subcellular localizations. The transcripts for these genes are mainly detected in reproductive and green organs and the corresponding proteins are expressed in plastids, in the cytosol and in the nucleus, but not in mitochondria and peroxisomes where ascorbate regeneration is obviously necessary. Comparing the kinetic properties and the sensitivity to GSSG-mediated oxidation of DHAR2 and DHAR3A, exhibiting 1 or 3 cysteinyl residues respectively, we observed that the presence of additional cysteines in DHAR3A modifies the regeneration mechanism of the catalytic cysteine by forming different redox states. Finally, from the 3D structure of DHAR3A solved by NMR, we were able to map the residues important for the binding of both substrates (GSH and DHA), showing that DHAR active site is very selective for DHA recognition and providing further insights into the catalytic mechanism and the roles of the additional cysteines found in some DHARs.

  1. The SHORT-ROOT-like gene PtSHR2B is involved in Populus phellogen activity.

    Science.gov (United States)

    Miguel, Andreia; Milhinhos, Ana; Novák, Ondřej; Jones, Brian; Miguel, Célia M

    2016-03-01

    SHORT-ROOT (SHR) is a GRAS transcription factor first characterized for its role in the specification of the stem cell niche and radial patterning in Arabidopsis thaliana (At) roots. Three SHR-like genes have been identified in Populus trichocarpa (Pt). PtSHR1 shares high similarity with AtSHR over the entire length of the coding sequence. The two other Populus SHR-like genes, PtSHR2A and PtSHR2B, are shorter in their 5' ends when compared with AtSHR. Unlike PtSHR1, that is expressed throughout the cambial zone of greenhouse-grown Populus trees, PtSHR2Bprom:uidA expression was detected in the phellogen. Additionally, PtSHR1 and PtSHR2B expression patterns markedly differ in the shoot apex and roots of in vitro plants. Transgenic hybrid aspen expressing PtSHR2B under the 35S constitutive promoter showed overall reduced tree growth while the proportion of bark increased relative to the wood. Reverse transcription-quantitative PCR (RT-qPCR) revealed increased transcript levels of cytokinin metabolism and response-related genes in the transgenic plants consistent with an increase of total cytokinin levels. This was confirmed by cytokinin quantification by LC-MS/MS. Our results indicate that PtSHR2B appears to function in the phellogen and therefore in the regulation of phellem and periderm formation, possibly acting through modulation of cytokinin homeostasis. Furthermore, this work points to a functional diversification of SHR after the divergence of the Populus and Arabidopsis lineages. This finding may contribute to selection and breeding strategies of cork oak in which, unlike Populus, the phellogen is active throughout the entire tree lifespan, being at the basis of a highly profitable cork industry.

  2. Arsenic tolerance and phytoremediation potential of Conocarpus erectus L. and Populus deltoides L.

    Science.gov (United States)

    Hussain, Sajad; Akram, Muhammad; Abbas, Ghulam; Murtaza, Behzad; Shahid, Muhammad; Shah, Noor S; Bibi, Irshad; Niazi, Nabeel Khan

    2017-03-21

    The present study was conducted to explore arsenic (As) tolerance and phytostabilization potential of the two tree species, Buttonwood (Conocarpus erectus) and Eastern cottonwood (Populus deltoides). Both plant species were exposed to various soil As levels (control, 5, 10, 15 and 20 mg kg(-1)) in pots. The plants were harvested after nine months for evaluation of growth parameters as well as root and shoot As concentrations. With increasing soil As levels, plant height stress tolerance index (PHSTI) was significantly decreased in both tree species, whereas root length stress tolerance index (RLSTI) and dry matter stress tolerance index (DMSTI) were not affected. Root and shoot As concentrations significantly increased in both tree species with increasing soil As levels. Translocation factor and bioconcentration factor were less than 1.0 for both plant species. This study revealed that both tree species are non-hyperaccumulators of As, but could be used for phytostabilization of As-contaminated soils.

  3. Multiple factors affect pest and pathogen damage on 31 Populus clones in South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Coyle, David R.; Coleman, Mark D. [USDA Forest Service, Southern Research Station, P.O. Box 700, New Ellenton, SC 29809 (United States); Durant, Jaclin A.; Newman, Lee A. [Arnold School of Public Health, Department of Environmental Health Sciences, University of South Carolina, 800 Sumter St., Columbia, SC 29208 (United States)

    2006-08-15

    Populus species and hybrids have many practical applications, but there is a paucity of data regarding selections that perform well in the southeastern US. We compared pest susceptibility of 31 Populus clones over 3 years in South Carolina, USA. Cuttings were planted in spring 2001 on two study sites. Clones planted in the bottomland site received granular fertilizer yearly and irrigation the first two years only, while those on the sandy, upland site received irrigation and fertilization throughout each growing season. Foliar damage by the cottonwood leaf beetle (Chrysomela scripta), cottonwood leafcurl mite (Tetra lobulifera), and poplar leaf rust (Melampsora medusae) was visually monitored several times each growing season. Damage ratings differed significantly among clones, and clonal rankings changed from year to year. Irrigation increased C. scripta and M. medusae damage, but had no effect on T. lobulifera damage. Certain clones received greater pest damage at a particular study site. Temporal damage patterns were evident among individual clones and on each site. At the upland site, OP367 and 7300502 were highly resistant to all three pests; I45/51 was highly resistant to C. scripta and M. medusae; NM6 and 15-29 were highly resistant to M. medusae; and 7302801 was highly resistant to T. lobulifera and M. medusae. At the bottomland site, NM6, Eridano, I45/51, and 7302801 were highly resistant to all three pests; clone 7300502 was highly resistant to M. medusae only. Based on this preliminary 3-year study of pest damage levels, we would recommend clones NM6, Eridano, I45/51, OP367, 15-29, 7302801, 7300502, and Kentucky 8 for use in this region. (author)

  4. Measuring and Scaling Evapotranspiration of a Cottonwood Restoration Plot on the Lower Colorado River

    Science.gov (United States)

    Nagler, P. L.; Jetton, A.; Fleming, J. B.; Glenn, E. P.; Erker, J.; Morino, K.; Milliken, J. A.; Gloss, S. P.

    2006-05-01

    Evapotranpsiration (ET) by riparian vegetation is the second largest water user on western U.S. rivers. Efforts are underway to create restoration plots containing native trees such as cottonwood (Populus fremontii) (CW) because they provide valuable wildlife habitat. Up to now, estimates of riparian ET have been based on indirect methods and validation of estimates has been difficult. At Cibola NWR on the Colorado River, we estimated ET for a 20 acre plot of 3 year old CW trees for 50 consecutive days, July 25 - Sept 15, 2005. We measured transpiration rate using sap flow, heat-balance methods to get sap flow on pairs of branches on 20 CW trees. We scaled these ground measurements to high resolution (0.3 m) aerial readings and then to the satellite-level using Landsat ETM+ (30m) and EOS-1 Terra MODIS (250m) pixels. Using regression equations developed in Nagler et al. (2005a,b), we predicted ET at this CW site based on local, maximum air temperatures and ETM+ and MODIS Enhanced Vegetation Index (EVI) data. Sap flow rates ranged from 6 mm d-1 to 10 mm d-1. Results projected by MODIS imagery were similar to rates measured by sap flow sensors. Scaled over the whole plantation, annual ET rates were projected to be 1.33 m yr-1 (4.3 ft yr-1), approximately 50% higher than saltcedar on this river system. We conclude that replacing saltcedar with CW may result in increased water demand and the efficacy in supporting wildlife should be validated before they are widely implemented as a restoration strategy.

  5. The effects of harvesting short rotation cottonwood with tree shears in Arkansas

    Science.gov (United States)

    Matthew H. Pelkki; Michael Blazier; Jonathan Hartley; Hal Liechty; Bryce Zimmermann

    2016-01-01

    Short-rotation cottonwood plantations were established on a marginal agricultural site in the lower Mississippi Alluvial Valley in southeast Arkansas using two known clones (S7C20 and ST-66) and nurseryrun cottonwood stock (MIXED) from the Louisiana Department of Agriculture and Forestry nursery. The cottonwood was grown for five seasons and harvested in the winter of...

  6. Diversity of Pseudomonas Genomes, Including Populus-Associated Isolates, as Revealed by Comparative Genome Analysis.

    Science.gov (United States)

    Jun, Se-Ran; Wassenaar, Trudy M; Nookaew, Intawat; Hauser, Loren; Wanchai, Visanu; Land, Miriam; Timm, Collin M; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A; Ussery, David W

    2015-10-30

    The Pseudomonas genus contains a metabolically versatile group of organisms that are known to occupy numerous ecological niches, including the rhizosphere and endosphere of many plants. Their diversity influences the phylogenetic diversity and heterogeneity of these communities. On the basis of average amino acid identity, comparative genome analysis of >1,000 Pseudomonas genomes, including 21 Pseudomonas strains isolated from the roots of native Populus deltoides (eastern cottonwood) trees resulted in consistent and robust genomic clusters with phylogenetic homogeneity. All Pseudomonas aeruginosa genomes clustered together, and these were clearly distinct from other Pseudomonas species groups on the basis of pangenome and core genome analyses. In contrast, the genomes of Pseudomonas fluorescens were organized into 20 distinct genomic clusters, representing enormous diversity and heterogeneity. Most of our 21 Populus-associated isolates formed three distinct subgroups within the major P. fluorescens group, supported by pathway profile analysis, while two isolates were more closely related to Pseudomonas chlororaphis and Pseudomonas putida. Genes specific to Populus-associated subgroups were identified. Genes specific to subgroup 1 include several sensory systems that act in two-component signal transduction, a TonB-dependent receptor, and a phosphorelay sensor. Genes specific to subgroup 2 contain hypothetical genes, and genes specific to subgroup 3 were annotated with hydrolase activity. This study justifies the need to sequence multiple isolates, especially from P. fluorescens, which displays the most genetic variation, in order to study functional capabilities from a pangenomic perspective. This information will prove useful when choosing Pseudomonas strains for use to promote growth and increase disease resistance in plants.

  7. Prototype wood chunker used on Populus 'Tristis'

    Science.gov (United States)

    Rodger A. Arola; Roger C. Radcliffe; Sharon A. Winsauer

    1983-01-01

    Populus 'Tristis' trees grown under short-rotation, intensive culture were sampled and chunked in a prototype experimental wood chunking machine. Data presented describe the character of the trees chunked, the energy and power requirements for chunking, and the chunking rates Specific energy requirements for chunking Populus 'Tristis...

  8. Leaf water relations and sapflow in eastern cottonwood (Populus deltoides Bartr.) trees planted for phytoremediation of a groundwater pollutant

    Science.gov (United States)

    James M. Vose; Wayne T. Swank; Gregory J. Harvey; Barton D. Clinton; Christine Sobek

    2000-01-01

    Plants that remediate groundwater pollutants may offer a feasible alternative to the traditional and more expensive practices. Because its success depends on water use, this approach requires a complete understanding of species-specific transpiration patterns. The objectives of this study were (1) to quantify tree and stand-level transpiration in two age classes (whips...

  9. Clone history shapes Populus drought responses.

    Science.gov (United States)

    Raj, Sherosha; Bräutigam, Katharina; Hamanishi, Erin T; Wilkins, Olivia; Thomas, Barb R; Schroeder, William; Mansfield, Shawn D; Plant, Aine L; Campbell, Malcolm M

    2011-07-26

    Just as animal monozygotic twins can experience different environmental conditions by being reared apart, individual genetically identical trees of the genus Populus can also be exposed to contrasting environmental conditions by being grown in different locations. As such, clonally propagated Populus trees provide an opportunity to interrogate the impact of individual environmental history on current response to environmental stimuli. To test the hypothesis that current responses to an environmental stimulus, drought, are contingent on environmental history, the transcriptome- level drought responses of three economically important hybrid genotypes-DN34 (Populus deltoides × Populus nigra), Walker [P. deltoides var. occidentalis × (Populus laurifolia × P. nigra)], and Okanese [Walker × (P. laurifolia × P. nigra)]-derived from two different locations were compared. Strikingly, differences in transcript abundance patterns in response to drought were based on differences in geographic origin of clones for two of the three genotypes. This observation was most pronounced for the genotypes with the longest time since establishment and last common propagation. Differences in genome-wide DNA methylation paralleled the transcriptome level trends, whereby the clones with the most divergent transcriptomes and clone history had the most marked differences in the extent of total DNA methylation, suggesting an epigenomic basis for the clone history-dependent transcriptome divergence. The data provide insights into the interplay between genotype and environment in the ecologically and economically important Populus genus, with implications for the industrial application of Populus trees and the evolution and persistence of these important tree species and their associated hybrids.

  10. Moving Away from the Reference Genome: Evaluating a Peptide Sequencing Tagging Approach for Single Amino Acid Polymorphism Identifications in the Genus Populus

    Energy Technology Data Exchange (ETDEWEB)

    Abraham, Paul E [ORNL; Adams, Rachel M [ORNL; Tuskan, Gerald A [ORNL; Hettich, Robert {Bob} L [ORNL

    2013-01-01

    The genetic diversity across natural populations of the model organism, Populus, is extensive, containing a single nucleotide polymorphism roughly every 200 base pairs. When deviations from the reference genome occur in coding regions, they can impact protein sequences. Rather than relying on a static reference database to profile protein expression, we employed a peptide sequence tagging (PST) approach capable of decoding the plasticity of the Populus proteome. Using shotgun proteomics data from two genotypes of P. trichocarpa, a tag-based approach enabled the detection of 6,653 unexpected sequence variants. Through manual validation, our study investigated how the most abundant chemical modification (methionine oxidation) could masquerade as a sequence variant (AlaSer) when few site-determining ions existed. In fact, precise localization of an oxidation site for peptides with more than one potential placement was indeterminate for 70% of the MS/MS spectra. We demonstrate that additional fragment ions made available by high energy collisional dissociation enhances the robustness of the peptide sequence tagging approach (81% of oxidation events could be exclusively localized to a methionine). We are confident that augmenting fragmentation processes for a PST approach will further improve the identification of single amino acid polymorphism in Populus and potentially other species as well.

  11. A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

    2015-04-15

    Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

  12. A systems biology, whole-genome association analysis of the molecular regulation of biomass growth and composition in Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Kirst, Matias [Univ. of Florida, Gainesville, FL (United States)

    2014-04-14

    Poplars trees are well suited for biofuel production due to their fast growing habit, favorable wood composition and adaptation to a broad range of environments. The availability of a reference genome sequence, ease of vegetative propagation and availability of transformation methods also make poplar an ideal model for the study of wood formation and biomass growth in woody, perennial plants. The objective of this project was to conduct a genome-wide association genetics study to identify genes that regulate bioenergy traits in Populus deltoides (eastern cottonwood). Populus deltoides is a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits and common and low-frequency single-nucleotide polymorphisms (SNPs) detected by targeted resequencing of 18,153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. These polymorphism are critical tools for the development of specialized plant feedstocks for bioenergy.

  13. Protein (Viridiplantae): 224115152 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5294 3694:5294 predicted protein Populus trichocarpa MSYPKYRSVKVINNPARLIVGDDFRVNWDCLRLSIPTSAVEGVSLIISESSTTLLSVTITESIGTGLLPSQQGLCART...SKAAATLFSVTLTESTGNVRRDKSRHQLGKQFCDDYRVNRDCARVRNRASAGEAVSATISKAAATQFWVTITESTGITESTGIITESRRTGMCARTKPSFSWGSSFDD...NVRRDKSRFNWGSSSGGDFRVGRDSFSVMISESTETELCARTKPSFSWGSSFGNDFQVGSDFVFGDDYRVNSYYRVNRDSY

  14. Protein (Viridiplantae): 224137436 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 2832 predicted protein Populus trichocarpa MKGIRVRDLPRYARWKDPNDCVFNHNMESTEKACKASAIIVHSFDALEQEVLNALYSMFPRVYPI...RDPNDCLFNYTMESTEKACKASAIIVHSFDALEQEVLNALYSMFPRVYPIGPLQLLLNQVPEDDLNSIGCNLWKEEPECLQWLDSKKPNSVVYVNFGKSDDIIDKGMC

  15. Protein (Viridiplantae): 224111224 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 4:1369 predicted protein Populus trichocarpa MVRISRGIADMLISFDWHGLRQLPSLVELTIRRCPSLSHIPEDDCLGSLTQLKELIIGGFSEE...LEAFPAGLLNSIQLLNLSGSLKHLTIHGWDTLKSVPHQLQHLTALEKLWIIDFYGEEFEEALPEWLANLSSLQSLWISHCKNLKYLPSSTAIQRLSKLKELEISGCRHLKENCRKENGSEWPKISHIPEISIDLILVQVSWDLNFMSFNNNQ ...

  16. Protein (Viridiplantae): 224148846 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 791 3694:10791 predicted protein Populus trichocarpa MARIEIAFEKFSLLRIFQTWAGRPRELGPLKNLYVLRFLTLPPFSRTPSSAPLSPRFLPSSAPLSPRFPSSAPLSPRFLP...SSAPLSPRFPSSAPLSPRFLPSSAPLSPRFLPSSAPLSPRFPSSAPLSPRFLPSSAPLSPHFLPRAPLSPRFPL ...

  17. Protein (Viridiplantae): 224118952 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 4:7786 predicted protein Populus trichocarpa MLDRCLGTHRVRQIQRATRHGKITLLCLFMTVVVLRGTIGAGKSGTPEQDFNDLRNHIYASRK...HAEPHRVLTESNQSNNNKNDEGSNANDANNYAAFDINKILVDEGEDEKPDPNKPYFLGPKISDWDEQRAKWLSENPNFSNF

  18. Protein (Viridiplantae): 224129640 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8070 predicted protein Populus trichocarpa MEAHHHHHQFTHNIFERRPIIRSKTPAVKWFKEWVPQDVVATGGRCSLFKWVTENQLNALKEKAKEPQAPEPEPEPTTEVLFLCSFEGCG...KTFIDAGALRKHSHIHGERQYVCHYEGCGKKFLDSSKLKRHFLIHTGERDFICPHEGCG

  19. Protein (Viridiplantae): 224127650 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available SKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLPSNVTQPSSTSQAAVPAAAFSDAD...redicted protein, partial Populus trichocarpa MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLDE

  20. Protein (Viridiplantae): 224122422 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3694:9513 predicted protein Populus trichocarpa MRMGSRGHQARAACAAPLPALLPTPEGLGQRHAHGPAFEPSLSPFERAFEPSLPFERAFEPSLSPFERAFQPSLPFE...RAFEPSLSPFERAFEPLLSPFELAFEPSLPFERAFEPSLSPFERAFQPSLPFERAFEPSLSPFERAFEPLLSPFELAFEPSLSPFERAFEPSLSLRARLSALAFSLRARL ...

  1. Protein (Viridiplantae): 224142529 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3689:10587 3694:10587 predicted protein Populus trichocarpa MSDMSYKLSSPSTSNSGYTERELVGAKMSSLANAHDLSNMSYKLSSPSTSNGRYTERDLVGAEMSCLANAHD...LSDLSSKLSFPSTSNGRYTERGLVGAEMSCLANAHDLINLSSKLSFLSTSNGRYTERDLVGAKMSSRNPLHKYSTSASHSVHRSLASACPQSIRM ...

  2. Protein (Viridiplantae): 224144295 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3689:10587 3694:10587 predicted protein Populus trichocarpa MSDMSYKLSSPSTSNSGYTERELVGAKMSCLANAHDLSNMSYKLSSPSTSNGRYTERDLVGAEMSCLANAHD...LSDLSSKLSFPSTSNGRYTERGLVGAEMSCLANAHDLINLSSKLSFLSTSNGRYTERDLVGAKMSSRNPLHKYSTSTSHSVHRSLASACPQSIRM ...

  3. Protein (Viridiplantae): 224142533 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3689:10587 3694:10587 predicted protein Populus trichocarpa MSSPANAHDLRNLSSKLSFPSTSNGRYAERDLVGAKMSSPANAHNLR...NLSSKLSFPSTSNGRYAERDLVGAKMSSPANAHDLRNLSSKLSFPSTSSSRYAERDLVGAKMSSPANAHDLRNFSFPSTSNGRYAERDLVGA ...

  4. Protein (Viridiplantae): 224106471 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3694:8508 predicted protein, partial Populus trichocarpa MSGVWIFDKNGVARLITNPTRESFEQKEPLHPGTATAPGARPRVLVYLPANHVIRSYTELEQRLAELGWTRYYNSNQPNLLQFHKSDNSAHLISLPRDFDSFKPLHMYDIVVKNRSFFEVRD ...

  5. Protein (Viridiplantae): 224072389 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available NRDQERKKEADRAYRQRCKFKKIKNEEKLCALTEENNRLDRENKHLKNEEVRLKEVVQTQNENMKQLQGHFCQLKSQLDKQ...694:1072 predicted protein Populus trichocarpa MWPPELATTSTANEIGGSYEINTVPSMIQPPIEQYMSFLSGCLDSPTIPDSKQKRKAPDDV

  6. Metabolomics study of Populus type propolis.

    Science.gov (United States)

    Anđelković, Boban; Vujisić, Ljubodrag; Vučković, Ivan; Tešević, Vele; Vajs, Vlatka; Gođevac, Dejan

    2017-02-20

    Herein, we propose rapid and simple spectroscopic methods to determine the chemical composition of propolis derived from various Populus species using a metabolomics approach. In order to correlate variability in Populus type propolis composition with the altitude of its collection, NMR, IR, and UV spectroscopy followed by OPLS was conducted. The botanical origin of propolis was established by comparing propolis spectral data to those of buds of various Populus species. An O2PLS method was utilized to integrate two blocks of data. According to OPLS and O2PLS, the major compounds in propolis samples, collected from temperate continental climate above 500m, were phenolic glycerides originating from P. tremula buds. Flavonoids were predominant in propolis samples collected below 400m, originating from P. nigra and P. x euramericana buds. Samples collected at 400-500m were of mixed origin, with variable amounts of all detected metabolites. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Changes in soil characteristics during landfill leachate irrigation of Populus deltoides.

    Science.gov (United States)

    Zupanc, Vesna; Justin, Maja Zupančič

    2010-11-01

    The effects of wastewater application on electrical conductivity, water retention and water repellency of soils planted with Populus deltoides (eastern cottonwood) and irrigated with different concentrations of landfill leachate and compost wastewater, tap water and nutrient solution were evaluated. Substrate water content at field capacity (-0.033 MPa) and at permanent wilting point (-1.5 MPa) was determined with a pressure plate extractor to assess available water capacity of the substrate. A water drop penetration test was used to determine substrate water repellency. The biomass of nutrient and landfill leachate treatments was significantly (Pwater repellency after the experiment at field capacity and permanent wilting point comparing to the original substrate. The strongest influence on water repellency at both field capacity and permanent wilting point showed irrigation with compost wastewater and tap water. Pronounced influence on substrate's water repellency of compost wastewater could be contributed to a high content of dissolved organic carbon, whereas Mg and Ca cations caused flocculation and consequent water repellency of the substrate irrigated with tap water. The results indicate that soil physical characteristics must be closely monitored when landfill leachate and compost wastewater are used for irrigation to avoid long term detrimental effects on the soil, and consequently on the environment. Due to the complexity of the compost wastewater quality the latter should be applied on open fields only after prior pre-treatment to reduce dissolved organic carbons, or alternatively, compost wastewater should be added only intermittently and in diluted ratios. Copyright © 2010 Elsevier Ltd. All rights reserved.

  8. Terra Populus and DataNet Collaboration

    Science.gov (United States)

    Kugler, T.; Ruggles, S.; Fitch, C. A.; Clark, P. D.; Sobek, M.; Van Riper, D.

    2012-12-01

    Terra Populus, part of NSF's new DataNet initiative, is developing organizational and technical infrastructure to integrate, preserve, and disseminate data describing changes in the human population and environment over time. Terra Populus will incorporate large microdata and aggregate census datasets from the United States and around the world, as well as land use, land cover, climate and other environmental datasets. These data are widely dispersed, exist in a variety of data structures, have incompatible or inadequate metadata, and have incompatible geographic identifiers. Terra Populus is developing methods of integrating data from different domains and translating across data structures based on spatio-temporal linkages among data contents. The new infrastructure will enable researchers to identify and merge data from heterogeneous sources to study the relationships between human behavior and the natural world. Terra Populus will partner with data archives, data producers, and data users to create a sustainable international organization that will guarantee preservation and access over multiple decades. Terra Populus is also collaborating with the other projects in the DataNet initiative - DataONE, the DataNet Federation Consortium (DFC) and Sustainable Environment-Actionable Data (SEAD). Taken together, the four projects address aspects of the entire data lifecycle, including planning, collection, documentation, discovery, integration, curation, preservation, and collaboration; and encompass a wide range of disciplines including earth sciences, ecology, social sciences, hydrology, oceanography, and engineering. The four projects are pursuing activities to share data, tools, and expertise between pairs of projects as well as collaborating across the DataNet program on issues of cyberinfrastructure and community engagement. Topics to be addressed through program-wide collaboration include technical, organizational, and financial sustainability; semantic

  9. Barcoding poplars (Populus L. from western China.

    Directory of Open Access Journals (Sweden)

    Jianju Feng

    Full Text Available BACKGROUND: Populus is an ecologically and economically important genus of trees, but distinguishing between wild species is relatively difficult due to extensive interspecific hybridization and introgression, and the high level of intraspecific morphological variation. The DNA barcoding approach is a potential solution to this problem. METHODOLOGY/PRINCIPAL FINDINGS: Here, we tested the discrimination power of five chloroplast barcodes and one nuclear barcode (ITS among 95 trees that represent 21 Populus species from western China. Among all single barcode candidates, the discrimination power is highest for the nuclear ITS, progressively lower for chloroplast barcodes matK (M, trnG-psbK (G and psbK-psbI (P, and trnH-psbA (H and rbcL (R; the discrimination efficiency of the nuclear ITS (I is also higher than any two-, three-, or even the five-locus combination of chloroplast barcodes. Among the five combinations of a single chloroplast barcode plus the nuclear ITS, H+I and P+I differentiated the highest and lowest portion of species, respectively. The highest discrimination rate for the barcodes or barcode combinations examined here is 55.0% (H+I, and usually discrimination failures occurred among species from sympatric or parapatric areas. CONCLUSIONS/SIGNIFICANCE: In this case study, we showed that when discriminating Populus species from western China, the nuclear ITS region represents a more promising barcode than any maternally inherited chloroplast region or combination of chloroplast regions. Meanwhile, combining the ITS region with chloroplast regions may improve the barcoding success rate and assist in detecting recent interspecific hybridizations. Failure to discriminate among several groups of Populus species from sympatric or parapatric areas may have been the result of incomplete lineage sorting, frequent interspecific hybridizations and introgressions. We agree with a previous proposal for constructing a tiered barcoding system in

  10. Management of plains cottonwood at Theodore Roosevelt National Park, North Dakota

    Science.gov (United States)

    Friedman, Jonathan M.; Griffin, Eleanor R.

    2017-01-01

    Establishment of cottonwood trees is driven by flood-induced channel migration, which provides the new surfaces necessary for successful germination and survival. Along the Little Missouri River the largest floods typically result from snowmelt in March or April. Seed release occurs in early summer, and seedlings usually germinate in moist, open locations on point bars at relatively low elevations above the channel. Subsequent channel migration allows seedlings to mature by protecting them from scour in floods and ice jams. Management actions that decrease channel movement will reduce cottonwood reproduction.

  11. Genotyping-by-sequencing for Populus population genomics: an assessment of genome sampling patterns and filtering approaches.

    Directory of Open Access Journals (Sweden)

    Martin P Schilling

    Full Text Available Continuing advances in nucleotide sequencing technology are inspiring a suite of genomic approaches in studies of natural populations. Researchers are faced with data management and analytical scales that are increasing by orders of magnitude. With such dramatic advances comes a need to understand biases and error rates, which can be propagated and magnified in large-scale data acquisition and processing. Here we assess genomic sampling biases and the effects of various population-level data filtering strategies in a genotyping-by-sequencing (GBS protocol. We focus on data from two species of Populus, because this genus has a relatively small genome and is emerging as a target for population genomic studies. We estimate the proportions and patterns of genomic sampling by examining the Populus trichocarpa genome (Nisqually-1, and demonstrate a pronounced bias towards coding regions when using the methylation-sensitive ApeKI restriction enzyme in this species. Using population-level data from a closely related species (P. tremuloides, we also investigate various approaches for filtering GBS data to retain high-depth, informative SNPs that can be used for population genetic analyses. We find a data filter that includes the designation of ambiguous alleles resulted in metrics of population structure and Hardy-Weinberg equilibrium that were most consistent with previous studies of the same populations based on other genetic markers. Analyses of the filtered data (27,910 SNPs also resulted in patterns of heterozygosity and population structure similar to a previous study using microsatellites. Our application demonstrates that technically and analytically simple approaches can readily be developed for population genomics of natural populations.

  12. High-density linkage mapping and evolution of paralogs and orthologs in Salix and Populus

    Directory of Open Access Journals (Sweden)

    Öst Torbjörn

    2010-02-01

    Full Text Available Abstract Background Salix (willow and Populus (poplar are members of the Salicaceae family and they share many ecological as well as genetic and genomic characteristics. The interest of using willow for biomass production is growing, which has resulted in increased pressure on breeding of high yielding and resistant clones adapted to different environments. The main purpose of this work was to develop dense genetic linkage maps for mapping of traits related to yield and resistance in willow. We used the Populus trichocarpa genome to extract evenly spaced markers and mapped the orthologous loci in the willow genome. The marker positions in the two genomes were used to study genome evolution since the divergence of the two lineages some 45 mya. Results We constructed two linkage maps covering the 19 linkage groups in willow. The most detailed consensus map, S1, contains 495 markers with a total genetic distance of 2477 cM and an average distance of 5.0 cM between the markers. The S3 consensus map contains 221 markers and has a total genetic distance of 1793 cM and an average distance of 8.1 cM between the markers. We found high degree of synteny and gene order conservation between willow and poplar. There is however evidence for two major interchromosomal rearrangements involving poplar LG I and XVI and willow LG Ib, suggesting a fission or a fusion in one of the lineages, as well as five intrachromosomal inversions. The number of silent substitutions were three times lower (median: 0.12 between orthologs than between paralogs (median: 0.37 - 0.41. Conclusions The relatively slow rates of genomic change between willow and poplar mean that the genomic resources in poplar will be most useful in genomic research in willow, such as identifying genes underlying QTLs of important traits. Our data suggest that the whole-genome duplication occurred long before the divergence of the two genera, events which have until now been regarded as contemporary

  13. Sexual dimorphism floral microRNA profiling and target gene expression in andromonoecious poplar (Populus tomentosa.

    Directory of Open Access Journals (Sweden)

    Yuepeng Song

    Full Text Available Although the molecular basis of poplar sex-specific flower development remains largely unknown, increasing evidence indicates an essential role for microRNAs (miRNAs. The specific miRNA types and precise miRNA expression patterns in dioecious plant flower development remain unclear. Here, we used andromonoecious poplar, an exceptional model system, to eliminate the confounding effects of genetic background of dioecious plants. This system, combined with high-throughput sequencing and computational analysis, allowed us to characterize sex-specific miRNAomes from female and male flowers. Comparative miRNAome analysis combined with quantitative real-time PCR revealed the expression patterns of 27 miRNAs in poplar flower and showed that the targets of these miRNAs are involved in flower organogenesis, Ca(2+ transport, phytohormone synthesis and metabolism, and DNA methylation. This paper describes a complex regulatory network consisting of these miRNAs expressed in sex-specific flower development in a dioecious plant. The conserved and novel miRNA locations were annotated in the Populus trichocarpa genome. Among these, miRNA Pto-F70 and 4 targets are located in the sex-determination regions of chromosome XIX. Furthermore, two novel miRNAs, Pto-F47 and Pto-F68, were shown for the first time to be regulatory factors in phytohormone interactions. To our knowledge, this report is the first systematic investigation of sex-specific flower-related miRNAs and their targets in poplar, and it deepens our understanding of the important regulatory functions of miRNAs in female and male flower development in this dioecious plant.

  14. Genetic Test of New Cottonwood Clones at Nursery Stage

    Institute of Scientific and Technical Information of China (English)

    QINGuanghua; JIANGYuezhong

    2004-01-01

    Twenty-five new clones belong to Populus Aigeiros of both domestic and foreign origin had been introduced and tested at nursery stage in Shandong province. Results showed that height (H),diameter at stem base (DO) and survival rate (SR) varied significantly and genetic variation were very large among the clones. CVg and broad-sense heritability (h2) of H, DO and SR of 1-year-old stock nursery were 7.43%, 9.25%, 18.78% and 78.91%, 96.31%, 95.93%, respectively, showing high genetic control on the tested traits. 11 superior clones with characteristics of high growth rate and medium or high SR were primarily selected and genetic gains (△G) of H, DO and SR were 16.89%, 16.08% and 13.08%, respectively.Rooting habits test of some selected clones were also conducted based on the cutting culture in water container and annual growth increment measured. The date of first root emergence, number of main roots, number of lateral roots, length of main roots and the emergence date of growth peak varied to certain degree among the selected clones.

  15. Genome-wide Identification of TCP Family Transcription Factors from Populus euphratica and Their Involvement in Leaf Shape Regulation.

    Science.gov (United States)

    Ma, Xiaodong; Ma, Jianchao; Fan, Di; Li, Chaofeng; Jiang, Yuanzhong; Luo, Keming

    2016-09-08

    Higher plants have been shown to experience a juvenile vegetative phase, an adult vegetative phase, and a reproductive phase during its postembryonic development and distinct lateral organ morphologies have been observed at the different development stages. Populus euphratica, commonly known as a desert poplar, has developed heteromorphic leaves during its development. The TCP family genes encode a group of plant-specific transcription factors involved in several aspects of plant development. In particular, TCPs have been shown to influence leaf size and shape in many herbaceous plants. However, whether these functions are conserved in woody plants remains unknown. In the present study, we carried out genome-wide identification of TCP genes in P. euphratica and P. trichocarpa, and 33 and 36 genes encoding putative TCP proteins were found, respectively. Phylogenetic analysis of the poplar TCPs together with Arabidopsis TCPs indicated a biased expansion of the TCP gene family via segmental duplications. In addition, our results have also shown a correlation between different expression patterns of several P. euphratica TCP genes and leaf shape variations, indicating their involvement in the regulation of leaf shape development.

  16. Genome-wide association mapping for wood characteristics in Populus identifies an array of candidate single nucleotide polymorphisms.

    Science.gov (United States)

    Porth, Ilga; Klapšte, Jaroslav; Skyba, Oleksandr; Hannemann, Jan; McKown, Athena D; Guy, Robert D; DiFazio, Stephen P; Muchero, Wellington; Ranjan, Priya; Tuskan, Gerald A; Friedmann, Michael C; Ehlting, Juergen; Cronk, Quentin C B; El-Kassaby, Yousry A; Douglas, Carl J; Mansfield, Shawn D

    2013-11-01

    Establishing links between phenotypes and molecular variants is of central importance to accelerate genetic improvement of economically important plant species. Our work represents the first genome-wide association study to the inherently complex and currently poorly understood genetic architecture of industrially relevant wood traits. Here, we employed an Illumina Infinium 34K single nucleotide polymorphism (SNP) genotyping array that generated 29,233 high-quality SNPs in c. 3500 broad-based candidate genes within a population of 334 unrelated Populus trichocarpa individuals to establish genome-wide associations. The analysis revealed 141 significant SNPs (α ≤ 0.05) associated with 16 wood chemistry/ultrastructure traits, individually explaining 3-7% of the phenotypic variance. A large set of associations (41% of all hits) occurred in candidate genes preselected for their suggested a priori involvement with secondary growth. For example, an allelic variant in the FRA8 ortholog explained 21% of the total genetic variance in fiber length, when the trait's heritability estimate was considered. The remaining associations identified SNPs in genes not previously implicated in wood or secondary wall formation. Our findings provide unique insights into wood trait architecture and support efforts for population improvement based on desirable allelic variants.

  17. Biomass and Nutrient Accumulation in a Cottonwood Plantation - The First Four Years

    Science.gov (United States)

    John K. Francis; James B. Baker

    1981-01-01

    For the first 4 years, height increment of an eastern cottonwood plantation on a clayey soil was greatest in the first growing season; diameter growth was greatest in the second growing season; and annual production of biomass was greatest in the third year. Nitrogen, phosphorus, and possibly magnesium are translocated from leaves into bark and other tissue before leaf...

  18. Newly identified helper bacteria stimulate ectomycorrhizal formation in Populus

    OpenAIRE

    Labbé, Jessy L.; Weston, David J; Nora eDunkirk; Pelletier, Dale A.; Tuskan, Gerald A.

    2014-01-01

    Mycorrhiza helper bacteria (MHB) are known to increase host root colonization by mycorrhizal fungi but the molecular mechanisms and potential tripartite interactions are poorly understood. Through an effort to study Populus microbiome, we isolated 21 Pseudomonas strains from native Populus deltoides roots. These bacterial isolates were characterized and screened for MHB effectiveness on the Populus-Laccaria system. Two additional Pseudomonas strains (i.e., Pf-5 and BBc6R8) from existing colle...

  19. Genome-wide analysis of the fasciclin-like arabinogalactan protein gene family reveals differential expression patterns, localization and salt stress response in Populus

    Directory of Open Access Journals (Sweden)

    Lina eZang

    2015-12-01

    points. In summary, this study may lay the foundation for further investigating the biological functions of FLA genes in Populus trichocarpa.

  20. Gene Response to Salt Stress in Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    Shen Xin; Thomas Teichmenn; Wang Yiqin; Bai Genben; Yu Guangjun; Wang Shasheng

    2003-01-01

    Through construction of a subtracted cDNA library and library screening, a number of salt-induced cDNA fragmentshave been cloned from Populus euphratica. Based on the results of DNA sequencing and Northern analysis, the gene response ofPopulus euphratica to salt stress is discussed. It is indicated that in response to salt treatment the transcription level for some genes ofPopulus euphratica increases by about 1.5 times and significant difference between the responses to osmotic stress and to ion stresshas been observed in gene activity.

  1. Chemical and physical properties of two-year short-rotation deciduous species. [Olea sp. , Populus deltoides, Platanus sp. , Alnus glutinosa, Paulownia tomentosa, Robina pseudoacacia, Acer saccharinum

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C.S

    1982-01-01

    The following seven broadleaved species were tested: autumn olive (Olea sp.) eastern cottonwood (Populus deltoides), sycamore (Platanus species), black alder (Alnus glutinosa), royal paulownia (Paulownia tomentosa), black locust (Robina pseudoacacia) and silver maple (Acer saccharinum). The species and portions both significantly affected the chemical and the physical findings of the juvenile wood. The ages, which were tested in factorial combination with the species, also showed a significant effect on both the chemical and the physical properties of wood. All of the results indicated that both chemical and physical properties did vary with species, among the portions of the wood, and according to the ages of the wood. From the portion standpoint, the bark had higher gross heat content, sulphur content, ash content and lignin content, and it was also higher in all three kinds of extractives contents. The wood portion was found to be rich in holocellulose, alpha-cellulose and pentosan. In considering the chemical and physical properties of juvenile wood among the species, eastern cottonwood was found to have the highest value for ash content and all of the three kinds of extractives content. Paulownia had the highest value for sulphur content. Black locust had highest gross heat content, holocellulose and alpha-cellulose contents. Silver maple had highest lignin content. Results from this study showed that these seven juvenile hardwood species can produce high biomass yields of fibre and energy when grown under intensive care in central and southern Illinois sites. The best species of these seven tested woods seem to be black locust, which could also serve as a raw material for the pulp and paper industry, as well as for a fuel for energy generation. However, further economic and energy efficiency analyses are needed before judging the feasibility of these short-rotation juvenile hardwood species.

  2. An Artificial Diet for Cottonwood and Imported Williow leaf Beetles (Coleoptera: Chrysomelidae) and Comparative Performance on Poplar Foliage1,2

    Science.gov (United States)

    Leah S. Bauer; Joann Meerschaert; Thomas O. Forrester

    1989-01-01

    An artificial diet was developed for labortory rearing of the cottonwood leaf beetle, Chrysomela scripta F., and the imported willow leaf beetle, Plagiodera versicolira (Laicharting). To reduce microbial contamination of the media, procedures were developed for the separating egg masses and sterilizing egg surfaces. Cottonwood leaf...

  3. Variation in Time of Flowering and Seed Dispersal of Eastern Cottonwood In the Lower Mississippi Valley

    Science.gov (United States)

    Robert E. Farmer

    1966-01-01

    Flowering of Populus deItoides Bartr. occurred from early March to early April; differences between trees within stands accounted for 98 percent of the significant variation in dates. High correlation (r = .91 to .96) between 1963 and 1964 dates of individual trees indicated that trees within stands flower in a predictable sequence. Seed dispersal...

  4. Protein (Viridiplantae): 224147325 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5294 3694:5294 predicted protein, partial Populus trichocarpa GLCARTKPSFSWGSGFRDDFQVGNDLVFGDDYRVNKDYRVNRDYYR...VNKDCERIRNKASAGEAVLSTISKAAATLFSVTITESLGIGLCARTKPSFSWGSSFGDDFQVGSDYVFGDDYRVNSDSGVN...RTVRAYGTKNHLGKRFCLQFPSRQRLSFGSRLPSEQGLCAQTKPGISWGSSSGDDFRGGRDSLSGLCARTKPSFSWGSGFRNDFQVGSDLVFGDDYRVNRDYRVNRDY...YRVNKDCARIRNKVISWGSGFVDNFQGGSDSVFGDDYRVNMDCAHRQNQASAGEAVLGLCARTKPSFSWGSGFRDDFQVGS...DLVFGADYRVNRDYRVNRDYYRVNKDCACIRNKASAGEAVSSKISKSAATLFSVTITESIGIVRTDNSRHQLGKQFCQQGLCARTKPSFSWGSGFRNDFQVGSDLVFGDDYRVNRDYRVNRDYYRVNKDCARIRNKASAGEAVSSTISKSAATLFSVTITESLGIVRIDNSTHQLGKKFW ...

  5. Protein (Viridiplantae): 224086357 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 4:195 predicted protein Populus trichocarpa MATTLKSLSSFVILLIVNSLFFTGTTEARPFNIMKSGNSAASRGTESFFDGLSLGGIKEGPSPGAGHEFTNSGTL...GGIKEEGPSPSAGHGFTSSGTLGGIKEGPSPGAGHGFTNSGTLGGIKEGPSPGVGHGFTNSGTLEGIKKEGPSPTNSGTL...GGIKEGPSPGAGHGFTNSETLGGIKEGPSPGVGHEFTNSGTLGGIKEGPSPGVGHGFTNSGTLEGIKKEGPSPTNSGTLGGIKEGPSPGAGHGFTNSE...TLGGIKEGPSPGGIKEGSSPGVGHAFTNSGTLGGIKEGPSPGAGHAFTNSGTLGGIKEGPSPGAGHGFTNSGTLGGIKEGSSPGVGHGFTNSGTLGGIKEGPSPCCGNKYTTGTKH ...

  6. Protein (Viridiplantae): 224124826 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 94:2255 predicted protein Populus trichocarpa MQLLDLEEDGSASLFIEKSAAKTASLPISASAAKTASLPISASAAKTAWLPIKKWAAKTVSL...PISVSVVKAASLPSPESAAKTASLLISASAAKTASLPSPESAAKTASLPSPESAAKTASLPISASVDKTASMPSPESAAKTASLPSSESAAKTASLPISA...SAAKTASLPSPESAAKTASLPISASADKTASMPSPESAAKTASLPSPESAAKTASLPISASAAKTASLPSPESAAKTASLPISASADKT...ASMPSPESAAKTASLPSPESAAKTASLPISASAAKTASLPSPESAAKTASLPSPESAANTASLPISASAAKTASLPISASAAKTASLPISASAAKTAFIIISLSLNIYIYFPLGVYK ...

  7. Rooting greenwood tip cuttings of several Populus clones hydroponically (hydroponic rooting of Populus cuttings)

    Energy Technology Data Exchange (ETDEWEB)

    Phipps, H.M.; Hansen, E.A.; Tolsted, D.N.

    1980-01-01

    Greenwood cuttings of several Populus clones were successfully rooted with a relatively simple hydroponic method. Indolebutyric acid and naphthaleneacetic acid at concentrations of 500 to 5000 ppM applied as a quick dip to the cutting bases, a complete nutrient solution at 20 to 40% of full strength, and a solution temperature between 27 and 30/sup 0/C generally produced the best rooting performance of most clones. Cuttings propagated by the hydroponic procedure rooted faster and generally outgrew those produced by a standard method after being transplanted to pots and grown in the greenhouse.

  8. Newly identified helper bacteria stimulate ectomycorrhizal formation in Populus.

    Science.gov (United States)

    Labbé, Jessy L; Weston, David J; Dunkirk, Nora; Pelletier, Dale A; Tuskan, Gerald A

    2014-01-01

    Mycorrhiza helper bacteria (MHB) are known to increase host root colonization by mycorrhizal fungi but the molecular mechanisms and potential tripartite interactions are poorly understood. Through an effort to study Populus microbiome, we isolated 21 Pseudomonas strains from native Populus deltoides roots. These bacterial isolates were characterized and screened for MHB effectiveness on the Populus-Laccaria system. Two additional Pseudomonas strains (i.e., Pf-5 and BBc6R8) from existing collections were included for comparative purposes. We analyzed the effect of co-cultivation of these 23 individual Pseudomonas strains on Laccaria bicolor "S238N" growth rate, mycelial architecture and transcriptional changes. Nineteen of the 23 Pseudomonas strains tested had positive effects on L. bicolor S238N growth, as well as on mycelial architecture, with strains GM41 and GM18 having the most significant effect. Four of seven L. bicolor reporter genes, Tra1, Tectonin2, Gcn5, and Cipc1, thought to be regulated during the interaction with MHB strain BBc6R8, were induced or repressed, while interacting with Pseudomonas strains GM17, GM33, GM41, GM48, Pf-5, and BBc6R8. Strain GM41 promoted the highest roots colonization across three Populus species but most notably in P. deltoides, which is otherwise poorly colonized by L. bicolor. Here we report novel MHB strains isolated from native Populus that improve L. bicolor root colonization on Populus. This tripartite relationship could be exploited for Populus species/genotypes nursery production as a means of improving establishment and survival in marginal lands.

  9. Newly identified helper bacteria stimulate ectomycorrhizal formation in Populus

    Directory of Open Access Journals (Sweden)

    Jessy L Labbé

    2014-10-01

    Full Text Available Mycorrhiza helper bacteria (MHB are known to increase host root colonization by mycorrhizal fungi but the molecular mechanisms and potential tripartite interactions are poorly understood. Through an effort to study Populus microbiome, we isolated 21 Pseudomonas strains from native Populus deltoides roots. These bacterial isolates were characterized and screened for MHB effectiveness on the Populus-Laccaria system. Two additional Pseudomonas strains (i.e., Pf-5 and BBc6R8 from existing collections were included for comparative purposes. We analyzed the effect of co-cultivation of these 23 individual Pseudomonas strains on Laccaria bicolor ‘S238N’ growth rate, mycelial architecture and transcriptional changes. Nineteen of the 23 Pseudomonas strains tested had positive effects on L. bicolor S238N growth, as well as on mycelial architecture, with strains GM41 and GM18 having the most significant effect. Four of seven L. bicolor reporter genes, Tra1, Tectonin2, Gcn5 and Cipc1, thought to be regulated during the interaction with MHB strain BBc6R8, were induced or repressed, while interacting with Pseudomonas strains GM17, GM33, GM41, GM48, Pf-5 and BBc6R8. Strain GM41 promoted the highest roots colonization across three Populus species but most notably in P. deltoides, which is otherwise poorly colonized by L. bicolor. Here we report novel MHB strains isolated from native Populus that improve L. bicolor root colonization on Populus. This tripartite relationship could be exploited for Populus species/genotypes nursery production as a means of improving establishment and survival in marginal lands.

  10. Highly efficient isolation of Populus mesophyll protoplasts and its application in transient expression assays.

    Directory of Open Access Journals (Sweden)

    Jianjun Guo

    Full Text Available BACKGROUND: Populus is a model woody plant and a promising feedstock for lignocellulosic biofuel production. However, its lengthy life cycle impedes rapid characterization of gene function. METHODOLOGY/PRINCIPAL FINDINGS: We optimized a Populus leaf mesophyll protoplast isolation protocol and established a Populus protoplast transient expression system. We demonstrated that Populus protoplasts are able to respond to hormonal stimuli and that a series of organelle markers are correctly localized in the Populus protoplasts. Furthermore, we showed that the Populus protoplast transient expression system is suitable for studying protein-protein interaction, gene activation, and cellular signaling events. CONCLUSIONS/SIGNIFICANCE: This study established a method for efficient isolation of protoplasts from Populus leaf and demonstrated the efficacy of using Populus protoplast transient expression assays as an in vivo system to characterize genes and pathways.

  11. Highly Efficient Isolation of Populus Mesophyll Protoplasts and Its Application in Transient Expression Assays

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Jianjun [ORNL; Morrell-Falvey, Jennifer L [ORNL; Labbe, Jessy L [ORNL; Muchero, Wellington [ORNL; Kalluri, Udaya C [ORNL; Tuskan, Gerald A [ORNL; Chen, Jay [ORNL

    2012-01-01

    Background: Populus is a model woody plant and a promising feedstock for lignocellulosic biofuel production. However, its lengthy life cycle impedes rapid characterization of gene function. Methodology/Principal Findings: We optimized a Populus leaf mesophyll protoplast isolation protocol and established a Populus protoplast transient expression system. We demonstrated that Populus protoplasts are able to respond to hormonal stimuli and that a series of organelle markers are correctly localized in the Populus protoplasts. Furthermore, we showed that the Populus protoplast transient expression system is suitable for studying protein-protein interaction, gene activation, and cellular signaling events. Conclusions/Significance: This study established a method for efficient isolation of protoplasts from Populus leaf and demonstrated the efficacy of using Populus protoplast transient expression assays as an in vivo system to characterize genes and pathways.

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-0827 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0827 ref|XP_002298442.1| predicted protein [Populus trichocarpa] gb|AB...K94884.1| unknown [Populus trichocarpa] gb|EEE83247.1| predicted protein [Populus trichocarpa] XP_002298442.1 1.8 28% ...

  13. Influence of water table decline on growth allocation and endogenous gibberellins in black cottonwood

    Energy Technology Data Exchange (ETDEWEB)

    Rood, S.B.; Zanewich, K.; Stefura, C. [Lethbridge Univ., Lethbridge, AB (Canada). Dept. of Biological Sciences; Mahoney, J.M. [Alberta Environmental Protection, Lethbridge, AB (Canada)

    2000-06-01

    Cottonwoods have shown an adaptation to the riparian zone by coordinating root elongation to maintain contact with the water table, whose depth varies with the elevation of the adjacent river. The rate of water decline on growth allocation and concentrations of endogenous gibberellins (GAs) in black cottonwood saplings were studied at the University of Lethbridge, Alberta. Water declines were achieved by using rhizopods, and root elongation approximately doubled in response whereas leaf area was reduced. At some point, a greater water decline rate led to water stress resulting in reduced growth, increased leaf diffusive resistance, decreased water potential, and leaf senescence and abscission. After extraction of endogenous GAs, they were purified and analysed by gas chromatography-selected ion monitoring with internal ({sup 2}H{sub 2})GA standards. The results showed that GAs were higher in shoot tips and sequentially lower in basal stems, root tips, leaves and upper roots. Noticeable relationships did not appear between GA concentration and growth allocation across the water decline treatments. Only GA{sub 8} showed a consistent reduction in plants experiencing water table decline. This research did not permit the authors to conclude whether endogenous GAs play a primary role in the regulation of root elongation in response to water table decline. 7 figs., 25 refs.

  14. Growth of Populus and Salix Species under Compost Leachate Irrigation

    Directory of Open Access Journals (Sweden)

    Tooba Abedi

    2014-12-01

    Full Text Available According to the known broad variation in remediation capacity, three plant species were used in the experiment: two fast growing poplar’s clones - Populus deltoides, Populus euramericana, and willows Salix alba. Populus and Salix cuttings were collected from the nursery of the Populus Research Center of Safrabasteh in the eastern part of Guilan province at north of Iran. The Populus clones were chosen because of their high biomass production capacity and willow- because it is native in Iran. The highest diameter growth rate was exhibited for all three plant species by the 1:1 treatment with an average of 0.26, 0.22 and 0.16 cm in eight months period for P. euroamericana, P. deltoides and S. alba, respectively. Over a period of eight months a higher growth rate of height was observed in (P and (1:1 treatment for S. alba (33.70 and 15.77 cm, respectively and in (C treatment for P. deltoides (16.51 cm. P. deltoides and S. alba produced significantly (p<0.05 smaller aboveground biomass in (P treatment compared to all species. P. deltoides exhibited greater mean aboveground biomass in the (1:1 treatment compared to other species. There were significant differences (p<0.05 in the growth of roots between P. deltoides, P. euramericana and S. alba in all of the treatments.

  15. Efficient Agrobacterium-Mediated Transformation of Hybrid Poplar Populus davidiana Dode × Populus bollena Lauche

    Directory of Open Access Journals (Sweden)

    Xue Han

    2013-01-01

    Full Text Available Poplar is a model organism for high in vitro regeneration in woody plants. We have chosen a hybrid poplar Populus davidiana Dode × Populus bollena Lauche. By optimizing the Murashige and Skoog medium with (0.3 mg/L 6-benzylaminopurine and (0.08 mg/L naphthaleneacetic acid, we have achieved the highest frequency (90% for shoot regeneration from poplar leaves. It was also important to improve the transformation efficiency of poplar for genetic breeding and other applications. In this study, we found a significant improvement of the transformation frequency by controlling the leaf age. Transformation efficiency was enhanced by optimizing the Agrobacterium concentration (OD600 = 0.8–1.0 and an infection time (20–30 min. According to transmission electron microscopy observations, there were more Agrobacterium invasions in the 30-day-old leaf explants than in 60-day-old and 90-day-old explants. Using the green fluorescent protein (GFP marker, the expression of MD–GFP fusion proteins in the leaf, shoot, and root of hybrid poplar P. davidiana Dode × P. bollena Lauche was visualized for confirmation of transgene integration. Southern and Northern blot analysis also showed the integration of T-DNA into the genome and gene expression of transgenic plants. Our results suggest that younger leaves had higher transformation efficiency (~30% than older leaves (10%.

  16. Repeated unidirectional introgression towards Populus balsamifera in contact zones of exotic and native poplars

    NARCIS (Netherlands)

    Thompson, S.L.; Lamothe, M.; Meirmans, P.G.; Périnet, P.; Isabel, N.

    2010-01-01

    As the evolutionary significance of hybridization is largely dictated by its extent beyond the first generation, we broadly surveyed patterns of introgression across a sympatric zone of two native poplars (Populus balsamifera, Populus deltoides) in Quebec, Canada within which European exotic Populus

  17. Seems like I hardly see them around anymore: Historical geographies of Cottonwood decline along the Wind River

    Science.gov (United States)

    Cottonwoods—as well as the water birch, bull berry, and currants that flourish in their galleries—hold special significance for Tribes of the Intermountain American West. These species have served ceremonial and practical purposes for generations. Yet cottonwoods have experienced well-documented dec...

  18. Prevalence of LuxR- and LuxI-type quorum sensing circuits in members of the Populus deltoides microbiome

    Energy Technology Data Exchange (ETDEWEB)

    Schaefer, Amy L [University of Washington, Seattle; Lappala, Colin [University of Washington, Seattle; Morlen, Ryan [University of Washington, Seattle; Pelletier, Dale A [ORNL; Lu, Tse-Yuan [ORNL; Lankford, Patricia K [ORNL; Harwood, Caroline S [University of Washington, Seattle; Greenberg, E. Peter [University of Washington, Seattle

    2013-01-01

    We are interested in the root microbiome of the fast-growing Eastern cottonwood tree, Populus 25 deltoides. There is a large bank of bacterial isolates from P. deltoides and there are 44 draft 26 genomes of bacterial endophyte and rhizosphere isolates. As a first step in efforts to understand 27 the roles of bacterial communication and plant-bacterial signaling in P. deltoides we focused on 28 the prevalence of acyl-homoserine lactone (AHL) quorum sensing signal production and 29 reception in members of the P. deltoides microbiome. We screened 129 bacterial isolates for 30 AHL production using a broad-spectrum bioassay that responds to many but not all AHLs, and 31 we queried the available genome sequences of microbiome isolates for homologs of AHL 32 synthase and receptor genes. AHL signal production was detected in 40% of 129 strains tested. 33 Positive isolates included -, - and -Proteobacteria. Members of the luxI family of AHL 34 synthases were identified in 18 of 39 Proteobacteria genomes including genomes of some 35 isolates that tested negative in the bioassay. Members of the luxR family of transcription factors, 36 that include AHL-responsive factors, were more abundant than luxI homologs. There were 72 in 37 the 39 Proteobacteria genomes. Some of the luxR homologs appear to be members of a 38 subfamily of LuxRs that respond to as yet unknown plant signals rather than bacterial AHLs. 39 Apparently, there is a substantial capacity for AHL cell-to-cell communication in Proteobacteria 40 of the P. deltoides microbiota and there are also Proteobacteria with LuxR homologs of the type 41 hypothesized to respond to plant signals or cues.

  19. Climate, streamflow, and legacy effects on growth of riparian Populus angustifolia in the arid San Luis Valley, Colorado

    Science.gov (United States)

    Andersen, Douglas

    2016-01-01

    Knowledge of the factors affecting the vigor of desert riparian trees is important for their conservation and management. I used multiple regression to assess effects of streamflow and climate (12–14 years of data) or climate alone (up to 60 years of data) on radial growth of clonal narrowleaf cottonwood (Populus angustifolia), a foundation species in the arid, Closed Basin portion of the San Luis Valley, Colorado. I collected increment cores from trees (14–90 cm DBH) at four sites along each of Sand and Deadman creeks (total N = 85), including both perennial and ephemeral reaches. Analyses on trees <110 m from the stream channel explained 33–64% of the variation in standardized growth index (SGI) over the period having discharge measurements. Only 3 of 7 models included a streamflow variable; inclusion of prior-year conditions was common. Models for trees farther from the channel or over a deep water table explained 23–71% of SGI variability, and 4 of 5 contained a streamflow variable. Analyses using solely climate variables over longer time periods explained 17–85% of SGI variability, and 10 of 12 included a variable indexing summer precipitation. Three large, abrupt shifts in recent decades from wet to dry conditions (indexed by a seasonal Palmer Drought Severity Index) coincided with dramatically reduced radial growth. Each shift was presumably associated with branch dieback that produced a legacy effect apparent in many SGI series: uncharacteristically low SGI in the year following the shift. My results suggest trees in locations distant from the active channel rely on the regional shallow unconfined aquifer, summer rainfall, or both to meet water demands. The landscape-level differences in the water supplies sustaining these trees imply variable effects from shifts in winter-versus monsoon-related precipitation, and from climate change versus streamflow or groundwater management.

  20. The Populus Genome Integrative Explorer (PopGenIE): a new resource for exploring the Populus genome.

    Science.gov (United States)

    Sjödin, Andreas; Street, Nathaniel Robert; Sandberg, Göran; Gustafsson, Petter; Jansson, Stefan

    2009-06-01

    Populus has become an important model plant system. However, utilization of the increasingly extensive collection of genetics and genomics data created by the community is currently hindered by the lack of a central resource, such as a model organism database (MOD). Such MODs offer a single entry point to the collection of resources available within a model system, typically including tools for exploring and querying those resources. As a starting point to overcoming the lack of such an MOD for Populus, we present the Populus Genome Integrative Explorer (PopGenIE), an integrated set of tools for exploring the Populus genome and transcriptome. The resource includes genome, synteny and quantitative trait locus (QTL) browsers for exploring genetic data. Expression tools include an electronic fluorescent pictograph (eFP) browser, expression profile plots, co-regulation within collated transcriptomics data sets, and identification of over-represented functional categories and genomic hotspot locations. A number of collated transcriptomics data sets are made available in the eFP browser to facilitate functional exploration of gene function. Additional homology and data extraction tools are provided. PopGenIE significantly increases accessibility to Populus genomics resources and allows exploration of transcriptomics data without the need to learn or understand complex statistical analysis methods. PopGenIE is available at www.popgenie.org or via www.populusgenome.info.

  1. Genomics of Secondary Metabolism in Populus: Interactions with Biotic and Abiotic Environments

    Energy Technology Data Exchange (ETDEWEB)

    Chen, F.; Liu, C.; Tschaplinski, T. J.; Zhao, N.

    2009-09-01

    Populus trees face constant challenges from the environment during their life cycle. To ensure their survival and reproduction, Populus trees deploy various types of defenses, one of which is the production of a myriad of secondary metabolites. Compounds derived from the shikimate-phenylpropanoid pathway are the most abundant class of secondary metabolites synthesized in Populus. Among other major classes of secondary metabolites in Populus are terpenoids and fatty acid-derivatives. Some of the secondary metabolites made by Populus trees have been functionally characterized. Some others have been associated with certain biological/ecological processes, such as defense against insects and microbial pathogens or acclimation or adaptation to abiotic stresses. Functions of many Populus secondary metabolites remain unclear. The advent of various novel genomic tools will enable us to explore in greater detail the complexity of secondary metabolism in Populus. Detailed data mining of the Populus genome sequence can unveil candidate genes of secondary metabolism. Metabolomic analysis will continue to identify new metabolites synthesized in Populus. Integrated genomics that combines various 'omics' tools will prove to be the most powerful approach in revealing the molecular and biochemical basis underlying the biosynthesis of secondary metabolites in Populus. Characterization of the biological/ecological functions of secondary metabolites as well as their biosynthesis will provide knowledge and tools for genetically engineering the production of seconday metabolites that can lead to the generation of novel, improved Populus varieties.

  2. 2004 progress report : Effects of ungulate browsing on post-fire recovery of riparian cottonwoods : Implications for management of riparian forests, Seedskadee National Wildlife Refuge, Wyoming

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Browsing pressure by ungulates may limit natural establishment of native cottonwood and willow stands, and fires, which have become more frequent on riparian lands...

  3. Audubon National Wildlife Refuge, Lake Nettie National Wildlife Refuge, Camp Lake Easement Refuge, Wintering River Easement Refuge, Cottonwood Lake Easement Refuge, Sheyenne Lake Easement Refuge : Narrative report : 1969

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Audubon National Wildlife Refuge (including Lake Nettie National Wildlife Refuge, Camp Lake Easement Refuge, Cottonwood Lake...

  4. Micropropagation, genetic engineering, and molecular biology of Populus

    Science.gov (United States)

    N. B. Klopfenstein; Y. W. Chun; M. -S. Kim; M. A. Ahuja; M. C. Dillon; R. C. Carman; L. G. Eskew

    1997-01-01

    Thirty-four Populus biotechnology chapters, written by 85 authors, are comprised in 5 sections: 1) in vitro culture (micropropagation, somatic embryogenesis, protoplasts, somaclonal variation, and germplasm preservation); 2) transformation and foreign gene expression; 3) molecular biology (molecular/genetic characterization); 4) biotic and abiotic resistance (disease,...

  5. A new diterpenoid from the stem bark of Populus davidiana

    Institute of Scientific and Technical Information of China (English)

    Xin Feng Zhang; Xiang Li; Byung Sun Min; Ki Hwan Bae

    2008-01-01

    A new diterpenoid, named populusol A (1), was isolated from the methanolic extraction of the stem bark of Populus davidiana. The structure was elucidated on the basis of extensive 1D and 2D NMR as well as HRFAB-MS spectroscopic analysis.

  6. Conservation status of white poplar (Populus alba L. and black poplar (Populus nigra L. in the territory of Great War Island

    Directory of Open Access Journals (Sweden)

    Šijačić-Nikolić Mirjana

    2014-01-01

    Full Text Available T he paper describes t he conservation status of white poplar (Populus alba L. and black poplar (Populus nigra L. in the territory of Great War Island. The activities of in situ and ex situ gene pool conservation have been defined in order to preserve and expand the populations of the above species, as carriers of complex wetland forest ecosystems.

  7. Paraffin dispersant application for cleaning subsea flow lines in the deep water Gulf of Mexico cottonwood development

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, David; White, Jake; Pogoson, Oje [Baker Hughes Inc., Houston, TX (United States); Barros, Dalmo; Ramachandran, Kartik; Bonin, George; Waltrich, Paulo; Shecaira, Farid [PETROBRAS America, Houston, TX (United States); Ziglio, Claudio [Petroleo Brasileiro S.A. (CENPES/PETROBRAS), Rio de Janeiro, RJ (Brazil). Centro de Pesquisa e Desenvolvimento

    2012-07-01

    This paper discusses a paraffin dispersant (in seawater) application to clean paraffin deposition from a severely restricted 17.4-mile dual subsea flow line system in the Gulf of Mexico Cottonwood development. In principle, dispersant treatments are simple processes requiring effective dispersant packages and agitation to break-up and disperse deposition. Dispersants have been used onshore for treating wax deposition for decades. Implementation of a treatment in a long deep water production system, however, poses numerous challenges. The Cottonwood application was one of the first ever deep water dispersant applications. The application was designed in four separate phases: pre-treatment displacement for hydrate protection, dispersant treatment for paraffin deposition removal, pigging sequence for final flow line cleaning, and post-treatment displacement for hydrate protection. In addition, considerable job planning was performed to ensure the application was executed in a safe and environmentally responsible manner. Two dynamically positioned marine vessels were used for pumping fluids and capturing returns. The application was extremely successful in restoring the deep water flow lines back to near pre-production state. Final pigging operations confirmed the flow lines were cleaned of all restrictions. Significant paraffin deposition was removed in the application. Approximately 900 bbls of paraffin sludge was recovered from the 4000 bbl internal volume flow line loop. Furthermore, the application was completed with zero discharge of fluids. The application provided significant value for the Cottonwood development. It allowed production from wells to be brought on-line at a higher capacity, thereby generating increased revenue. It also allowed resumption of routine pigging operations. As such, the Cottonwood dispersant application illustrates that with proper planning and execution, paraffin dispersant treatments can be highly effective solutions for cleaning

  8. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume II Yakima (Overview, Report, Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  9. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume III (Overview and Tools).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  10. Above Ground Leafless Woody Biomass and Nutrient Content within Different Compartments of a P. maximowicii × P. trichocarpa Poplar Clone

    Directory of Open Access Journals (Sweden)

    Heinrich Spiecker

    2013-06-01

    Full Text Available In this study the quantification of biomass within all relevant compartments of a three-year-old poplar clone (P. maximowicii × P. trichocarpa planted on abandoned agricultural land at a density of 5000 trees ha−1 is presented. A total of 30 trees within a diameter range of 1.8 cm to 8.9 cm, at breast height (dbh at 1.3 m, were destructively sampled. In order to analyze the biomass, the complete tree, stem, as well as all branches, were divided into 1 cm diameter classes and all buds from the trees were completely removed. Total yield was calculated as 11.7 odt ha−1 year−1 (oven dry tonnes per hectare and year. Branches constituted 22.2% of total dry leafless biomass and buds 2.0%. The analyses revealed a strong correlation of the dry weight for all the three compartments with diameter at breast height. Debarked sample discs were used to obtain a ratio between wood and bark. Derived from these results, a model was developed to calculate the biomass of bark with dbh as the predictor variable. Mean bark percentage was found to be 16.8% of above ground leafless biomass. The results concur that bark percentage decreases with increasing tree diameter, providing the conclusion that larger trees contain a lower bark proportion, and thus positively influence the quality of the end product while consequently reducing the export of nutrients from site.

  11. Towards a map of the Populus biomass protein-protein interaction network

    Energy Technology Data Exchange (ETDEWEB)

    Beers, Eric [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Brunner, Amy [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Helm, Richard [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Dickerman, Allan [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States)

    2015-07-31

    Biofuels can be produced from a variety of plant feedstocks. The value of a particular feedstock for biofuels production depends in part on the degree of difficulty associated with the extraction of fermentable sugars from the plant biomass. The wood of trees is potentially a rich source fermentable sugars. However, the sugars in wood exist in a tightly cross-linked matrix of cellulose, hemicellulose, and lignin, making them largely recalcitrant to release and fermentation for biofuels production. Before breeders and genetic engineers can effectively develop plants with reduced recalcitrance to fermentation, it is necessary to gain a better understanding of the fundamental biology of the mechanisms responsible for wood formation. Regulatory, structural, and enzymatic proteins are required for the complicated process of wood formation. To function properly, proteins must interact with other proteins. Yet, very few of the protein-protein interactions necessary for wood formation are known. The main objectives of this project were to 1) identify new protein-protein interactions relevant to wood formation, and 2) perform in-depth characterizations of selected protein-protein interactions. To identify relevant protein-protein interactions, we cloned a set of approximately 400 genes that were highly expressed in the wood-forming tissue (known as secondary xylem) of poplar (Populus trichocarpa). We tested whether the proteins encoded by these biomass genes interacted with each other in a binary matrix design using the yeast two-hybrid (Y2H) method for protein-protein interaction discovery. We also tested a subset of the 400 biomass proteins for interactions with all proteins present in wood-forming tissue of poplar in a biomass library screen design using Y2H. Together, these two Y2H screens yielded over 270 interactions involving over 75 biomass proteins. For the second main objective we selected several interacting pairs or groups of interacting proteins for in

  12. Functional Gene Discovery and Characterization of Genes and Alleles Affecting Wood Biomass Yield and Quality in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Busov, Victor [Michigan Technological Univ., Houghton, MI (United States)

    2017-02-12

    Adoption of biofuels as economically and environmentally viable alternative to fossil fuels would require development of specialized bioenergy varieties. A major goal in the breeding of such varieties is the improvement of lignocellulosic biomass yield and quality. These are complex traits and understanding the underpinning molecular mechanism can assist and accelerate their improvement. This is particularly important for tree bioenergy crops like poplars (species and hybrids from the genus Populus), for which breeding progress is extremely slow due to long generation cycles. A variety of approaches have been already undertaken to better understand the molecular bases of biomass yield and quality in poplar. An obvious void in these undertakings has been the application of mutagenesis. Mutagenesis has been instrumental in the discovery and characterization of many plant traits including such that affect biomass yield and quality. In this proposal we use activation tagging to discover genes that can significantly affect biomass associated traits directly in poplar, a premier bioenergy crop. We screened a population of 5,000 independent poplar activation tagging lines under greenhouse conditions for a battery of biomass yield traits. These same plants were then analyzed for changes in wood chemistry using pyMBMS. As a result of these screens we have identified nearly 800 mutants, which are significantly (P<0.05) different when compared to wild type. Of these majority (~700) are affected in one of ten different biomass yield traits and 100 in biomass quality traits (e.g., lignin, S/G ration and C6/C5 sugars). We successfully recovered the position of the tag in approximately 130 lines, showed activation in nearly half of them and performed recapitulation experiments with 20 genes prioritized by the significance of the phenotype. Recapitulation experiments are still ongoing for many of the genes but the results are encouraging. For example, we have shown successful

  13. Impact of Drying Methods on Wettability of Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Plantation poplar is one of the most important resources for wood industry, its utilization field is vast. The wettability of Populus tomentosa with different drying methods was judged by measurement of contact angle using distilled water in this paper. The results showed that the specimens from conventional drying have the biggest contact angle, and the air dried have the smallest contact angle, air dried lumbers have a better wettability than the kiln dried. The changes of contact angle in a period of tim...

  14. Stress-responsive hydroxycinnamate glycosyltransferase modulates phenylpropanoid metabolism in Populus

    OpenAIRE

    2014-01-01

    The diversity of phenylpropanoids offers a rich inventory of bioactive chemicals that can be exploited for plant improvement and human health. Recent evidence suggests that glycosylation may play a role in the partitioning of phenylpropanoid precursors for a variety of downstream uses. This work reports the functional characterization of a stress-responsive glycosyltransferase, GT1-316 in Populus. GT1-316 belongs to the UGT84A subfamily of plant glycosyltransferase family 1 and is designated ...

  15. Using Populus as a lignocellulosic feedstock for bioethanol.

    Science.gov (United States)

    Porth, Ilga; El-Kassaby, Yousry A

    2015-04-01

    Populus species along with species from the sister genus Salix will provide valuable feedstock resources for advanced second-generation biofuels. Their inherent fast growth characteristics can particularly be exploited for short rotation management, a time and energy saving cultivation alternative for lignocellulosic feedstock supply. Salicaceae possess inherent cell wall characteristics with favorable cellulose to lignin ratios for utilization as bioethanol crop. We review economically important traits relevant for intensively managed biofuel crop plantations, genomic and phenotypic resources available for Populus, breeding strategies for forest trees dedicated to bioenergy provision, and bioprocesses and downstream applications related to opportunities using Salicaceae as a renewable resource. Challenges need to be resolved for every single step of the conversion process chain, i.e., starting from tree domestication for improved performance as a bioenergy crop, bioconversion process, policy development for land use changes associated with advanced biofuels, and harvest and supply logistics associated with industrial-scale biorefinery plants using Populus as feedstock. Significant hurdles towards cost and energy efficiency, environmental friendliness, and yield maximization with regards to biomass pretreatment, saccharification, and fermentation of celluloses and the sustainability of biorefineries as a whole still need to be overcome.

  16. 拟南芥、水稻和毛果杨中CesA基因的进化和表达分析%Phylogenetic and expression analysis of CesA genes in Arabidopsis thaliana, Oryza sativa and Populus trichocarpa

    Institute of Scientific and Technical Information of China (English)

    朱煜; 谭梦月; 邹爱兰; 张文举; 戚金亮; 杨永华

    2013-01-01

    纤维素是植物细胞壁的主要成分,纤维素合成酶是纤维素合成过程中重要的酶类.利用拟南芥(草本植物)、水稻(禾本科作物)、毛果杨(木本植物)3种已知全基因组序列的模式植物,对纤维素合成酶基因(CesA)家族的成员进行系统分析,了解CesA基因超基因家族的进化关系.研究结果表明,CesA基因在物种分化之前就已经存在,并且在各个物种内部出现了基因扩张,不同物种扩张程度不同,整个基因家族呈负选择压力.为进一步探讨该家族基因的表达调控模式,以水稻为例对该基因家族的启动子元件进行了分析,发现OsCesA基因可能受到多种胁迫和激素信号的调控;而RT-PCR结果表明ABA可以显著下调该类基因的表达.

  17. Analysis of the Correlation between the Geographical Distribution of Populus euphratica Oliv. and the Climatic Environment

    Institute of Scientific and Technical Information of China (English)

    Yinke YANG; Zhenglong YAN

    2012-01-01

    [Objective] This research was to study the correlation regional climatic characteristics and changing geographic distribution of Populus euphratica Oily. (Sali- caceae), as well as the adaption of Populus euphratica Oliv. to the climatic environ- ment. [Method] The climatic characteristics, water source, groundwater and soil type in the distribution regions of Populus euphratica Oliv. and the effect of long-term hu- man activities were comprehensively analyzed based an overview of Populus eu- phratica Oliv. and its distribution. [Result] Specific regional climatic characteristics and long term human activities are the principle determinants for the growth of Populus euphratica Oliv. The change of leaf shape is a distinct feature of Populus euphratica Oliv. in adapting to the climatic environment. Populus euphratica Oliv. withstands various environmental stresses by means of in vivo synthesis, transport and conver- sion of secondary phenolic metabolites. Effective protection and rehabilitation mea- sures, and ecological water transport have obvious effect on the restoration and re- construction of damaged ecological environment of Populus euphratica oasis. [Con- clusion] This study is of great significance for the restoration of ecological environ- ment in the arid inland regions, north-west China.

  18. Effect of Alnus glutinosa on hybrid populus growth and soil nitrogen concentration in a mixed plantation

    Science.gov (United States)

    Jeffrey O. Dawson; Edward A. Hansen

    1983-01-01

    Height growth of hybrid Populusand soil nitrogen concentration around Alnus glutinosa stems differed significantly both spatially and with the Alnus/Populus mixture in a short-rotation intensively cultured mixed planting. Populus height growth comparable to that obtained from optimal rates of...

  19. Glycosylation-mediated phenylpropanoid partitioning in Populus tremuloides cell cultures

    Directory of Open Access Journals (Sweden)

    Babst Benjamin A

    2009-12-01

    Full Text Available Abstract Background Phenylpropanoid-derived phenolic glycosides (PGs and condensed tannins (CTs comprise large, multi-purpose non-structural carbon sinks in Populus. A negative correlation between PG and CT concentrations has been observed in several studies. However, the molecular mechanism underlying the relationship is not known. Results Populus cell cultures produce CTs but not PGs under normal conditions. Feeding salicyl alcohol resulted in accumulation of salicins, the simplest PG, in the cells, but not higher-order PGs. Salicin accrual reflected the stimulation of a glycosylation response which altered a number of metabolic activities. We utilized this suspension cell feeding system as a model for analyzing the possible role of glycosylation in regulating the metabolic competition between PG formation, CT synthesis and growth. Cells accumulated salicins in a dose-dependent manner following salicyl alcohol feeding. Higher feeding levels led to a decrease in cellular CT concentrations (at 5 or 10 mM, and a negative effect on cell growth (at 10 mM. The competition between salicin and CT formation was reciprocal, and depended on the metabolic status of the cells. We analyzed gene expression changes between controls and cells fed with 5 mM salicyl alcohol for 48 hr, a time point when salicin accumulation was near maximum and CT synthesis was reduced, with no effect on growth. Several stress-responsive genes were up-regulated, suggestive of a general stress response in the fed cells. Salicyl alcohol feeding also induced expression of genes associated with sucrose catabolism, glycolysis and the Krebs cycle. Transcript levels of phenylalanine ammonia lyase and most of the flavonoid pathway genes were reduced, consistent with down-regulated CT synthesis. Conclusions Exogenous salicyl alcohol was readily glycosylated in Populus cell cultures, a process that altered sugar utilization and phenolic partitioning in the cells. Using this system, we

  20. A Novel Antioxidant Phenyl Disaccharide from Populus tremula Knotwood

    Directory of Open Access Journals (Sweden)

    Bjarne Holmbom

    2007-02-01

    Full Text Available The complete characterization of two compounds obtained from the acetoneextract of Populus tremula knotwood has been was achieved using LC-DAD-MS,MS/MS, IR and NMR. The new compounds were unequivocally identified as a mixtureof the ester isomers of the (E and (Z p-coumarate of 1-O-rutinose. The isomers showedthe capacity to inhibit lipid peroxidation induced by tert-butylhydroperoxide and to trapperoxyl radicals, as determined by a chemiluminescence method. These new phenyldisaccharides also showed a significant ORAC (oxygen radical absorbance capacityvalue, i.e. 11.7 μM TE (Trolox Equivalents.

  1. Response of Populus x canescens (Populus tremula x alba) to high concentration of NaCl stress

    Institute of Scientific and Technical Information of China (English)

    GAO Jian; PENG Zhen-hua

    2006-01-01

    Populus x canescens was cultivated on solid substrate and treated by salt (150 mM NaCl). The growth parametersincluding new leaf formation, height increment, diameter at the base increment, fresh and dry mass of leaf, stem, coarse root, and fine root were determined. The nutrient elements in leaves of samples under salt stress and the control, and the chlorophyll fluorescence of plants separated dark and light, initial fluorescence (Fo), and maximum fluorescence (Fm) were measured. Results showed that 150 mM NaCl treatment resulted in growth reduction of Populus x canescens. Nutrient element contents in the foliage of plants under salt stress were different from that of control. The foliar N-concentrations of plants under salt stress were not affected. Contents of Na under salt stress were 120 times as much as that under control. However, contents of S, K, P, Ca, Mg, Fe, Mn under salt stress were less than that under control. Salt stress caused damage in the PSII reaction centers, i.e. photo-inhibition couldn't be repaired under dark situation. The yield of chlorophyll fluorescence showed that several parameters associated with PSII functions, e.g. Fv/Fo, Fv/Fm were not influenced at the first stage of salt stress treatment. However, after a period of time, PSII functions were significantly inhibited, which led to the decrease of carbon assimilation. These results suggest that salt stress (150 mM NaCl) did not affect photosynthetic chlorophyll fluorescence of Populus x canescens immediately. After four day of salt stress, PSII reaction centres were seriously damaged during photo-inhibition.

  2. Flooding Regime Impacts on Radiation, Evapotranspiration, and Latent Energy Fluxes over Groundwater-Dependent Riparian Cottonwood and Saltcedar Forests

    Directory of Open Access Journals (Sweden)

    James Cleverly

    2015-01-01

    Full Text Available Radiation and energy balances are key drivers of ecosystem water and carbon cycling. This study reports on ten years of eddy covariance measurements over groundwater-dependent ecosystems (GDEs in New Mexico, USA, to compare the role of drought and flooding on radiation, water, and energy budgets of forests differing in species composition (native cottonwood versus nonnative saltcedar and flooding regime. After net radiation (700–800 W m−2, latent heat flux was the largest energy flux, with annual values of evapotranspiration exceeding annual precipitation by 250–600%. Evaporative cooling dominated the energy fluxes of both forest types, although cottonwood generated much lower daily values of sensible heat flux (<−5 MJ m−2 d−1. Drought caused a reduction in evaporative cooling, especially in the saltcedar sites where evapotranspiration was also reduced, but without a substantial decline in depth-to-groundwater. Our findings have broad implications on water security and the management of native and nonnative vegetation within semiarid southwestern North America. Specifically, consideration of the energy budgets of GDEs as they respond to fluctuations in climatic conditions can inform the management options for reducing evapotranspiration and maintaining in-stream flow, which is legally mandated as part of interstate and international water resources agreements.

  3. Water-Quality Characteristics of Cottonwood Creek, Taggart Creek, Lake Creek, and Granite Creek, Grand Teton National Park, Wyoming, 2006

    Science.gov (United States)

    Clark, Melanie L.; Wheeler, Jerrod D.; O'Ney, Susan E.

    2007-01-01

    To address water-resource management objectives of the National Park Service in Grand Teton National Park, the U.S. Geological Survey in cooperation with the National Park Service has conducted water-quality sampling on streams in the Snake River headwaters area. A synoptic study of streams in the western part of the headwaters area was conducted during 2006. Sampling sites were located on Cottonwood Creek, Taggart Creek, Lake Creek, and Granite Creek. Sampling events in June, July, August, and October were selected to characterize different hydrologic conditions and different recreational-use periods. Stream samples were collected and analyzed for field measurements, major-ion chemistry, nutrients, selected trace elements, pesticides, and suspended sediment. Water types of Cottonwood Creek, Taggart Creek, Lake Creek, and Granite Creek were calcium bicarbonate. Dissolved-solids concentrations were dilute in Cottonwood Creek and Taggart Creek, which drain Precambrian-era rocks and materials derived from these rocks. Dissolved-solids concentrations ranged from 11 to 31 milligrams per liter for samples collected from Cottonwood Creek and Taggart Creek. Dissolved-solids concentrations ranged from 55 to 130 milligrams per liter for samples collected from Lake Creek and Granite Creek, which drain Precambrian-era rocks and Paleozoic-era rocks and materials derived from these rocks. Nutrient concentrations generally were small in samples collected from Cottonwood Creek, Taggart Creek, Lake Creek, and Granite Creek. Dissolved-nitrate concentrations were the largest in Taggart Creek. The Taggart Creek drainage basin has the largest percentage of barren land cover of the basins, and subsurface waters of talus slopes may contribute to dissolved-nitrate concentrations in Taggart Creek. Pesticide concentrations, trace-element concentrations, and suspended-sediment concentrations generally were less than laboratory reporting levels or were small for all samples. Water

  4. Initial characterization of shade avoidance response suggests functional diversity between Populus phytochrome B genes.

    Energy Technology Data Exchange (ETDEWEB)

    Karve, Abhijit A [ORNL; Weston, David [ORNL; Jawdy, Sara [ORNL; Gunter, Lee E [ORNL; Allen, Sara M [ORNL; Yang, Xiaohan [ORNL; Wullschleger, Stan D [ORNL; Tuskan, Gerald A [ORNL

    2012-01-01

    Shade avoidance signaling in higher plants involves perception of the incident red/far-red (R/FR) light by phytochromes and the modulation of downstream transcriptional networks to regulate developmental plasticity in relation to heterogeneous light environments. In this study, we characterized the expression and functional features of Populus phytochrome (PHY) gene family as well as the transcriptional responses of Populus to the changes in R/FR light. Expression data indicated that PHYA is the predominant PHY in the dark grown Populus seedling whereas PHYBs are most abundant in mature tissue types. Out of three Populus PHYs, PHYA is light labile and localized to cytosol in dark whereas both PHYB1 and PHYB2 are light stable and are localized to nucleus in mesophyll protoplasts. When expressed in Arabidopsis, PHYB1 rescued Arabidopsis phyB mutant phenotype whereas PHYB2 did not, suggesting functional diversification between these two gene family members. However, phenotypes of transgenic Populus lines with altered expression of PHYB1, PHYB2 or both and the expression of candidate shade response genes in these transgenic lines suggest that PHYB1 and PHYB2 may have distinct yet overlapping functions. The RNAseq results and analysis of Populus exposed to enriched-FR light indicate that genes associated in cell wall modification and brassinosteroid signaling were induced under far red light. Overall our data indicate that Populus transcriptional responses are at least partially conserved with Arabidopsis.

  5. Differential allelopathic effects of Japanese knotweed on willow and cottonwood cuttings used in riverbank restoration techniques.

    Science.gov (United States)

    Dommanget, Fanny; Evette, André; Spiegelberger, Thomas; Gallet, Christiane; Pacé, Marine; Imbert, Marika; Navas, Marie-Laure

    2014-01-01

    Using bioengineering techniques to restore areas invaded by Fallopia japonica shows promising results. Planting tree cuttings could allow both rapidly re-establishing a competitive native plant community and reducing F. japonica performance. However, F. japonica has been shown to affect native plant species through different mechanisms such as allelopathy. This article investigates the phytotoxic effect of F. japonica on the resprouting capacity and the growth of three Salicaceae species with potential value for restoration. An experimental design which physically separates donor pots containing either an individual from F. japonica or bare soil from target pots containing cuttings of Populus nigra, Salix atrocinerea or Salix viminali was used. Leachates from donor pots were used to water target pots. The effects of leachates were evaluated by measuring the final biomass of the cuttings. F. japonica leachates inhibited the growth of cuttings, and this effect is linked to the emission of polyphenol compounds by F. japonica. Leachates also induced changes in soil nitrogen composition. These results suggest the existence of allelopathic effects, direct and/or indirect, of F. japonica on the growth of Salicaceae species cuttings. However, the three species were not equally affected, suggesting that the choice of resistant species could be crucial for restoration success. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Populus euphratica, a Tolerant Model but Endangered Arborescent Species

    Institute of Scientific and Technical Information of China (English)

    Gu Ruisheng; Pei Dong

    2005-01-01

    @@ Populus euphratica is a most tolerant arborescent species to abiotic stress. It can adapt to extreme conditions, ranging from flood to atmosphere extremely dry, hot from + 54 ℃ to - 45 ℃, and from normal soil to the soil with very high salt concentration ( to 2 ~5%) although being a non-halophyte. However, the natural stands of P. euphratica have been shrinking tremendously for the past decades and some populations are facing the fate of extinction. The preservation of existing resources should be carried out as a burning issue. In parallel, P. euphratica could be taken as a model plant to explore the molecular mechanism of abiotic-stress tolerance and to exploit its tolerant genes due to its smaller genome and easy molecular manipulation. The measures for preservation, germ-plasma exploitation, tolerance mechanism exploration and resource utilization were also discussed in this paper.

  7. Establishment of cell suspension line of Populus tomentosa Carr

    Institute of Scientific and Technical Information of China (English)

    YAO Na; ZHANG Zhi-yi; AN Xin-min; YANG Kai

    2008-01-01

    Leaves of fine Populus tomentosa genotype TC152 were used as explants to establish cell suspension lines. The effects of plant growth regulators on callus induction and establishment of cell suspension lines were studied. The callus induction rate was the highest on a MS solid medium supplemented with 1.0 mg·L-1 2,4-D. A cell suspension line could be obtained by inoculating calli which were not subeultured into a MS liquid medium supplemented with 1.5 mg·L-1 2,4-D. The best subculture medium was MS+ 0.8 mg·L-1 2,4-D + 30 g·L-1 sucrose with a subculture cycle of seven days.

  8. Variation of Leaf Characteristics in Populus tomentosa Carr.

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    An investigation was conducted to determine the extent of variations among nine provenances of Populus tomentosa Carr. in terms of leaf characteristics. A total of 263 accessions were studied under field conditions in the National Gene Bank of P. tomentosa in 2003. All of the accessions were characterized by 17 indices from 1 to 2-dimension constructions. Variance analysis of all characteristics showed that there were significant differences among the nine provenances and among individuals within each provenance. This study reveals that the evaluated germplasm appears to have a wide genetic base and high potential for further genetic improvements and it also indicates that abundant gene resources of P. tomentosa have been collected and preserved in the National Gene Bank.

  9. RAPD markers related to sex locus in Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    Wanwei HOU; Junfeng FAN; Feimei ZHOU; Shufang ZHAO

    2009-01-01

    By using the methods of random amplified polymorphic DNA (RAPD) and bulked segregate analysis (BSA), we identified markers that are linked to the sex determination in the dioecious Populus tomentosa. Male and female bulks were created through rough mixing equal amounts of its five individual DNA. A total of 88 primers were screened. Twelve primers produced clear patterns with at least one band that appeared to be polymorphic between the two bulks. Subsequently, five male and female individuals were analyzed with those 12 primers, and only S60 (ACCCGGTCAC) could generate a common 1800bp DNA fragment in all five male individuals and male pool but not in any female individuals. It can be concluded that the gender of P. tomentosa is most likely connected to the S60-1800bp DNA fragment and RAPD markers. S60, therefore, can be used for selecting the gender of P. tomentosa.

  10. [Application of Populus Nigra preparations at experimental parodontitis].

    Science.gov (United States)

    Kipiani, N V; Kuchukhidze, Dzh K; Chichua, Z Dzh; Kipiani, V A; Datunashvili, I V

    2007-09-01

    Severe oxidative stress, developed under experimental periodontitis is accompanied by disturbances in mitochondrial respiration in tissue cells of gingiva, membrane damage and release of Fe(2+) and Mn(2+), leading to the worsening of inflammation process and gingival tissue necrosis. Reduction of free nitric oxide in gingival tissue appeared to be characteristic for experimental parodontitis: decreases local immunity, antimicrobial resistance, and tissue regeneration, disturbs blood supply and tissue trophism, which forwards important role in deepening of inflammation process and wasting of gingival tissue. Application of preparations derived from black poplar (Populus Nigra) gemma standardizes mitochondrial respiration, reduces presentation of inflammation, and considerably improves EPR-spectrum of gingival tissue. Though the complete normalization is not achieved--hazard of peroxidation still remains, the applied preparations, due to their strong anti- oxidative and anti-inflammatory activities is as an effective and rehabilitative means to tackle gingivitis and peiodontitis.

  11. Cross Breeding of Populus and Its Hybrids for Cold Resistance

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Populus tomentosa was crossed with P. tremuloidis, P. grandidentata, P. alba × P. grandidentata and P. alba × Ulmus pumila in order to maintain its rapid growth and high wood quality and improve its resistance to cold. Two methods were used to increase the germination rate from 1.5% to 41.1% and the remaining rate from 1.7% to 44.2%. Forty crossing combinations were conducted and 2 744 hybrid seedlings were obtained. MX4 × P. grandidentata (G-1-58), MX3 × P. tremuloidis (T-44-60), MX2 × P. tremuloidis (l-13-87-37) and MX2 × (P. alba × P. grandidentata) were regarded as superior combinations after analysis and selection. Thirty seedlings of these combinations and 11 triploid seedlings identified by counting their chromosomes were selected as super plants.

  12. Stress-responsive hydroxycinnamate glycosyltransferase modulates phenylpropanoid metabolism in Populus.

    Science.gov (United States)

    Babst, Benjamin A; Chen, Han-Yi; Wang, Hong-Qiang; Payyavula, Raja S; Thomas, Tina P; Harding, Scott A; Tsai, Chung-Jui

    2014-08-01

    The diversity of phenylpropanoids offers a rich inventory of bioactive chemicals that can be exploited for plant improvement and human health. Recent evidence suggests that glycosylation may play a role in the partitioning of phenylpropanoid precursors for a variety of downstream uses. This work reports the functional characterization of a stress-responsive glycosyltransferase, GT1-316 in Populus. GT1-316 belongs to the UGT84A subfamily of plant glycosyltransferase family 1 and is designated UGT84A17. Recombinant protein analysis showed that UGT84A17 is a hydroxycinnamate glycosyltransferase and able to accept a range of unsubstituted and substituted cinnamic and benzoic acids as substrates in vitro. Overexpression of GT1-316 in transgenic Populus led to plant-wide increases of hydroxycinnamoyl-glucose esters, which were further elevated under N-limiting conditions. Levels of the two most abundant flavonoid glycosides, rutin and kaempferol-3-O-rutinoside, decreased, while levels of other less abundant flavonoid and phenylpropanoid conjugates increased in leaves of the GT1-316-overexpressing plants. Transcript levels of representative phenylpropanoid pathway genes were unchanged in transgenic plants, supporting a glycosylation-mediated redirection of phenylpropanoid carbon flow as opposed to enhanced phenylpropanoid pathway flux. The metabolic response of N-replete transgenic plants overlapped with that of N-stressed wild types, as the majority of phenylpropanoid derivatives significantly affected by GT1-316 overexpression were also significantly changed by N stress in the wild types. These results suggest that UGT84A17 plays an important role in phenylpropanoid metabolism by modulating biosynthesis of hydroxycinnamoyl-glucose esters and their derivatives in response to developmental and environmental cues.

  13. Effects of Fertilization Treatments on Plantation Growth of Triploid Clones in Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    Wang Lixian; Liu Yong; Zhang Zhiyi

    2003-01-01

    With four clones of triploid Populus tomentosa as materials, the effects of fertilization treatment on growth and physiological characters in terms of leaf nitrogen content, phosphorous content, potassium content, net photosynthetic rate, transpiration rate, water utilization efficiency and chlorophyll content have been studied. Compared with the general fertilizer as a control, the long-effect fertilizer, especially for Populus, produce more favorable results, for P. tomentosa on sandy land.

  14. Ozone-induced changes in carotenoids and chlorophylls in three Populus clones

    OpenAIRE

    Keski-Saari, Sarita; Dumont, Jennifer; Keinänen, Markku; Kontunen-Soppela, Sari; Oksanen, Elina; Le Thiec, Didier

    2011-01-01

    Ozone is a phytotoxic air pollutant causing oxidative stress. We studied the effect of ozone on carotenoids, chlorophylls and polyisoprenoid alcohols in three euramerican poplar clones (Populus deltoides x Populus nigra: 'Carpaccio', 'Cima' and 'Robusta'). Poplars originating from cuttings were grown for 6 weeks and exposed to ozone in fumigation chambers (120 ppb each day for 13h). Leaf samples were collected 2, 4, 11, 15 and 17 days after the start of ozone treatment. Chemical analyses were...

  15. Glycosylation-mediated phenylpropanoid partitioning in Populus tremuloides cell cultures

    OpenAIRE

    2009-01-01

    Abstract Background Phenylpropanoid-derived phenolic glycosides (PGs) and condensed tannins (CTs) comprise large, multi-purpose non-structural carbon sinks in Populus. A negative correlation between PG and CT concentrations has been observed in several studies. However, the molecular mechanism underlying the relationship is not known. Results Populus cell cultures produce CTs but not PGs under normal conditions. Feeding salicyl alcohol resulted in accumulation of salicins, the simplest PG, in...

  16. Audubon National Wildlife Refuge, Lake Nettie National Wildlife Refuge, Camp-Strawberry Lake Easement Refuge, Cottonwood Lake Easement Refuge, Wintering River Easement Refuge, Sheyenne Lake Easement Refuge : Narrative report : 1968

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Audubon National Wildlife Refuge (including Lake Nettie National Wildlife Refuge, Camp-Strawberry Lake Easement Refuge, Cottonwood...

  17. Audubon National Wildlife Refuge, Lake Nettie National Wildlife Refuge, Camp Lake Easement Refuge, Wintering River Easement Refuge, Cottonwood Lake Easement Refuge, Sheyenne Lake Easement Refuge, Lake Otis Easement Refuge : Narrative report : 1970

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Audubon National Wildlife Refuge (including Lake Nettie National Wildlife Refuge, Camp Lake Easement Refuge, Cottonwood Lake...

  18. Protein (Viridiplantae): 613798 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 601 3688:1895 ... 238069:1895 ... 3689:1895 ... 3694:1895 ... hypothetical protein POPTR_0005s01830g Populus trichocarpa MARIFRGNETQANTDRIVGAHGYMSPEYAMEGLFSIKSDVFSFGLLVLEIVSAGASSVTNVTITAIDAR

  19. Protein (Viridiplantae): 761681 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3688:2831 ... 238069:2831 ... 3689:2831 ... 3694:2831 ... caprice family protein Populus trichocarpa MDRRRKKQAKTTSCCSEQEVSSIEWEFINMSEQEEDLIYRMHNLVGDRWALIAGRIPGRKAEEIERFWLMRHGEGFASRRREQKRCHS

  20. Protein (Viridiplantae): 400303 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 19 3688:327 ... 238069:327 ... 3689:327 ... 3694:327 ... zinc finger family protein Populus trichocarpa MKGCELCGSSARM...FCESDEASLCWDCDEKVHSANFLVAKHCRTLLCQVCQSPTPWKASVSKFAPTVSICESCFTIPNKTKETEERMKGCELCGSSARM

  1. Identification of shared single copy nuclear genes in Arabidopsis, Populus, Vitis and Oryza and their phylogenetic utility across various taxonomic levels

    Directory of Open Access Journals (Sweden)

    Ma Hong

    2010-02-01

    Full Text Available Abstract Background Although the overwhelming majority of genes found in angiosperms are members of gene families, and both gene- and genome-duplication are pervasive forces in plant genomes, some genes are sufficiently distinct from all other genes in a genome that they can be operationally defined as 'single copy'. Using the gene clustering algorithm MCL-tribe, we have identified a set of 959 single copy genes that are shared single copy genes in the genomes of Arabidopsis thaliana, Populus trichocarpa, Vitis vinifera and Oryza sativa. To characterize these genes, we have performed a number of analyses examining GO annotations, coding sequence length, number of exons, number of domains, presence in distant lineages, such as Selaginella and Physcomitrella, and phylogenetic analysis to estimate copy number in other seed plants and to demonstrate their phylogenetic utility. We then provide examples of how these genes may be used in phylogenetic analyses to reconstruct organismal history, both by using extant coverage in EST databases for seed plants and de novo amplification via RT-PCR in the family Brassicaceae. Results There are 959 single copy nuclear genes shared in Arabidopsis, Populus, Vitis and Oryza ["APVO SSC genes"]. The majority of these genes are also present in the Selaginella and Physcomitrella genomes. Public EST sets for 197 species suggest that most of these genes are present across a diverse collection of seed plants, and appear to exist as single or very low copy genes, though exceptions are seen in recently polyploid taxa and in lineages where there is significant evidence for a shared large-scale duplication event. Genes encoding proteins localized in organelles are more commonly single copy than expected by chance, but the evolutionary forces responsible for this bias are unknown. Regardless of the evolutionary mechanisms responsible for the large number of shared single copy genes in diverse flowering plant lineages, these

  2. Identification of shared single copy nuclear genes in Arabidopsis, Populus, Vitis and Oryza and their phylogenetic utility across various taxonomic levels

    Science.gov (United States)

    2010-01-01

    Background Although the overwhelming majority of genes found in angiosperms are members of gene families, and both gene- and genome-duplication are pervasive forces in plant genomes, some genes are sufficiently distinct from all other genes in a genome that they can be operationally defined as 'single copy'. Using the gene clustering algorithm MCL-tribe, we have identified a set of 959 single copy genes that are shared single copy genes in the genomes of Arabidopsis thaliana, Populus trichocarpa, Vitis vinifera and Oryza sativa. To characterize these genes, we have performed a number of analyses examining GO annotations, coding sequence length, number of exons, number of domains, presence in distant lineages, such as Selaginella and Physcomitrella, and phylogenetic analysis to estimate copy number in other seed plants and to demonstrate their phylogenetic utility. We then provide examples of how these genes may be used in phylogenetic analyses to reconstruct organismal history, both by using extant coverage in EST databases for seed plants and de novo amplification via RT-PCR in the family Brassicaceae. Results There are 959 single copy nuclear genes shared in Arabidopsis, Populus, Vitis and Oryza ["APVO SSC genes"]. The majority of these genes are also present in the Selaginella and Physcomitrella genomes. Public EST sets for 197 species suggest that most of these genes are present across a diverse collection of seed plants, and appear to exist as single or very low copy genes, though exceptions are seen in recently polyploid taxa and in lineages where there is significant evidence for a shared large-scale duplication event. Genes encoding proteins localized in organelles are more commonly single copy than expected by chance, but the evolutionary forces responsible for this bias are unknown. Regardless of the evolutionary mechanisms responsible for the large number of shared single copy genes in diverse flowering plant lineages, these genes are valuable for

  3. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume I Kootenai River (Overview, Report and Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  4. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume I Kootenai River (Overview, Report and Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  5. Lignin Characterization of Triploid Clones of Populus tomentosa Carr.

    Institute of Scientific and Technical Information of China (English)

    Jin Xiao-juan; Pu Jun-wen; Xie Yi-min; Takeshi Furuno; Liu Xin-yu

    2005-01-01

    In order to understand the structural characteristics of lignin in triploid clones ofPopulus tomentosa and its changes in the processes of pulping and bleaching, milled wood lignin (MWL), lignin carbohydrate complex (LCC) and the residual lignin from kraft pulp (KP) and sulfite pulp (SP) were isolated and analyzed by Fourier transform infrared (FTIR) spectrum and 13C nuclear magnetic resonance (NMR). The most diagnostic peaks were assigned and the differences were discussed. The spectral patterns reveal that triploid P. tomentosa shows the specific features of hardwood from temperate areas, but in the spectrum of FTIR, the strength ratio of A1270 cm-1 to A1226 cm-1 is 0.88, higher than the average of hardwood from temperate areas, which will make the lignin delignification more difficult during pulping and bleaching. The LCC from triploid P. tomentosa is mainly composed of xyloglucan and glucuronic acid, and other glucides have much lower ratio. In LCC FTIR, there are three peaks at 1 427, 1 329 and 1046 cm--1, indicating that both semi-cellulose and cellulose could exist in LCC, and that there might be relationships between cellulose and lignin. Compared with the residual lignin from KP and SP, the condensed structure in KP is more than that in SP.

  6. Widespread triploidy in Western North American aspen (Populus tremuloides).

    Science.gov (United States)

    Mock, Karen E; Callahan, Colin M; Islam-Faridi, M Nurul; Shaw, John D; Rai, Hardeep S; Sanderson, Stewart C; Rowe, Carol A; Ryel, Ronald J; Madritch, Michael D; Gardner, Richard S; Wolf, Paul G

    2012-01-01

    We document high rates of triploidy in aspen (Populus tremuloides) across the western USA (up to 69% of genets), and ask whether the incidence of triploidy across the species range corresponds with latitude, glacial history (as has been documented in other species), climate, or regional variance in clone size. Using a combination of microsatellite genotyping, flow cytometry, and cytology, we demonstrate that triploidy is highest in unglaciated, drought-prone regions of North America, where the largest clone sizes have been reported for this species. While we cannot completely rule out a low incidence of undetected aneuploidy, tetraploidy or duplicated loci, our evidence suggests that these phenomena are unlikely to be significant contributors to our observed patterns. We suggest that the distribution of triploid aspen is due to a positive synergy between triploidy and ecological factors driving clonality. Although triploids are expected to have low fertility, they are hypothesized to be an evolutionary link to sexual tetraploidy. Thus, interactions between clonality and polyploidy may be a broadly important component of geographic speciation patterns in perennial plants. Further, cytotypes are expected to show physiological and structural differences which may influence susceptibility to ecological factors such as drought, and we suggest that cytotype may be a significant and previously overlooked factor in recent patterns of high aspen mortality in the southwestern portion of the species range. Finally, triploidy should be carefully considered as a source of variance in genomic and ecological studies of aspen, particularly in western U.S. landscapes.

  7. Establishment of in vitro culture of Populus euphratica Olivier

    Institute of Scientific and Technical Information of China (English)

    Zhao Peng; Dong Zhan-yuan; Sun Hong-bin; Zhao Ju-ying; Wang Hua-fang

    2006-01-01

    The purpose of our study was to establish a regeneration system for micropropagation of Populus euphratica Olivier. On the basis of an analysis of plant leaf mineral nutrients, a special medium was proposed, called MP2. In optimizing media for in vitro plant cultures including MS, B5 and MP2 media we employed hormones, auxin IAA, cytokine benzyladenine (BAP) and gibberellic acid (GA) in our factorial experiments on media. Adventitious shoots were derived from cuttings of adult plants taken from Xingjiang, west China, on selected media with MP2 + 0.5 mg.L-1 BA + 0.1 mg·L-1 NAA. The shoots were elongated on a medium with 0.25mg.L-1 BAP, 0.1 mg.L-1NAA and 2 mg·L-1 GA and were then rooted on a medium with 0.2-0.5 mg·L-1 IBA. All the media were incorporated with 30 g·L-1 sucrose and an adjusted pH at 6.3.

  8. Genetic diversity in Populus nigra plantations from west of Iran

    Directory of Open Access Journals (Sweden)

    Afrooz Alimohamadi

    2012-11-01

    Full Text Available In order to adopt strategies for forest conservation and development,it is necessary to estimate the amount and distribution of genetic diversity in existing populations of poplar in Iran. In this study, the genetic diversity between eight stands of Populus nigra established in Kermanshah province was evaluated on the basis of molecular and morphological markers. To amplify microsatellite loci (WPMS09, WPMS16 and WPMS18, DNA extraction from young and fresh leaveswas done. Various conditions of the PCR assay were examined and to evaluate the morphological variation of the morphological characters leaves (consist of 19 traits were measured. In addition, height growth was measured, to evaluate the growth function of the stands in homogeneous conditions. Genetic diversity in termof polymorphic loci was 0%, because three investigated microsatellite loci were monomorphic. The total number of alleles for 3 microsatellite loci was 6 (na = 2, ne = 2, heo = 1, hee = 0.51. Genetic identity based on Nei was 100%, so genetic distance was 0%. The whole sampled trees represented the same thus the genotype. No significant differences between the mean values of all morphological characters and height growth were revealed. Observed genetic similarity gave indication that same ramets had been selected to plant in poplar plantation established in Kermanshah province.These results suggest the need for an initial evaluation of the genetic diversity in selected ramets for planting in plantation to avoid repetition.

  9. Genetic diversity in Populus nigra plantations from west of Iran

    Directory of Open Access Journals (Sweden)

    Afrooz Alimohamadi

    2012-12-01

    Full Text Available In order to adopt strategies for forest conservation and development, it is necessary to estimate the amount and distribution of genetic diversity in existing populations of poplar in Iran. In this study, the genetic diversity between eight stands of Populus nigra established in Kermanshah province was evaluated on the basis of molecular and morphological markers. To amplify microsatellite loci (WPMS09, WPMS16 and WPMS18, DNA extraction from young and fresh leaveswas done. Various conditions of the PCR assay were examined and to evaluate the morphological variation of the morphological characters leaves (consist of 19 traits were measured. In addition, height growth was measured, to evaluate the growth function of the stands in homogeneous conditions. Genetic diversity in term of polymorphic loci was 0%, because three investigated microsatellite loci were monomorphic. The total number of alleles for 3 microsatellite loci was 6 (na = 2, ne = 2, heo = 1, hee = 0.51. Genetic identity based on Nei was 100%, so genetic distance was 0%. The whole sampled trees represented the same thus the genotype. No significant differences between the mean values of all morphological characters and height growth were revealed. Observed genetic similarity gave indication that same ramets had been selected to plant in poplar plantation established in Kermanshah province. These results suggest the need for an initial evaluation of the genetic diversity in selected ramets for planting in plantation to avoid repetition.  

  10. Construction of cDNA Library from Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    Yu Guangjun; Wang Yiqin; Shen Xin

    2003-01-01

    In order to isolate and clone salt-tolerance involved genes of Populus euphratica, we constructed a cDNA library from salt-treated leaves of P. euphratica. In the experiment, double strand cDNA were synthesized by a beads-based method. The syntheses of the first strand and the second strand cDNA, adapter ligation and restriction reaction for releasing cDNA were all conducted on the beads. The double strand cDNA were released from magnetic beads by digestion with NotI, and cDNA fragments smaller than 500 bp and residual adapters were removed through cDNA size fractionation columns. Finally, double strand cDNA were directionally cloned intoλExcell vector. The results show that the primary titer of the cDNA library is 7.46×106 pfu per mL and the packaging efficiency reaches 1.47×107 recombinants per μg DNA. λDNA extracted from two clones of plaque were digested by EcoR I and NotI, both of the clones contained inserts larger than 900 bp. These results show that the cDNA library of salt-treated P. euphratica leaves has been successfully constructed.

  11. Widespread triploidy in Western North American aspen (Populus tremuloides.

    Directory of Open Access Journals (Sweden)

    Karen E Mock

    Full Text Available We document high rates of triploidy in aspen (Populus tremuloides across the western USA (up to 69% of genets, and ask whether the incidence of triploidy across the species range corresponds with latitude, glacial history (as has been documented in other species, climate, or regional variance in clone size. Using a combination of microsatellite genotyping, flow cytometry, and cytology, we demonstrate that triploidy is highest in unglaciated, drought-prone regions of North America, where the largest clone sizes have been reported for this species. While we cannot completely rule out a low incidence of undetected aneuploidy, tetraploidy or duplicated loci, our evidence suggests that these phenomena are unlikely to be significant contributors to our observed patterns. We suggest that the distribution of triploid aspen is due to a positive synergy between triploidy and ecological factors driving clonality. Although triploids are expected to have low fertility, they are hypothesized to be an evolutionary link to sexual tetraploidy. Thus, interactions between clonality and polyploidy may be a broadly important component of geographic speciation patterns in perennial plants. Further, cytotypes are expected to show physiological and structural differences which may influence susceptibility to ecological factors such as drought, and we suggest that cytotype may be a significant and previously overlooked factor in recent patterns of high aspen mortality in the southwestern portion of the species range. Finally, triploidy should be carefully considered as a source of variance in genomic and ecological studies of aspen, particularly in western U.S. landscapes.

  12. Chemical responses to modified lignin composition in tension wood of hybrid poplar (Populus tremula x Populus alba).

    Science.gov (United States)

    Al-Haddad, Jameel M; Kang, Kyu-Young; Mansfield, Shawn D; Telewski, Frank W

    2013-04-01

    The effect of altering the expression level of the F5H gene was investigated in three wood tissues (normal, opposite and tension wood) in 1-year-old hybrid poplar clone 717 (Populus tremula × Populus alba L.), containing the F5H gene under the control of the C4H promoter. Elevated expression of the F5H gene in poplar has been previously reported to increase the percent syringyl content of lignin. The wild-type and three transgenic lines were inclined 45° for 3 months to induce tension wood formation. Tension and opposite wood from inclined trees, along with normal wood from control trees, were analyzed separately for carbohydrates, lignin, cellulose crystallinity and microfibril angle (MFA). In the wild-type poplar, the lignin in tension wood contained a significantly higher percentage of syringyl than normal wood or opposite wood. However, there was no significant difference in the percent syringyl content of the three wood types within each of the transgenic lines. Increasing the F5H gene expression caused an increase in the percent syringyl content and a slight decrease in the total lignin in normal wood. In tension wood, the addition of a gelatinous layer in the fiber walls resulted in a consistently lower percentage of total lignin in the tissue. Acid-soluble lignin was observed to increase by up to 2.3-fold in the transgenic lines. Compared with normal wood and opposite wood, cell wall crystallinity in tension wood was higher and the MFA was smaller, as expected, with no evidence of an effect from modifying the syringyl monomer ratio. Tension wood in all the lines contained consistently higher total sugar and glucose percentages when compared with normal wood within the respective lines. However, both sugar and glucose percentages were lower in the tension wood of transgenic lines when compared with the tension wood of wild-type trees. Evaluating the response of trees with altered syringyl content to gravity will improve our understanding of the changes

  13. Bud phenology and growth are subject to divergent selection across a latitudinal gradient in Populus angustifolia and impact adaptation across the distributional range and associated arthropods.

    Science.gov (United States)

    Evans, Luke M; Kaluthota, Sobadini; Pearce, David W; Allan, Gerard J; Floate, Kevin; Rood, Stewart B; Whitham, Thomas G

    2016-07-01

    Temperate forest tree species that span large geographical areas and climatic gradients often have high levels of genetic variation. Such species are ideal for testing how neutral demographic factors and climate-driven selection structure genetic variation within species, and how this genetic variation can affect ecological communities. Here, we quantified genetic variation in vegetative phenology and growth traits in narrowleaf cottonwood, Populus angustifolia, using three common gardens planted with genotypes originating from source populations spanning the species' range along the Rocky Mountains of North America (ca. 1700 km). We present three main findings. First, we found strong evidence of divergent selection (Q ST > F ST) on fall phenology (bud set) with adaptive consequences for frost avoidance. We also found evidence for selection on bud flush duration, tree height, and basal diameter, resulting in population differentiation. Second, we found strong associations with climate variables that were strongly correlated with latitude of origin. More strongly differentiated traits also showed stronger climate correlations, which emphasizes the role that climate has played in divergent selection throughout the range. We found population × garden interaction effects; for some traits, this accounted for more of the variance than either factor alone. Tree height was influenced by the difference in climate of the source and garden locations and declined with increasing transfer distance. Third, growth traits were correlated with dependent arthropod community diversity metrics. Synthesis. Overall, we conclude that climate has influenced genetic variation and structure in phenology and growth traits and leads to local adaptation in P. angustifolia, which can then impact dependent arthropod species. Importantly, relocation of genotypes far northward or southward often resulted in poor growth, likely due to a phenological mismatch with photoperiod, the proximate

  14. Shipping coal to Newcastle: are SRIC populus plantations a viable fiber production option for the central hardwoods region?

    Science.gov (United States)

    C.H. Strauss

    1991-01-01

    Production costs for short rotation, intensive culture (SRIC) Populus biomass were developed from commercial-sized plantations under investigation throughout the eastern U.S. Populus hybrid planted on good quality plantation sites at a density of 850 cuttings/acre was projected to yield an average of 7 ovendry (OD) tons/acre/year....

  15. The Populus ARBORKNOX1 homeodomain transcription factor regulates woody growth through binding to evolutionarily conserved target genes of diverse function

    Science.gov (United States)

    Lijun Liu; Matthew S. Zinkgraf; H. Earl Petzold; Eric P. Beers; Vladimir Filkov; Andrew Groover

    2014-01-01

    The class I KNOX homeodomain transcription factor ARBORKNOX1 (ARK1) is a key regulator of vascular cambium maintenance and cell differentiation in Populus. Currently, basic information is lacking concerning the distribution, functional characteristics, and evolution of ARK1 binding in the Populus genome.

  16. Sodium and chloride accumulation in leaf, woody, and root tissue of Populus after irrigation with landfill leachate

    Science.gov (United States)

    Jill A. Zalesny; Ronald S., Jr. Zalesny; Adam H. Wiese; Bart Sexton; Richard B. Hall

    2008-01-01

    The response of Populus to irrigation sources containing elevated levels of sodium (Na+) and chloride (Cl-) is poorly understood. We irrigated eight Populus clones with fertilized well water (control) (N, P, K) or municipal solid waste landfill leachate weekly during 2005 and 2006 in...

  17. Genome-wide identification of lineage-specific genes in Arabidopsis, Oryza and Populus

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaohan [ORNL; Jawdy, Sara [ORNL; Tschaplinski, Timothy J [ORNL; Tuskan, Gerald A [ORNL

    2009-01-01

    Protein sequences were compared among Arabidopsis, Oryza and Populus to identify differential gene (DG) sets that are in one but not the other two genomes. The DG sets were screened against a plant transcript database, the NR protein database and six newly-sequenced genomes (Carica, Glycine, Medicago, Sorghum, Vitis and Zea) to identify a set of species-specific genes (SS). Gene expression, protein motif and intron number were examined. 192, 641 and 109 SS genes were identified in Arabidopsis, Oryza and Populus, respectively. Some SS genes were preferentially expressed in flowers, roots, xylem and cambium or up-regulated by stress. Six conserved motifs in Arabidopsis and Oryza SS proteins were found in other distant lineages. The SS gene sets were enriched with intronless genes. The results reflect functional and/or anatomical differences between monocots and eudicots or between herbaceous and woody plants. The Populus-specific genes are candidates for carbon sequestration and biofuel research.

  18. Summary of environmental flow monitoring for the Sustainable Rivers Project on the Middle Fork Willamette and McKenzie Rivers, western Oregon, 2014–15

    Science.gov (United States)

    Jones, Krista L.; Mangano, Joseph F.; Wallick, J. Rose; Bervid, Heather D.; Olson, Melissa; Keith, Mackenzie K.; Bach, Leslie

    2016-11-07

    This report presents the results of an ongoing environmental flow monitoring study by The Nature Conservancy (TNC), U.S. Army Corps of Engineers (USACE), and U.S. Geological Survey in support of the Sustainable Rivers Project (SRP) of TNC and USACE. The overarching goal of this study is to evaluate and characterize relations between streamflow, geomorphic processes, and black cottonwood (Populus trichocarpa) recruitment on the Middle Fork Willamette and McKenzie Rivers, western Oregon, that were hypothesized in earlier investigations. The SRP can use this information to plan future monitoring and scientific investigations, and to help mitigate the effects of dam operations on streamflow regimes, geomorphic processes, and biological communities, such as black cottonwood forests, in consultation with regional experts. The four tasks of this study were to:Compare the hydrograph from Water Year (WY) 2015 with hydrographs from WYs 2000–14 and the SRP flow recommendations,Assess short-term and system-wide changes in channel features and vegetation throughout the alluvial valley section of the Middle Fork Willamette River (2005–12),Examine changes in channel features and vegetation over two decades (1994–2014) for two short mapping zones on the Middle Fork Willamette and McKenzie Rivers, andComplete a field investigation of summer stage and the growth of black cottonwood and other vegetation on the Middle Fork Willamette and McKenzie Rivers in summer 2015.

  19. Tissue Culture Technology for Populus × euramericana Hybrids: Effect of Genotype on in Vitro Regeneration

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In order to select a suitable genotype for the studies on genetic transformation, the difference among three genotypes (DN04-18, DN04-25 and DN04-26) of Populus × euramericana (Populus deltoides × P. nigra) in terms of shoot regeneration was investigated in this paper. An efficient in vitro micropropagation method was successfully established for genotype DN04-18. The high frequency shoot regeneration (90.0%) from leaf discs was obtained in genotype DN04-18 on the modified Murashige and Skoog (mMS) medium w...

  20. Structural characterization of lignin from triploid of Populus tomentosa Carr.

    Science.gov (United States)

    Yuan, Tong-Qi; Sun, Shao-Ni; Xu, Feng; Sun, Run-Cang

    2011-06-22

    To improve yields while minimizing the extent of mechanical action (just 2 h of planetary ball-milling), the residual wood meal obtained from extraction of milled wood lignin (MWL) was sequentially treated with cellulolytic enzyme and alkali, and the yields of MWL, cellulolytic enzyme lignin (CEL), and alkaline lignin (AL) were 5.4, 23.2, and 16.3%, respectively. The chemical structures of the lignin fractions obtained were characterized by carbohydrate analysis, gel permeation chromatography (GPC), Fourier transform infrared (FT-IR) spectroscopy, and various advanced NMR spectroscopic techniques. The results showed that the lignin isolated as MWL during the early part of ball milling may originate mainly from the middle lamella. This lignin fraction was less degradable and contained more linear hemicelluloses and more C═O in unconjugated groups as well as more phenolic OH groups. Both 1D and 2D NMR spectra analyses confirmed that the lignin in triploid of Populus tomentosa Carr. is GSH-type and partially acylated at the γ-carbon of the side chain. Two-dimensional heteronuclear single-quantum coherence (¹³C-¹H) NMR of MWL, CEL, and AL showed a predominance of β-O-4' aryl ether linkages (81.1-84.5% of total side chains), followed by β-β' resinol-type linkages (12.2-16.4%), and lower amounts of β-5' phenylcoumaran (2.1-2.6%) and β-1' spirodienone-type (0.4-1.4%) linkages. The syringyl (S)/guaiacyl (G) ratios were estimated to be 1.43, 2.29, and 2.83 for MWL, CEL, and AL, respectively.

  1. Cloning and Expression Patterns of PtSUS1 in Populus tomentosa%毛白杨蔗糖合酶基因PtSUS1的克隆及其表达模式分析

    Institute of Scientific and Technical Information of China (English)

    李英; 陈仲; 李昊; 郭斌; 王佳; 安新民

    2012-01-01

    蔗糖合酶(sucrose synthase)与植物库强调节、次生壁的形成和纤维素合成等有着密切的联系,其中在纤维素合成过程中的作用尤为显著.本研究根据我们已获得的毛白杨PtSUS1基因片段设计引物,采用RACE技术,获得了毛白杨PtSUS1的基因序列,测序结果显示该基因序列全长为2 669 bp,包括一个完整的阅读框,编码805个氨基酸.通过Blast检索分析表明,PtSUS1与拟南芥、巨桉、陆地棉、温州蜜柑、毛果杨SUS1的核酸和氨基酸序列的同源性分别达到76%~97%和82%~97%.运用生物信息软件对PtSUS1编码的蛋白进行了二级结构预测和功能位点分析,结果显示该蛋白氨基酸序列包括两个功能域,存在可能的磷酸化位点38个,无跨膜结构域存在.系统进化分析表明PtSUS1与PtSUS2关系最为接近.RT-PCR分析结果显示,PtSUS1在被检测的毛白杨根、茎、叶及雌雄花芽组织和器官中均有表达,呈现组成型表达模式.该研究为进一步深入探索毛白杨蔗糖合酶基因PtSUS1的功能奠定了基础.%Sucrose synthase (SUS) was closely associated with sink strength, secondary wall formationand cellulose synthesis in plant. Among these items, cellulose synthesis is considered to be the most important. According to the known gene fragment of PtSUSl and the principle of RACE amplification, we got the gene sequence of PtSUSl from Populous tomentosa. The full sequence of PtSUSl which contains an open reading frame (ORF) is 2 669 bp encoding a deduced amino acid sequence of 805 residues. Blast analysis results indicated that the homology was as high as 76% to 97% and 81% to 97%, respectively, when compared PtSUSl sequence of amino acid and nucle-otide with the ones of Arabidopsis thaliana, Eucalyptus grandis, Gossypium hirsutum, Citrus unshiu, and Populus trichocarpa. Furthermore, secondary structure and functional sites in amino acid sequences have been predicted by the bioinformatics

  2. Litter Quality of Populus Species as Affected by Free-Air CO2

    NARCIS (Netherlands)

    Vermue, E.; Buurman, P.; Hoosbeek, M.R.

    2009-01-01

    The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM) was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samp

  3. The Populus homeobox gene ARBORKNOX2 regulates cell differentiation during secondary growth

    Science.gov (United States)

    Juan Du; Shawn D. Mansfield; Andrew T. Groover

    2009-01-01

    The stem cells of the vascular cambium divide to produce daughter cells, which in turn divide before undergoing differentiation during the radial growth of woody stems. The genetic regulation of these developmental events is poorly understood, however. We report here the cloning and functional characterization of a Populus class-I KNOX...

  4. The response of Populus spp. to cadmium stress: chemical, morphological and proteomics study.

    Science.gov (United States)

    Marmiroli, Marta; Imperiale, Davide; Maestri, Elena; Marmiroli, Nelson

    2013-10-01

    Poplar (Populus) species are seen as candidates for removing heavy metal contamination from polluted soil. A bottom-up multidisciplinary approach was utilized to compare the performances of clones 58-861 and Poli (Populus nigra) and A4A, a Populus nigra × Populus deltoides hybrid to Cd toxicity. Qualitative and quantitative differences in their tolerance to Cd exposure and the uptake, accumulation and translocation of Cd were noted following the hydroponic exposure of rooted cuttings to 20 μM CdSO₄ for either 48 h or 14 d. Cadmium was less toxic for the hybrid clone A4A as compared to Poli and 58-861. Cd uptake and root to shoot translocation were determined by AAS, and its compartmentation was analyzed using SEM/EDX. A comparative proteomic approach was utilized to identify changes in proteins expression according to dose and time of exposure. Toxicity to Cd mainly influenced proteins related to general defense, stress response and carbohydrate metabolism.

  5. Alteration of PHYA expression change circadian rhythms and timing of bud set in Populus.

    Science.gov (United States)

    Kozarewa, Iwanka; Ibáñez, Cristian; Johansson, Mikael; Ogren, Erling; Mozley, David; Nylander, Eva; Chono, Makiko; Moritz, Thomas; Eriksson, Maria E

    2010-05-01

    In many temperate woody species, dormancy is induced by short photoperiods. Earlier studies have shown that the photoreceptor phytochrome A (phyA) promotes growth. Specifically, Populus plants that over-express the oat PHYA gene (oatPHYAox) show daylength-independent growth and do not become dormant. However, we show that oatPHYAox plants could be induced to set bud and become cold hardy by exposure to a shorter, non-24 h diurnal cycle that significantly alters the relative position between endogenous rhythms and perceived light/dark cycles. Furthermore, we describe studies in which the expression of endogenous Populus tremula x P. tremuloides PHYTOCHROME A (PttPHYA) was reduced in Populus trees by antisense inhibition. The antisense plants showed altered photoperiodic requirements, resulting in earlier growth cessation and bud formation in response to daylength shortening, an effect that was explained by an altered innate period that leads to phase changes of clock-associated genes such as PttCO2. Moreover, gene expression studies following far-red light pulses show a phyA-mediated repression of PttLHY1 and an induction of PttFKF1 and PttFT. We conclude that the level of PttPHYA expression strongly influences seasonally regulated growth in Populus and is central to co-ordination between internal clock-regulated rhythms and external light/dark cycles through its dual effect on the pace of clock rhythms and in light signaling.

  6. Clonal variation in lateral and basal rooting of Populus irrigated with landfill leachate

    Science.gov (United States)

    R.S. Zalesny Jr.; J.A. Zalesny

    2011-01-01

    Successful establishment and productivity of Populus depends upon adventitious rooting from: 1) lateral roots that develop from either preformed or induced primordia and 2) basal roots that differentiate from callus at the base of the cutting in response to wounding. Information is needed for phytotechnologies about the degree to which ...

  7. Genome-wide analysis of the structural genes regulating defense phenylpropanoid metabolism in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Tschaplinski, Timothy J [ORNL; Tsai, Chung-Jui [Michigan Technological University; Harding, Scott A [Michigan Technological University; Lindroth, richard L [University of Wisconsin, Madison; Yuan, Yinan [Michigan Technological University

    2006-01-01

    Salicin-based phenolic glycosides, hydroxycinnamate derivatives and flavonoid-derived condensed tannins comprise up to one-third of Populus leaf dry mass. Genes regulating the abundance and chemical diversity of these substances have not been comprehensively analysed in tree species exhibiting this metabolically demanding level of phenolic metabolism. Here, shikimate-phenylpropanoid pathway genes thought to give rise to these phenolic products were annotated from the Populus genome, their expression assessed by semiquantitative or quantitative reverse transcription polymerase chain reaction (PCR), and metabolic evidence for function presented. Unlike Arabidopsis, Populus leaves accumulate an array of hydroxycinnamoyl-quinate esters, which is consistent with broadened function of the expanded hydroxycinnamoyl-CoA transferase gene family. Greater flavonoid pathway diversity is also represented, and flavonoid gene families are larger. Consistent with expanded pathway function, most of these genes were upregulated during wound-stimulated condensed tannin synthesis in leaves. The suite of Populus genes regulating phenylpropanoid product accumulation should have important application in managing phenolic carbon pools in relation to climate change and global carbon cycling.

  8. Selecting and utilizing Populus and Salix for landfill covers: implications for leachate irrigation

    Science.gov (United States)

    Ronald S., Jr. Zalesny; Edmund O. Bauer

    2007-01-01

    The success of using Populus and Salix for phytoremediation has prompted further use of leachate as a combination of irrigation and fertilization for the trees. A common protocol for such efforts has been to utilize a limited number of readily-available genotypes with decades of deployment in other applications, such as fiber or...

  9. Chemo-mechanical modification of cottonwood for Pb(2+) removal from aqueous solutions: Sorption mechanisms and potential application as biofilter in drip-irrigation.

    Science.gov (United States)

    Mosa, Ahmed; El-Ghamry, Ayman; Trüby, Peter; Omar, Mahmoud; Gao, Bin; Elnaggar, Abdelhamid; Li, Yuncong

    2016-10-01

    Using biomass (e.g. crop residues) and its derivatives as biosorbents have been recognized as an eco-friendly technique for wastewater decontamination. In this study, mechanically modified cottonwood was further activated with KOH to improve its sorption of Pb(2+). In addition, its potential as a biofilter to safeguard radish (Raphanus sativus, L.) against Pb-stress was evaluated in a gravity-fed drip irrigation system. Physiochemical properties of the chemo-mechanically activated cottonwood (CMACW) and the mechanically activated cottonwood (MACW) before and after sorption process were characterized using scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS), transmission electron microscopy (TEM), digital selected-area electron diffraction (SAED) and Fourier transform infrared spectroscopy (FTIR). After activation, several sorption mechanisms (i.e. precipitation, electrostatic outer- and inner-sphere complexation) were responsible for the higher sorption capacity of CMACW as compared with MACW (8.55 vs. 7.28 mg g(-1)). Sorption kinetics and isotherms fitted better with the pseudo-second-order and Langmuir models as compared with the pseudo-first-order and Freundlich models, respectively. In the gravity-fed drip irrigation system, the CMACW biofilter reduced the accumulation of Pb in radish roots and shoots and avoided reaching the toxic limits in some cases. Soil types had a significant effect on Pb(2+) bioavailability because of the difference in sorption ability. Findings from this study showed that CMACW biofilter can be used as a safeguard for wastewater irrigation. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. ADVANCE IN RESEARCH ON DROUGHT RESISTANCE OF POPULUS%杨树抗旱性研究进展

    Institute of Scientific and Technical Information of China (English)

    尹春英; 李春阳

    2003-01-01

    The drought resistance of woody plants, in particular, Populus, was reviewed in this paper. Studies about drought resistance of Populus mostly focused on changes in growth properties, physiological adaptation and biochemical aspects, but a few on molecular biology. The indexes of drought adaptation and productivity were analyzed and these indexes could be employed to identify drought resistance of woody plants. Combination of such different approaches will, hopefully, give us a more complete understanding of the various regulatory mechanisms in trees than what we may have today. With development of the molecular biology of woody plants, the sluties on stress resistance of Populus which was regarded as a model plant, are summarised. Ref 96

  11. Soils and late-Quaternary landscape evolution in the Cottonwood River basin, east-central Kansas: Implications for archaeological research

    Science.gov (United States)

    Beeton, J.M.; Mandel, R.D.

    2011-01-01

    Temporal and spatial patterns of landscape evolution strongly influence the temporal and spatial patterns of the archaeological record in drainage systems. In this geoarchaeological investigation we took a basin-wide approach in assessing the soil stratigraphy, lithostratigraphy, and geochronology of alluvial deposits and associated buried soils in the Cottonwood River basin of east-central Kansas. Patterns of landscape evolution emerge when stratigraphic sequences and radiocarbon chronologies are compared by stream size and landform type. In the valleys of high-order streams (???4th order) the Younger Dryas Chronozone (ca. 11,000-10,000 14C yr B.P.) was characterized by slow aggradation accompanied by pedogenesis, resulting in the development of organic-rich cumulic soils. Between ca. 10,000 and 4900 14C yr B.P., aggradation punctuated by soil formation was the dominant process in those valleys. Alluvial fans formed on the margins of high-order stream valleys during the early and middle Holocene (ca. 9000-5000 14C yr B.P.) and continued to develop slowly until ca. 3000-2000 14C yr B.P. The late-Holocene record of high-order streams is characterized by episodes of entrenchment, rapid aggradation, and slow aggradation punctuated by soil development. By contrast, the early and middle Holocene (ca. 10,000-5000 14C yr B.P.) was a period of net erosion in the valleys of low-order streams. However, during the late Holocene small valleys became zones of net sediment storage. Consideration of the effects of these patterns of landscape evolution on the archaeological record is crucial for accurately interpreting that record and searching for buried archaeological deposits dating to specific cultural periods. ?? 2011 Wiley Periodicals, Inc. ?? 2011 Wiley Periodicals, Inc..

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-1060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1060 ref|XP_002331444.1| white-brown-complex ABC transporter family [P...opulus trichocarpa] gb|EEF10653.1| white-brown-complex ABC transporter family [Populus trichocarpa] XP_002331444.1 0.007 25% ...

  13. Growth Characteristics of Four Clone of Populus alba × Populus bolleana%4个银×新杨无性系生长特性

    Institute of Scientific and Technical Information of China (English)

    王宝庆; 李丕军; 李宏; 李素琼; 雷双喜

    2011-01-01

    Growth characteristics of Populus alba X Populus bolleana plantaion in Plain Forestry Farm of Hi Area had been studied. The results showed than tree height growth of four clone of Populus alba X Populus bolleana was earlier than the breast diameter growth. There were significant differences among single plants in the middle and later periods of plant growth. The maximum of current annual increment and average annual increment of tree height appeared nearly synchronously,so did the breast diameter. The current annual increment of the tree height and the average annual increment intersected with each other nearly in 4th-6th year. The current annual increment of breast diameter and the average annual increment intersected about in 6th-7th year. But the maximum of current annual increment of timber volume appeared much more earlier than the maximum of mean annual increment;From the view of growth process of four clone of Populus alba Xpopulus bolleana produced 18 years ago,the growth can be divided into three periods;0 - 6 years were the young treelet period,during which the tree height and breast diameter grew faster;7 - 14 years were the high-growing period, during which the tree height and breast diameter grew at high speed. 15 - 18 years were the near mature period. The average current increment of Populus alba X Populus bolleana and current annual increment intersected with each other about in 16 years with quantitative mature, in this moment,the rotation of humbering can be operated.%对伊犁地区筛选的4个银×新杨无性系生长特性进行研究.结果表明,银×新杨4个无性系的高生长要早于胸径生长,生长中后期单株之间差异明显;树高连年生长量最大值与平均生长量最大值几乎同步出现,胸径亦如此,树高连年生长量在第4~6年时与平均生长量相交,胸径连年生长量和平均生长量在第6~7年时相交.从18a生的4个无性系生长过程来看,生长可分为3个时期:第0~6

  14. Genome resequencing in Populus: Revealing large-scale genome variation and implications on specialized-trait genomics

    Energy Technology Data Exchange (ETDEWEB)

    Muchero, Wellington [ORNL; Labbe, Jessy L [ORNL; Priya, Ranjan [University of Tennessee, Knoxville (UTK); DiFazio, Steven P [West Virginia University, Morgantown; Tuskan, Gerald A [ORNL

    2014-01-01

    To date, Populus ranks among a few plant species with a complete genome sequence and other highly developed genomic resources. With the first genome sequence among all tree species, Populus has been adopted as a suitable model organism for genomic studies in trees. However, far from being just a model species, Populus is a key renewable economic resource that plays a significant role in providing raw materials for the biofuel and pulp and paper industries. Therefore, aside from leading frontiers of basic tree molecular biology and ecological research, Populus leads frontiers in addressing global economic challenges related to fuel and fiber production. The latter fact suggests that research aimed at improving quality and quantity of Populus as a raw material will likely drive the pursuit of more targeted and deeper research in order to unlock the economic potential tied in molecular biology processes that drive this tree species. Advances in genome sequence-driven technologies, such as resequencing individual genotypes, which in turn facilitates large scale SNP discovery and identification of large scale polymorphisms are key determinants of future success in these initiatives. In this treatise we discuss implications of genome sequence-enable technologies on Populus genomic and genetic studies of complex and specialized-traits.

  15. Abaxial Greening Phenotype in Hybrid Aspen

    Directory of Open Access Journals (Sweden)

    Julia S. Nowak

    2013-04-01

    Full Text Available The typical angiosperm leaf, as in Arabidopsis, is bifacial consisting of top (adaxial and bottom (abaxial surfaces readily distinguishable by the underlying cell type (palisade and spongy mesophyll, respectively. Species of the genus Populus have leaves that are either conventionally bifacial or isobilateral. Isobilateral leaves have palisade mesophyll on the top and bottom of the leaf, making the two sides virtually indistinguishable at the macroscopic level. In poplars this has been termed the “abaxial greening” phenotype. Previous work has implicated ASYMMETRIC LEAVES1 (AS1 as an essential determinant of palisade mesophyll development. This gene, as well as other genes (84 in all putatively involved in setting the dorsiventral axis of leaves, were investigated in two Populus species: black cottonwood (Populus trichocarpa and hybrid aspen (P. tremula x tremuloides, representative of each leaf type (bifacial and isobilateral, respectively. Poplar orthologs of AS1 have significantly higher expression in aspen leaf blade and lower in the petiole, suggestive of a potential role in the isobilateral leaf phenotype consistent with the previously observed phenotypes. Furthermore, an ABERRANT TESTA SHAPE (ATS ortholog has significantly lower expression in aspen leaf tissue, also suggesting a possible contribution of this gene to abaxial greening.

  16. Abaxial Greening Phenotype in Hybrid Aspen.

    Science.gov (United States)

    Nowak, Julia S; Douglas, Carl J; Cronk, Quentin C B

    2013-04-24

    The typical angiosperm leaf, as in Arabidopsis, is bifacial consisting of top (adaxial) and bottom (abaxial) surfaces readily distinguishable by the underlying cell type (palisade and spongy mesophyll, respectively). Species of the genus Populus have leaves that are either conventionally bifacial or isobilateral. Isobilateral leaves have palisade mesophyll on the top and bottom of the leaf, making the two sides virtually indistinguishable at the macroscopic level. In poplars this has been termed the "abaxial greening" phenotype. Previous work has implicated ASYMMETRIC LEAVES1 (AS1) as an essential determinant of palisade mesophyll development. This gene, as well as other genes (84 in all) putatively involved in setting the dorsiventral axis of leaves, were investigated in two Populus species: black cottonwood (Populus trichocarpa) and hybrid aspen (P. tremula x tremuloides), representative of each leaf type (bifacial and isobilateral, respectively). Poplar orthologs of AS1 have significantly higher expression in aspen leaf blade and lower in the petiole, suggestive of a potential role in the isobilateral leaf phenotype consistent with the previously observed phenotypes. Furthermore, an ABERRANT TESTA SHAPE (ATS) ortholog has significantly lower expression in aspen leaf tissue, also suggesting a possible contribution of this gene to abaxial greening.

  17. Biochemical basis of drought tolerance in hybrid Populus grown under field production conditions. CRADA final report

    Energy Technology Data Exchange (ETDEWEB)

    Tschaplinski, T.J.; Tuskan, G.A. [Oak Ridge National Lab., TN (United States); Wierman, C. [Boise Cascade Corp., Wallula, WA (United States)

    1997-04-01

    The purpose of this cooperative effort was to assess the use of osmotically active compounds as molecular selection criteria for drought tolerance in Populus in a large-scale field trial. It is known that some plant species, and individuals within a plant species, can tolerate increasing stress associated with reduced moisture availability by accumulating solutes. The biochemical matrix of such metabolites varies among species and among individuals. The ability of Populus clones to tolerate drought has equal value to other fiber producers, i.e., the wood products industry, where irrigation is used in combination with other cultural treatments to obtain high dry weight yields. The research initially involved an assessment of drought stress under field conditions and characterization of changes in osmotic constitution among the seven clones across the six moisture levels. The near-term goal was to provide a mechanistic basis for clonal differences in productivity under various irrigation treatments over time.

  18. NON DESTRUCTIVE EVALUATION OF HEARTWOOD DIAMETER AT BREAST HEIGHT FOR EUCALYPTUS GLOBULUS AND POPULUS EURAMERICANA HYBRID

    Directory of Open Access Journals (Sweden)

    Hugo Alexandre Jóia

    2006-12-01

    Full Text Available The objective of this study was the evaluation of the heartwood diameter (dcerne at breast height on stand trees, for Eucalyptus globulus Labill and the hybrid Populus euramericana. The data used was collected in eucalyptus and popular pure plantations in Central and North Portugal.The non destructive methods tested in the evaluation of heartwood diameter at breast height were [1] visual identification of the heartwood on core samples and [2] indirect estimation using mathematic models. The results allow to consider that visual determination of dcerne is appropriate for Populus, and development of prediction models based diameter at breast height (d, total height (h and age (t, give better results for eucalyptus.

  19. Knockdown of a Laccase in Populus deltoides Confers Altered Cell Wall Chemistry and Increased Sugar Release

    Energy Technology Data Exchange (ETDEWEB)

    Bryan, Anthony C.; Jawdy, Sara; Gunter, Lee; Gjersing, Erica; Sykes, Robert; Hinchee, Maud A. W.; Winkeler, Kimberly A.; Collins, Cassandra M.; Engle, Nancy; Tschaplinski, Timothy J.; Yang, Xiaohan; Tuskan, Gerald A.; Muchero, Wellington; Chen, Jin-Gui

    2016-10-01

    Plant laccases are thought to function in the oxidation of monolignols which leads to higher order lignin formation. Only a hand-full of laccases in plants have been functionally evaluated and as such little is known about the breadth of their impact on cell wall chemistry or structure. Here we describe a previously uncharacterized laccase from Populus, encoded by locus Potri.008G064000, whose reduced expression resulted in transgenic Populus trees with changes in syringyl/guaiacyl (S/G) ratios as well as altered sugar release phenotypes. These phenotypes are consistent with plant biomass exhibiting reduced recalcitrance. Interestingly, the transgene effect on recalcitrance is dependent on a mild pretreatment prior to chemical extraction of sugars. Metabolite profiling suggests the transgene modulates phenolics that are associated with the cell wall structure. We propose that this particular laccase has a range of functions related to oxidation of phenolics and conjugation of flavonoids that interact with lignin in the cell wall.

  20. Knockdown of a laccase in Populus deltoides confers altered cell wall chemistry and increased sugar release.

    Science.gov (United States)

    Bryan, Anthony C; Jawdy, Sara; Gunter, Lee; Gjersing, Erica; Sykes, Robert; Hinchee, Maud A W; Winkeler, Kimberly A; Collins, Cassandra M; Engle, Nancy; Tschaplinski, Timothy J; Yang, Xiaohan; Tuskan, Gerald A; Muchero, Wellington; Chen, Jin-Gui

    2016-10-01

    Plant laccases are thought to function in the oxidation of monolignols which leads to higher order lignin formation. Only a hand-full of laccases in plants have been functionally evaluated, and as such little is known about the breadth of their impact on cell wall chemistry or structure. Here, we describe a previously uncharacterized laccase from Populus, encoded by locus Potri.008G064000, whose reduced expression resulted in transgenic Populus trees with changes in syringyl/guaiacyl ratios as well as altered sugar release phenotypes. These phenotypes are consistent with plant biomass exhibiting reduced recalcitrance. Interestingly, the transgene effect on recalcitrance is dependent on a mild pretreatment prior to chemical extraction of sugars. Metabolite profiling suggests the transgene modulates phenolics that are associated with the cell wall structure. We propose that this particular laccase has a range of functions related to oxidation of phenolics and conjugation of flavonoids that interact with lignin in the cell wall.

  1. NON DESTRUCTIVE EVALUATION OF HEARTWOOD DIAMETER AT BREAST HEIGHT FOR EUCALYPTUS GLOBULUS AND POPULUS EURAMERICANA HYBRID

    OpenAIRE

    Hugo Alexandre Jóia; Teresa Fonseca; Maria Emília Silva; Carlos Pacheco Marques

    2006-01-01

    The objective of this study was the evaluation of the heartwood diameter (dcerne) at breast height on stand trees, for Eucalyptus globulus Labill and the hybrid Populus euramericana. The data used was collected in eucalyptus and popular pure plantations in Central and North Portugal.The non destructive methods tested in the evaluation of heartwood diameter at breast height were [1] visual identification of the heartwood on core samples and [2] indirect estimation using mathematic models. The...

  2. Diversification in the genetic architecture of gene expression and transcriptional networks in organ differentiation of Populus

    OpenAIRE

    Drost, Derek R.; Benedict, Catherine I.; Berg, Arthur; Novaes, Evandro; Novaes, Carolina R. D. B.; Yu, Qibin; Dervinis, Christopher; Jessica M Maia; Yap, John; Miles, Brianna; Kirst, Matias

    2010-01-01

    A fundamental goal of systems biology is to identify genetic elements that contribute to complex phenotypes and to understand how they interact in networks predictive of system response to genetic variation. Few studies in plants have developed such networks, and none have examined their conservation among functionally specialized organs. Here we used genetical genomics in an interspecific hybrid population of the model hardwood plant Populus to uncover transcriptional networks in xylem, leav...

  3. Successful Agrobacterium-mediated transformation of Populus tomentosa with apple SPDS gene

    Institute of Scientific and Technical Information of China (English)

    LIU Ting-ting; PANG Xiao-ming; LONG Cui; ZHANG Zhi-yi

    2008-01-01

    The problem of salinized soils has become one of the most serious constraints to agricultural and forest productivity. With the purpose of enhancing salt stress tolerance of Populus tomentosa, we transformed this tree species with spermidine synthase (SPDS) genes derived from an apple by an Agrobacterium-mediatod method. Four transgenic clones were confirmed by PCR and Southern blot analysis. As well, the expression of introduced SPDS genes was analyzed by real-time quantitative PCR.

  4. A simple and efficient transient transformation for hybrid aspen (Populus tremula × P. tremuloides

    Directory of Open Access Journals (Sweden)

    Takata Naoki

    2012-08-01

    Full Text Available Abstract Background The genus Populus is accepted as a model system for molecular tree biology. To investigate gene functions in Populus spp. trees, generating stable transgenic lines is the common technique for functional genetic studies. However, a limited number of genes have been targeted due to the lengthy transgenic process. Transient transformation assays complementing stable transformation have significant advantages for rapid in vivo assessment of gene function. The aim of this study is to develop a simple and efficient transient transformation for hybrid aspen and to provide its potential applications for functional genomic approaches. Results We developed an in planta transient transformation assay for young hybrid aspen cuttings using Agrobacterium-mediated vacuum infiltration. The transformation conditions such as the infiltration medium, the presence of a surfactant, the phase of bacterial growth and bacterial density were optimized to achieve a higher transformation efficiency in young aspen leaves. The Agrobacterium infiltration assay successfully transformed various cell types in leaf tissues. Intracellular localization of four aspen genes was confirmed in homologous Populus spp. using fusion constructs with the green fluorescent protein. Protein-protein interaction was detected in transiently co-transformed cells with bimolecular fluorescence complementation technique. In vivo promoter activity was monitored over a few days in aspen cuttings that were transformed with luciferase reporter gene driven by a circadian clock promoter. Conclusions The Agrobacterium infiltration assay developed here is a simple and enhanced throughput method that requires minimum handling and short transgenic process. This method will facilitate functional analyses of Populus genes in a homologous plant system.

  5. Estimating Stem Volume Using QuickBird Imagery and Allometric Relationships for Open Populus xiaohei Plantations

    Institute of Scientific and Technical Information of China (English)

    Xiao-Qing Wang; Zeng-Yuan Li; Xing-E Liu; Guang Deng; Ze-Hui Jiang

    2007-01-01

    There has been a great deal of interest in studying the crown of trees using remote sensing data. In this study, crown width was extracted from high-resolution QuickBird images for open Populus xiaohei plantations. Regression models for predicting the individual stem volumes of Populus xiaohei were established using extracted crown width, as well as estimated tree parameters (i.e. diameter at breast height [DBH] and tree height) as predictors. Our results indicated that crown width could be accurately extracted from QuickBird images using a multi-scale segmentation approach with a mean relative error of 5.74%, especially for wide-spacing stands. Using either extracted crown width alone or with estimated DBH and tree height can successfully estimate individual stem volume of Populus xiaohei with the R2 value ranging from 0.87 to 0.92 depending on different model forms. In particular, the two second-order polynomial models (model2 and model 6), based on QuickBird image-derived crown widths and estimated DBH and tree heights, respectively, were the best at describing the relationship between stem volume and tree characteristics.

  6. Association genetics and expression patterns of a CBF4 homolog in Populus under abiotic stress.

    Science.gov (United States)

    Li, Ying; Xu, Baohua; Du, Qingzhang; Zhang, Deqiang

    2015-06-01

    New strategies for prevention and treatment of abiotic stress require an improved understanding of stress responses. Here, we examined response differences of a C-repeat binding factor gene (PsCBF4) between five species in the genus Populus. We also used a candidate gene-based approach to identify single nucleotide polymorphisms (SNPs) within PsCBF4 that were associated with physiological and biochemical traits in a natural population (528 unrelated individuals) of Populus simonii. We first isolated a 1,044-bp PsCBF4 cDNA encoding a polypeptide of 256 amino acids. Expression profiling revealed that CBF4 is differentially expressed under cold, heat, drought, and salt conditions among five Populus species. Cold stress is the most significant interspecific difference, and PsCBF4 transcript levels ranged from 6.5 to 379.5 times higher than in unstressed controls. A natural population of P. simonii showed high nucleotide diversity (π T = 0.00880, θ w = 0.01192) and low linkage disequilibrium (r (2) ≥ 0.1, within 700 bp) across PsCBF4. Association analysis showed that nine SNPs (false discovery rate Q stress tolerance in P. simonii.

  7. Palaeogene fossil Populus leaves from Lanzhou Basin and their palaeoclimatic significance

    Institute of Scientific and Technical Information of China (English)

    SUN Bainian; YAN Defei; XIE Sanping; CONG Peiyun; XIN Cunlin; YUN Fei

    2004-01-01

    An angiosperm compression flora is found in Palaeogene from Lanzhou Basin and the cuticular analysis of Populus davidiana Dode in the flora is carefully made. Furthermore, the fossil cuticles are compared with the epidermal structures of extant Populus leaves growing in different environments, I.e. Moist, semimoist, and semiarid to arid climatic regions. The present experiments indicate that mature leaves of P. Davidiana show leaf size from big to small, leaf cuticles from thick to thin and anticlinal walls of epidermal cells from faintness to clarity along with the increase of latitudes of the plant distributions, the climatic variation from moist to arid, the annual precipitation from more to less and the annual mean temperature from high to low. The fossil P.davidiana differs from the specimens collected from Shandan in semiarid to arid climatic regions but closely resembles the Wushan leaves in a semi-moist climatic area in a lot of features. In a word, the new research may reflect that the flora lives in a semi-moist climatic environment. The present discovery of compression of Paleogene Populus davidiana is of great significance to studying vegetation types, climatic and environmental changes during the primal uplifting of the Qinghai-Tibet Plateau.

  8. Plants remember past weather: a study for atmospheric pollen concentrations of Ambrosia, Poaceae and Populus

    Science.gov (United States)

    Matyasovszky, István; Makra, László; Csépe, Zoltán; Sümeghy, Zoltán; Deák, Áron József; Pál-Molnár, Elemér; Tusnády, Gábor

    2015-10-01

    After extreme dry (wet) summers or years, pollen production of different taxa may decrease (increase) substantially. Accordingly, studying effects of current and past meteorological conditions on current pollen concentrations for different taxa have of major importance. The purpose of this study is separating the weight of current and past weather conditions influencing current pollen productions of three taxa. Two procedures, namely multiple correlations and factor analysis with special transformation are used. The 11-year (1997-2007) data sets include daily pollen counts of Ambrosia (ragweed), Poaceae (grasses) and Populus (poplar), as well as daily values of four climate variables (temperature, relative humidity, global solar flux and precipitation). Multiple correlations of daily pollen counts with simultaneous values of daily meteorological variables do not show annual course for Ambrosia, but do show definite trends for Populus and Poaceae. Results received using the two methods revealed characteristic similarities. For all the three taxa, the continental rainfall peak and additional local showers in the growing season can strengthen the weight of the current meteorological elements. However, due to the precipitation, big amount of water can be stored in the soil contributing to the effect of the past climate elements during dry periods. Higher climate sensitivity (especially water sensitivity) of the herbaceous taxa ( Ambrosia and Poaceae) can be definitely established compared to the arboreal Populus. Separation of the weight of the current and past weather conditions for different taxa involves practical importance both for health care and agricultural production.

  9. Above- and Below-ground Biomass, Net Ecosystem Carbon Exchange, and Soil Respiration in a Poplar Populus deltoides Bartr.) stand : Changes after 3 years of Growth under Elevated CO2

    Science.gov (United States)

    Barron-Gafford, G. A.; Grieve, K.; Bil, K.; Kudeyarov, V.; Handley, L.; Murthy, R.

    2003-12-01

    Stands of cottonwood (Populus deltoides Bartr.) trees were grown as a coppiced system under ambient (40 Pa), twice ambient (80 Pa), and three times ambient (120 Pa) partial pressure CO2 for the past three years in the Intensively-managed Forest Mesocosm (IFM) of the Biosphere 2 Center. Over three years Net Ecosystem CO2 exchange (NECE) was measured continuously and in the third year, nine whole trees were harvested from each CO2 treatment over the growing season. Both above- and below-ground parameters were measured. Three years of growth under elevated CO2 showed the expected stimulation in foliar biomass (8.7, 11.9, and 13.1 kg for the 40, 80, and 120 Pa treatments, respectively). Rates of NECE also followed an expected increase with elevated atmospheric CO2 concentrations, with maximum CO2 uptake rates reaching 10.5, 15.6, and 19.6 μ moles m-2 s-1 in the 40, 80, and 120 Pa treatments, respectively. However, above ground woody biomass and root biomass were not much stimulated beyond 80 Pa CO2. Wood/foliage and above/below ground biomass ratios reflect this decline. Under conditions of non-limiting nutrients and water, we found consistent increases in the above/below ground biomass ratio and wood to foliage biomass ratios in the 80 compared to the 40 Pa pCO2. Woody biomass production and the above/below ground biomass ratio were lower under the 120 Pa than any other treatment. Although biomass production did not change appreciably between 80 and 120 Pa CO2 treatments, both substrate induced and in-situ soil respiration values are also significantly higher in the 120Pa treatment, though no differences were present prior to CO2 treatments (Murthy et al. 2003). The unique closed-system operation of the IFM allowed for measures of soil CO2 efflux to be measured at both the soil collar and stand scales using a box model that takes into account all inputs and outputs from the stand. In-situ soil respiration rates increased significantly with increased atmospheric CO2

  10. Dissolved greenhouse gas concentrations and fluxes from Wetlands P7 and P8 of the Cottonwood Lake Study area, Stutsman County, North Dakota, 2015

    Science.gov (United States)

    Bansal, Sheel; Tangen, Brian

    2016-01-01

    A study was conducted to assess the relationships among carbon mineralization, sulfate reduction and greenhouse gas emissions in prairie pothole wetlands. These data are for dissolved methane and carbon dioxide concentrations and fluxes. Dissolved gas concentrations in the water column and fluxes to the atmosphere were estimated from April through November, 2015 for wetlands P7 and P8 of the Cottonwood Lake Study area, Stutsman County, North Dakota. Dissolved gases in the water column were collected every two weeks using a pumping-induced ebullition device. Gas flux samples were collected concurrently at the water-atmosphere interface using the vented static-chamber method. Gas concentrations of the gas samples were determined using gas chromatography. Air and water temperature and water depth also were collected concurrently. These data directly support the associated publication “Abundant carbon substrates drive extremely high sulfate reduction rates and methane fluxes in Prairie Pothole Wetlands” which is referenced within the Metadata.

  11. Elucidating the evolutionary history and expression patterns of nucleoside phosphorylase paralogs (vegetative storage proteins) in Populus and the plant kingdom.

    Science.gov (United States)

    Pettengill, Emily A; Pettengill, James B; Coleman, Gary D

    2013-08-19

    Nucleoside phosphorylases (NPs) have been extensively investigated in human and bacterial systems for their role in metabolic nucleotide salvaging and links to oncogenesis. In plants, NP-like proteins have not been comprehensively studied, likely because there is no evidence of a metabolic function in nucleoside salvage. However, in the forest trees genus Populus a family of NP-like proteins function as an important ecophysiological adaptation for inter- and intra-seasonal nitrogen storage and cycling. We conducted phylogenetic analyses to determine the distribution and evolution of NP-like proteins in plants. These analyses revealed two major clusters of NP-like proteins in plants. Group I proteins were encoded by genes across a wide range of plant taxa while proteins encoded by Group II genes were dominated by species belonging to the order Malpighiales and included the Populus Bark Storage Protein (BSP) and WIN4-like proteins. Additionally, we evaluated the NP-like genes in Populus by examining the transcript abundance of the 13 NP-like genes found in the Populus genome in various tissues of plants exposed to long-day (LD) and short-day (SD) photoperiods. We found that all 13 of the Populus NP-like genes belonging to either Group I or II are expressed in various tissues in both LD and SD conditions. Tests of natural selection and expression evolution analysis of the Populus genes suggests that divergence in gene expression may have occurred recently during the evolution of Populus, which supports the adaptive maintenance models. Lastly, in silico analysis of cis-regulatory elements in the promoters of the 13 NP-like genes in Populus revealed common regulatory elements known to be involved in light regulation, stress/pathogenesis and phytohormone responses. In Populus, the evolution of the NP-like protein and gene family has been shaped by duplication events and natural selection. Expression data suggest that previously uncharacterized NP-like proteins may

  12. Twenty-One Genome Sequences from Pseudomonas Species and 19 Genome Sequences from Diverse Bacteria Isolated from the Rhizosphere and Endosphere of Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Steven D [ORNL; Utturkar, Sagar M [ORNL; Klingeman, Dawn Marie [ORNL; Johnson, Courtney M [ORNL; Martin, Stanton [ORNL; Land, Miriam L [ORNL; Lu, Tse-Yuan [ORNL; Schadt, Christopher Warren [ORNL; Doktycz, Mitchel John [ORNL; Pelletier, Dale A [ORNL

    2012-01-01

    To aid in the investigation of the Populus deltoides microbiome we generated draft genome sequences for twenty one Pseudomonas and twenty one other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Burkholderia, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium and Variovorax were generated.

  13. Diversification and expression of the PIN, AUX/LAX and ABCB families of putative auxin transporters in Populus

    Directory of Open Access Journals (Sweden)

    Nicola eCarraro

    2012-02-01

    Full Text Available Intercellular transport of the plant hormone auxin is mediated by three families of membrane-bound protein carriers, with the PIN and ABCB families coding primarily for efflux proteins and the AUX/LAX family coding for influx proteins. In the last decade our understanding of gene and protein function for these transporters in Arabidopsis has expanded rapidly but very little is known about their role in woody plant development. Here we present a comprehensive account of all three families in the model woody species Populus, including chromosome distribution, protein structure, quantitative gene expression, and evolutionary relationships. The PIN and AUX/LAX gene families in Populus comprise 16 and 8 members respectively, and show evidence for the retention of paralogs following a relatively recent whole genome duplication. There is also evidence for differential expression across tissues within many gene pairs. The ABCB family is previously undescribed in Populus and includes 20 members, showing a much deeper evolutionary history including both tandem and whole genome duplication as well as probable loss. A striking number of these transporters are expressed in developing Populus stems and we suggest that evolutionary and structural relationships with known auxin transporters in Arabidopsis can point toward candidate genes for further study in Populus. This is especially important for the ABCBs, which is a large family and includes members in Arabidopsis that are able to transport other substrates in addition to auxin. Protein modeling, sequence alignment and expression data all point to ABCB1.1 as a likely auxin transport protein in Populus. Given that basipetal auxin flow through the cambial zone shapes the development of woody stems, it is important that we identify the full complement of proteins involved in this process. This work should lay the foundation for studies targeting specific proteins for functional characterization and in situ

  14. Interaction of nitrogen nutrition and salinity in Grey poplar (Populus tremula x alba).

    Science.gov (United States)

    Ehlting, B; Dluzniewska, P; Dietrich, H; Selle, A; Teuber, M; Hänsch, R; Nehls, U; Polle, A; Schnitzler, J-P; Rennenberg, H; Gessler, A

    2007-07-01

    Salinity represents an increasing environmental problem in managed ecosystems. Populus spp. is widely used for wood production by short-rotation forestry in fertilized plantations and can be grown on saline soil. Because N fertilization plays an important role in salt tolerance, we analysed Grey poplar (Populus tremula x alba, syn. Populus canescens) grown with either 1 mM nitrate or ammonium subjected to moderate 75 mM NaCl. The impact of N nutrition on amelioration of salt tolerance was analysed on different levels of N metabolism such as N uptake, assimilation and N (total N, proteins and amino compounds) accumulation. Na concentration increased in all tissues over time of salt exposure. The N nutrition-dependent effects of salt exposure were more intensive in roots than in leaves. Application of salt reduced root increment as well as stem height increase and, at the same time, increased the concentration of total amino compounds more intensively in roots of ammonium-fed plants. In leaves, salt treatment increased concentrations of total N more intensively in nitrate-fed plants and concentrations of amino compounds independently of N nutrition. The major changes in N metabolism of Grey poplar exposed to moderate salt concentrations were detected in the significant increase of amino acid concentrations. The present results indicate that N metabolism of Grey poplar exposed to salt performed better when the plants were fed with nitrate instead of ammonium as sole N source. Therefore, nitrate fertilization of poplar plantations grown on saline soil should be preferred.

  15. Effects of invasive European bird cherry (Prunus padus) on leaf litter processing by aquatic invertebrate shredder communities in urban Alaskan streams

    Science.gov (United States)

    Roon, David A.; Wipfli, Mark S.; Wurtz, Tricia L.

    2014-01-01

    European bird cherry (Prunus padus) (EBC) is an invasive ornamental tree that is spreading rapidly in riparian forests of urban Alaska. To determine how the spread of EBC affects leaf litter processing by aquatic invertebrate shredders, we conducted complementary leaf pack experiments in two streams located in Anchorage, Alaska. The first experiment contrasted invasive EBC with three native tree species—thin-leaf alder (Alnus tenuifolia), paper birch (Betula neoalaskana), and black cottonwood (Populus trichocarpa)—in one reach of Chester Creek; finding that EBC leaf litter broke down significantly faster than birch and cottonwood, but at a similar rate to alder. The second experiment contrasted EBC with alder in four reaches of Campbell and Chester creeks; finding that while EBC leaf litter broke down significantly faster than alder in Chester Creek, EBC broke down at a similar rate to alder in Campbell Creek. Although EBC sometimes supported fewer shredders by both count and mass, shredder communities did not differ significantly between EBC and native plants. Collectively, these data suggest that invasive EBC is not currently exhibiting strong negative impacts on leaf litter processing in these streams, but could if it continues to spread and further displaces native species over time.

  16. Erfassung, Identifizierung, Vermehrung und Wiederansiedlung der Schwarzpappel Populus nigra in Sachsen-Anhalt

    OpenAIRE

    2013-01-01

    Durch den Flußlauf der Elbe und ihre Nebenflüsse sind in Sachsen-Anhalt aktuelle und potentielle Vorkommensgebiete der Schwarzpappel (Populus nigra) vorhanden. Die natürlichen Standorte der Schwarzpappel sind die Übergangszonen von Weichholzund Hartholzaue (ELLENBERG 1996), wie sie an naturnahen Flußufern zu finden sind. Im Gegensatz zu anderen Baumarten erträgt die Schwarzpappel wie auch Baumweidenarten Hochwasserstände von bis zu 90 Tagen und damit mittlere Hochwässer. Auf Grund der Konkurr...

  17. Stress Responsive Zinc-finger Protein Gene of Populus euphratica in Tobacco Enhances Salt Tolerance

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The Populus euphratica stress responsive zinc-finger protein gene PSTZ, which encodes a protein including typical Cys2/His2 zinc finger structure, was isolated by reverse transcription-polymerase chain reaction from P. euphratica.Northern hybridization revealed that its expression was induced under drought and salt stress conditions. To examine its function, cDNA of the PSTZ gene, driven by the cauliflower mosaic virus 35S promoter, was cloned into a plant expression vector pBin438 and introduced into tobacco plants. Transgenic tobacco showed an enhanced salt tolerance, suggesting that PSTZ may play a role in plant responsiveness to salt stress.

  18. Populations of aspen (Populus tremuloides Michx.) with different evolutionary histories differ in their climate occupancy.

    Science.gov (United States)

    Greer, Burke T; Still, Christopher; Howe, Glenn T; Tague, Christina; Roberts, Dar A

    2016-05-01

    Quaking aspens (Populus tremuloides Michx.) are found in diverse habitats throughout North America. While the biogeography of aspens' distribution has been documented, the drivers of the phenotypic diversity of aspen are still being explored. In our study, we examined differences in climate between northern and southwestern populations of aspen, finding large-scale differences between the populations. Our results suggest that northern and southwestern populations live in distinct climates and support the inclusion of genetic and phenotypic data with species distribution modeling for predicting aspens' distribution.

  19. Temporal heterogeneity of Populus euphratica seed rain in Ejina Oasis, China

    OpenAIRE

    Cao, Dechang; Li, Jingwen; Chen,Weiqiang; Li, Junqing

    2009-01-01

    The seed rain of Populus euphratica in Ejina Oasis was continuously studied in the years of 2004, 2006, 2007, and 2008. The duration of P. euphratica seed rain in a community was usually 2 to 3 weeks, with a peak period of 7 to 14 days. Approximately 90% of the total number of seeds were dispersed in the peak period, and for a single day most seeds fell between the hours of 10:00 to 16:00. It was found that the seed rain of P. euphratica was determined by a combination of biological rhythms a...

  20. Metabolic profiling reveals altered sugar and secondary metabolism in response to UGPase overexpression in Populus

    OpenAIRE

    2014-01-01

    Background UDP-glucose pyrophosphorylase (UGPase) is a sugar-metabolizing enzyme (E.C. 2.7.7.9) that catalyzes a reversible reaction of UDP-glucose and pyrophosphate from glucose-1-phosphate and UTP. UDP-glucose is a key intermediate sugar that is channeled to multiple metabolic pathways. The functional role of UGPase in perennial woody plants is poorly understood. Results We characterized the functional role of a UGPase gene in Populus deltoides, PdUGPase2. Overexpression of the native gene ...

  1. Effects of antibiotics on plantlet regeneration via organogenesis in Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    Ding Xia; Chen Xiao-yang; Li Wei; Du Zhi-yan

    2006-01-01

    Four antibiotics, kanamycin, geneticin, carbenicillin and cefotaxime, were evaluated for their effect on the regeneration of adventitious buds, shoot differentiation, rooting from regenerated shoots of Populus euphratica as well as on their control of Agrobacterium-mediated transformations. Results showed that the optimum concentration ranges of kanamycin and geneticin were 15-20 and 10-15 mg·L-1 at the stage of transgenic plantlet selection. The inhibitory effects of cefotaxime and carbenicillin varied among different genotypes of Agrobacterium. The inhibition of cefotaxime on Agrobacterium C58 was stronger than that of carbenicillin.LBA4404 and their optimum concentrations were both 150 mg·L-1.

  2. Commercial wood of clones of genus Populus: Relationship between growth and density of wood with inorganic nutrients

    OpenAIRE

    Senisterra, Gabriela; Marlats, Raúl M.; Ducid, María G.

    2008-01-01

    El objetivo del trabajo fue determinar sobre 10 clones de álamos, provenientes de cruzamientos intraespecíficos de Populus deltoides e interespecíficos de Populus x canadensis, implantados en Teodelina, Santa Fe, Argentina (34°09' S; 61°15' W), la concentración de nutrientes inorgánicos en su corteza y leño, y sus relaciones con los volúmenes comerciales alcanzados a los 9 años de edad y la densidad bási...

  3. Tree rings, Populus nigra L., as mercury data logger in aquatic environments: case study of an historically contaminated environment.

    Science.gov (United States)

    Abreu, S N; Soares, A M V M; Nogueira, A J A; Morgado, F

    2008-03-01

    In this study, a tree (Populus nigra L.) has been presented as data logger of mercury release in aquatic environments using tree rings chemistry to provide chronological historical monitoring of mercury discharge from a chlor-alkali industrial effluent to a coastal lagoon. Tree rings (Populus nigra L.) as mercury data logger is suggested by mercury accumulation trends in the tree rings reflecting the industrial plant capacity increments in the early stages of mercury discharges and enhancing industrial plant controls to minimize mercury discharges in the last two decades after imposed global regulations on mercury emissions.

  4. Development of a channel classification to evaluate potential for cottonwood restoration, lower segments of the Middle Missouri River, South Dakota and Nebraska

    Science.gov (United States)

    Jacobson, Robert B.; Elliott, Caroline M.; Huhmann, Brittany L.

    2010-01-01

    This report documents development of a spatially explicit river and flood-plain classification to evaluate potential for cottonwood restoration along the Sharpe and Fort Randall segments of the Middle Missouri River. This project involved evaluating existing topographic, water-surface elevation, and soils data to determine if they were sufficient to create a classification similar to the Land Capability Potential Index (LCPI) developed by Jacobson and others (U.S. Geological Survey Scientific Investigations Report 2007–5256) and developing a geomorphically based classification to apply to evaluating restoration potential.Existing topographic, water-surface elevation, and soils data for the Middle Missouri River were not sufficient to replicate the LCPI. The 1/3-arc-second National Elevation Dataset delineated most of the topographic complexity and produced cumulative frequency distributions similar to a high-resolution 5-meter topographic dataset developed for the Lower Missouri River. However, lack of bathymetry in the National Elevation Dataset produces a potentially critical bias in evaluation of frequently flooded surfaces close to the river. High-resolution soils data alone were insufficient to replace the information content of the LCPI. In test reaches in the Lower Missouri River, soil drainage classes from the Soil Survey Geographic Database database correctly classified 0.8–98.9 percent of the flood-plain area at or below the 5-year return interval flood stage depending on state of channel incision; on average for river miles 423–811, soil drainage class correctly classified only 30.2 percent of the flood-plain area at or below the 5-year return interval flood stage. Lack of congruence between soil characteristics and present-day hydrology results from relatively rapid incision and aggradation of segments of the Missouri River resulting from impoundments and engineering. The most sparsely available data in the Middle Missouri River were water

  5. Fractionation of alkali-solubilized hemicelluloses from delignified Populus gansuensis: structure and properties.

    Science.gov (United States)

    Peng, Feng; Ren, Jun-Li; Xu, Feng; Bian, Jing; Peng, Pai; Sun, Run-Cang

    2010-05-12

    The dewaxed cell walls of Populus gansuensis were delignified with NaClO(2) and then sequentially extracted with 0.25, 0.5, and 1.0 M KOH under a solid to liquid ratio of 1: 25 (g mL(-1)) at 25 degrees C for 10 h. The successive treatments together resulted in the dissolution of 83.7% of original hemicelluloses. The solubilized hemicellulosic fractions were further fractionated into six hemicellulosic subfractions by an iodine-complex precipitation technique. Their chemical and physical characteristics were determined by HPAEC, GPC, FT-IR, and (1)H and (13)C NMR spectroscopy. Neutral sugar composition and molecular weight analysis showed that, for each extract, the hemicellulosic subfractions that precipitated with aqueous potassium iodide-iodine had lower overall uronic acid/xylose (Uro/Xyl) ratios and higher molecular weights (M(w)) than those remaining in the solution. FT-IR, (1)H, and (13)C NMR spectroscopy analysis indicated that the alkali-soluble hemicelluloses of Populus gansuensis had a structure composed of the (1 --> 4)-linked beta-D-xylopyranosyl backbone with 4-O-methyl-alpha-D-glucuronic acid attached to O-2 of the xylose residues.

  6. An Elite Variety of Populus deltoides‘Beiyang’%杨树良种‘北杨’

    Institute of Scientific and Technical Information of China (English)

    曹国玉; 李继祥; 买买提库尔班·阿力; 李开花; 胡建军

    2016-01-01

    The‘Beiyang’,male clone and intraspecific hybrid of Populus deltoides hybrid,was selected from the progeny of Populus deltoides‘Nankang’× P. deltoides‘D175’by the way of artificial control cross pollination. Average DBH,height and volume of nine-year-old‘Beiyang’were 21. 3 cm,20. 4 m and 0. 250 m3 ,which were 49. 9% greater than the control‘2025’. The elite variety has the fine characteristics such as straight trunk,middle crown,fast-growing, strong resistance to Anoplophora glaberipennis and soil barren tolerance.%‘北杨’是通过人工控制授粉选育而成,雄株,为美洲黑杨种内杂种,其母本为南抗杨,父本为‘D175’。9年生平均胸径21.3 cm,平均树高20.4 m,单株材积0.250 m3,比对照‘中林2025杨’材积生长量提高49.9%。树冠长卵形,干形通直,冠幅中等,早期速生,抗光肩星天牛,耐瘠薄。

  7. Hot water and dilute acid pretreatment of high and low specific gravity Populus deltoides clones.

    Science.gov (United States)

    Martin, Elizabeth M; Bunnell, Kris A; Lau, Ching-Shuan; Pelkki, Matthew H; Patterson, David W; Clausen, Edgar C; Smith, James A; Carrier, Danielle Julie

    2011-02-01

    Populus sp. are hardwood feedstocks that grow in forest management areas that are logged for softwoods; however, they are also being considered as an energy-destined feedstock. The objective of this work was to determine the effect of xylose yield from dilute acid and hot water pretreatments performed in unstirred batch stainless steel reactors at temperatures ranging from 140 to 200°C. Populus deltoides clones S13C20 and S7C15 used in this study originated from Eastern Texas and were cultivated for 14 years in Pine Tree, AR. P. deltoides clones S13C20 and S7C15 had specific gravities of 0.48 and 0.40, respectively. Bark and wood were examined separately. As expected, hot water pretreatments, in the tested temperature range, resulted in very little direct xylose recovery. However, the 140°C dilute acid pretreatment of the lower specific gravity clone, S7C15, wood yielded the highest average xylose recovery of 56%. This condition also yielded the highest concentration of furfural, 9 mg/g sample, which can be inhibitory to the fermentation step. The highest xylose recovery from bark samples, 31%, was obtained with clone S7C15, using the 160°C dilute acid pretreatment for 60 min.

  8. Differential detection of genetic Loci underlying stem and root lignin content in Populus.

    Directory of Open Access Journals (Sweden)

    Tongming Yin

    Full Text Available In this study, we established a comprehensive genetic map with a large number of progeny from a three-generation hybrid Populus intercross, and phenotyped the lignin content, S/G ratio and 28 cell wall subcomponents both in stems and roots for the mapping individuals. Phenotypic analysis revealed that lignin content and syringyl-to-guaiacyl (S/G ratio using pyrolysis molecular beam mass spectroscopy (pyMBMS varied among mapping individuals. Phenotypic analysis revealed that stem lignin content is significantly higher than that in root and the quantified traits can be classified into four distinct groups, with strong correlations observed among components within organs. Altogether, 179 coordinating QTLs were detected, and they were co-localized into 49 genetic loci, 27 of which appear to be pleiotropic. Many of the detected genetic loci were detected differentially in stem and root. This is the first report of separate genetic loci controlling cell wall phenotypes above and below ground. These results suggest that it may be possible to modify lignin content and composition via breed and/or engineer as a means of simultaneously improving Populus for cellulosic ethanol production and carbon sequestration.

  9. The transcriptome of Populus in elevated CO2 reveals increased anthocyanin biosynthesis during delayed autumnal senescence

    Energy Technology Data Exchange (ETDEWEB)

    Tallis, M.J.; Rogers, A.; Lin, Y.; Zhang, J.; Street, N. R.; Miglietta, F.; Karnosky, D. F.; Angelis, P. D.; Calfapietra, C.; Taylor, G.

    2010-03-01

    The delay in autumnal senescence that has occurred in recent decades has been linked to rising temperatures. Here, we suggest that increasing atmospheric CO{sub 2} may partly account for delayed autumnal senescence and for the first time, through transcriptome analysis, identify gene expression changes associated with this delay. Using a plantation of Populus x euramericana grown in elevated [CO{sub 2}] (e[CO{sub 2}]) with free-air CO{sub 2} enrichment (FACE) technology, we investigated the molecular and biochemical basis of this response. A Populus cDNA microarray was used to identify genes representing multiple biochemical pathways influenced by e[CO{sub 2}] during senescence. Gene expression changes were confirmed through real-time quantitative PCR, and leaf biochemical assays. Pathways for secondary metabolism and glycolysis were significantly up-regulated by e[CO{sub 2}] during senescence, in particular, those related to anthocyanin biosynthesis. Expressed sequence tags (ESTs) representing the two most significantly up-regulated transcripts in e[CO{sub 2}], LDOX (leucoanthocyanidin dioxgenase) and DFR (dihydroflavonol reductase), gave (e[CO{sub 2}]/ambient CO{sub 2} (a[CO{sub 2}])) expression ratios of 39.6 and 19.3, respectively. We showed that in e[CO{sub 2}] there was increased autumnal leaf sugar accumulation and up-regulation of genes determining anthocyanin biosynthesis which, we propose, prolongs leaf longevity during natural autumnal senescence.

  10. Degradation of Populus euphratica community in the lower reaches of the Tarim River, Xinjiang, China

    Institute of Scientific and Technical Information of China (English)

    LIU Jia-zhen; CHEN Ya-ning; CHEN Yong-jin; ZHANG Na; LI Wei-hong

    2005-01-01

    To investigate the relationships between the degradation of plant community and groundwater level in the lower reaches of the Tarim River, nine monitored sections were set along the main stream, where there had been no runoff for nearly 30 years. The characteristics of plant communities were analyzed. It was found that the coverage of trees gradually decreased along the groundwater depth gradient, while the coverage of shrubs slightly increased rather than decreased at first and then gradually decreased, and the coverage of herbs steadily decreased at the beginning and then quickly decreased. The species diversity and species richness of both herbs and woody plants showed obvious degrading trends, while the variations in species evenness were slight. The degrading sequences of species were related to their physiological and ecological characteristics, especially their sensitivity to changes of groundwater table. The herbs with shallow roots first degenerated or disappeared when the groundwater table fell, and then did the deep-rooted herbs, and finally the trees and shrubs with strong tolerance to drought degenerated. The Populus euphratica communities showed typical degrading characteristics, namely the dominant species Populus euphratica remained its dominant status during the degradation. Overall, the existence of strongly tolerant-drought species was the obvious indication of plant species degradation; while simplification of community structure and the decrease of species richness were the obvious indication of plant community degradation.

  11. Reproductive characteristics of a Populus euphratica population and prospects for its restoration in China.

    Directory of Open Access Journals (Sweden)

    Dechang Cao

    Full Text Available Populus euphratica is a dominant tree in riparian ecosystems in arid areas of northwest China, but it fails to regenerate in these systems. This study evaluates causes for the failure of sexual and asexual regeneration of this species in the wild. P. euphratica disperses as many as 85743 seeds/m(2 during summer, and the seeds germinate to 92.0% in distilled water and to 60.8% on silt. However, very few seeds (3.6% can germinate on unflooded soil. The seed-rain season is prolonged by temporal variability in seed dispersal among individuals, which ensures that seedling emergence can occur during favorable conditions (i.e., floods and rainfall. As a result of water shortage and river channeling due to water usage and altered river flows, there are no safe sites on river banks for seed germination, which has led to the failure of P. euphratica to regenerate from seed. Root suckers of P. euphratica were present in 86% of the forest gaps investigated. However, extensive grazing has destroyed many of them and thus has reduced this form of regeneration. This research suggests that human activities are resulting in the failure of P. euphratica to regenerate. Changes in land management such as reduced use of concrete canals in Populus forests and/or reduced sheep grazing in these areas may promote their regeneration.

  12. Salt stress induces the formation of a novel type of 'pressure wood' in two Populus species.

    Science.gov (United States)

    Janz, Dennis; Lautner, Silke; Wildhagen, Henning; Behnke, Katja; Schnitzler, Jörg-Peter; Rennenberg, Heinz; Fromm, Jörg; Polle, Andrea

    2012-04-01

    • Salinity causes osmotic stress and limits biomass production of plants. The goal of this study was to investigate mechanisms underlying hydraulic adaptation to salinity. • Anatomical, ecophysiological and transcriptional responses to salinity were investigated in the xylem of a salt-sensitive (Populus × canescens) and a salt-tolerant species (Populus euphratica). • Moderate salt stress, which suppressed but did not abolish photosynthesis and radial growth in P. × canescens, resulted in hydraulic adaptation by increased vessel frequencies and decreased vessel lumina. Transcript abundances of a suite of genes (FLA, COB-like, BAM, XET, etc.) previously shown to be activated during tension wood formation, were collectively suppressed in developing xylem, whereas those for stress and defense-related genes increased. A subset of cell wall-related genes was also suppressed in salt-exposed P. euphratica, although this species largely excluded sodium and showed no anatomical alterations. Salt exposure influenced cell wall composition involving increases in the lignin : carbohydrate ratio in both species. • In conclusion, hydraulic stress adaptation involves cell wall modifications reciprocal to tension wood formation that result in the formation of a novel type of reaction wood in upright stems named 'pressure wood'. Our data suggest that transcriptional co-regulation of a core set of genes determines reaction wood composition.

  13. Field performance of Populus in short-rotation intensive culture plantations in the north-central U.S.

    Science.gov (United States)

    Edward A. Hansen; Michael E. Ostry; Wendell D. Johnson; David N. Tolsted; Daniel A. Netzer; William E. Berguson; Richard B. Hall

    1994-01-01

    Describes a network of short-rotation, Populus research and demonstration plantations that has been established across a 5-state region in the north-central U.S. to identify suitable hybrid poplar clones for large-scale biomass plantations in the region. Reports 6-year results.

  14. Biomass traits and candidate genes for bioenergy revealed through association genetics in coppiced European Populus nigra (L.)

    NARCIS (Netherlands)

    Allwright, Mike Robert; Payne, Adrienne; Emiliani, Giovanni; Milner, Suzanne; Viger, Maud; Rouse, Franchesca; Keurentjes, Joost J.B.; Bérard, Aurélie; Wildhagen, Henning; Faivre-Rampant, Patricia; Polle, Andrea; Morgante, Michele; Taylor, Gail

    2016-01-01

    Background: Second generation (2G) bioenergy from lignocellulosic feedstocks has the potential to develop as a sustainable source of renewable energy; however, significant hurdles still remain for large-scale commercialisation. Populus is considered as a promising 2G feedstock and understanding t

  15. Sapflow of hybrid poplar (Populus nigra L. x P. maximowiczii A. Henry 'NM6') during phytoremediation of landfill leachate

    Science.gov (United States)

    Ronald S., Jr. Zalesny; Adam H. Wiese; Edmund O. Bauer; Don E. Riemenschneider

    2006-01-01

    Poplars are ideal for phytoremediation because of their high water usage, fast growth, and deep root systems. We measured in 2002 and 2003 the sapflow of hybrid poplars (Populus nigra L. x P. maximowiczii A. Henry 'NM6') planted in 1999 for phytoremediation of a landfill in Rhinelander, WI, USA (45.6?N, 89.4?W).

  16. Differential phylogenetic expansions in BAHD acyltransferases across five angiosperm taxa and evidence of divergent expression among Populus paralogues

    Directory of Open Access Journals (Sweden)

    Johnson Virgil E

    2011-05-01

    Full Text Available Abstract Background BAHD acyltransferases are involved in the synthesis and elaboration of a wide variety of secondary metabolites. Previous research has shown that characterized proteins from this family fall broadly into five major clades and contain two conserved protein motifs. Here, we aimed to expand the understanding of BAHD acyltransferase diversity in plants through genome-wide analysis across five angiosperm taxa. We focus particularly on Populus, a woody perennial known to produce an abundance of secondary metabolites. Results Phylogenetic analysis of putative BAHD acyltransferase sequences from Arabidopsis, Medicago, Oryza, Populus, and Vitis, along with previously characterized proteins, supported a refined grouping of eight major clades for this family. Taxon-specific clustering of many BAHD family members appears pervasive in angiosperms. We identified two new multi-clade motifs and numerous clade-specific motifs, several of which have been implicated in BAHD function by previous structural and mutagenesis research. Gene duplication and expression data for Populus-dominated subclades revealed that several paralogous BAHD members in this genus might have already undergone functional divergence. Conclusions Differential, taxon-specific BAHD family expansion via gene duplication could be an evolutionary process contributing to metabolic diversity across plant taxa. Gene expression divergence among some Populus paralogues highlights possible distinctions between their biochemical and physiological functions. The newly discovered motifs, especially the clade-specific motifs, should facilitate future functional study of substrate and donor specificity among BAHD enzymes.

  17. Comparative physiology of allopatric Populus species: geographic clines in photosynthesis, height growth, and carbon isotope discrimination in common gardens.

    Science.gov (United States)

    Soolanayakanahally, Raju Y; Guy, Robert D; Street, Nathaniel R; Robinson, Kathryn M; Silim, Salim N; Albrectsen, Benedicte R; Jansson, Stefan

    2015-01-01

    Populus species with wide geographic ranges display strong adaptation to local environments. We studied the clinal patterns in phenology and ecophysiology in allopatric Populus species adapted to similar environments on different continents under common garden settings. As a result of climatic adaptation, both Populus tremula L. and Populus balsamifera L. display latitudinal clines in photosynthetic rates (A), whereby high-latitude trees of P. tremula had higher A compared to low-latitude trees and nearly so in P. balsamifera (p = 0.06). Stomatal conductance (g s) and chlorophyll content index (CCI) follow similar latitudinal trends. However, foliar nitrogen was positively correlated with latitude in P. balsamifera and negatively correlated in P. tremula. No significant trends in carbon isotope composition of the leaf tissue (δ(13)C) were observed for both species; but, intrinsic water-use efficiency (WUEi) was negatively correlated with the latitude of origin in P. balsamifera. In spite of intrinsically higher A, high-latitude trees in both common gardens accomplished less height gain as a result of early bud set. Thus, shoot biomass was determined by height elongation duration (HED), which was well approximated by the number of days available for free growth between bud flush and bud set. We highlight the shortcoming of unreplicated outdoor common gardens for tree improvement and the crucial role of photoperiod in limiting height growth, further complicating interpretation of other secondary effects.

  18. Research Progress on the Salt-tolerance of Populus spp.%杨树耐盐性研究进展

    Institute of Scientific and Technical Information of China (English)

    陈必胜; 汪晓沙; 黄梅; 朱继军; 林登贵; 李梅玲; 李萍; 曾丽

    2012-01-01

    杨树生长迅速、生物产量高,是一种世界性的造林树种,一些杨树具有较强的耐盐性,对盐碱化土地的利用和开发具有重要价值.对盐胁迫下杨树的植物学特征、生理生化指标变化、耐盐分子机制和遗传改良策略进行了综述,并对深入地解析杨树耐盐分子机制应采取策略和在生产中应用前景进行了讨论,以期为筛选和培育耐盐杨树品种提供借鉴和参考.%Populus spp. is a world-wide tree species for forestation with rapid growth and higher biomass. Due to stronger salt-tolerance of some Populus spp. varieties, they may be used to exploit the potential value of the salinized land. Several properties of Populus spp. under salt stress were reviewed, including the botanical features, physiological and biochemical indexes, and molecular response; furthermore, the molecular mechanism and genetic improvement strategies for poplar salt-tolerance were outlined and discussed, so as to provide reference for screening and developing Populus spp. variety with slat tolerance.

  19. Seed development in Phaseolus vulgaris L., Populus nigra L., and Ranunculus sceleratus L. with special reference to the microtubular cytoskeleton

    NARCIS (Netherlands)

    XuHan, X.

    1995-01-01

    In this thesis, seed development is investigated in celery-leafed buttercup ( Ranunculus sceleratus L.), bean ( Phaseolus vulgaris L.) and poplar ( Populus nigra L.). Developing embryos, endosperms and seed coats are investigate

  20. 不同生长势美洲黑杨转录组差异分析%Analysis of Transcriptome Differences among Populus deltoides with Different Growth Potentials

    Institute of Scientific and Technical Information of China (English)

    丁昌俊; 张伟溪; 高暝; 黄秦军; 褚延广; 苏晓华

    2016-01-01

    及外来物质的降解和代谢途径。【结论】杂种优势的形成,可能是由于相关基因的显著差异表达,调控光合作用、物质代谢吸收等与生长紧密联系的代谢活动,进而促进生长优势的产生。%[Objective]The study was intended to study the gene expression profile of F1 hybrids of Populus deltoides to reveal the mechanism of hybrid vigor at the gene expression level. [Method]We sequenced the transcriptomes of three super-parent hybrids F1 ( H1 ,H2 ,H3 ) ,two low-parent hybrids ( L1 ,L2 ) ,and their parents ( Q1 ,Q2 ) using high throughput sequencing. [Result]We obtained a total of 171 154 127 reads,with an average length of 200 bp and a total of 31. 32 Gb size. After filtering,we aligned the clean reads to the reference genome of Populus trichocarpa and 61. 89%of the clean reads could be aligned to the reference genome. The comparison between super-parent hybrids F1 and parents ( H Vs Q) revealed that 342 genes were differently expressed (87 up-regulated and 255 down-regulated) . We termed the different expressed gene as DEG thereafter. Meanwhile,577 DEGs ( 146 up-regulated and 431 down-regulated ) were identified by comparing low-parent hybrids F1 with parents(L Vs Q),and 486 DEGs (200 up-regulated and 286 down-regulated) were identified by comparison of low-parent hybrids F1 and super-parent hybrid F1(H Vs L). 377 genes that were highly related to the hybrid vigor were identified,of which 4 genes down-regulated expressed in H Vs Q,L Vs Q and H Vs L,72 genes down-regulated expressed both in H Vs Q and L Vs Q,129 genes differentially expressed ( 19 up-regulated and 110 down-regulated) both in H Vs Q and H Vs L,170 genes differentially expressed both in L Vs Q and H Vs L. The functional analysis and pathway analysis demonstrated that there were 167,233 and 288 DGEs could be categorized into 46,45 and 51 functional groups,respectively. In the three main categories ( cellular component, molecular function

  1. Adaptive genetic variation mediates bottom-up and top-down control in an aquatic ecosystem

    Science.gov (United States)

    Rudman, Seth M.; Rodriguez-Cabal, Mariano A.; Stier, Adrian; Sato, Takuya; Heavyside, Julian; El-Sabaawi, Rana W.; Crutsinger, Gregory M.

    2015-01-01

    Research in eco-evolutionary dynamics and community genetics has demonstrated that variation within a species can have strong impacts on associated communities and ecosystem processes. Yet, these studies have centred around individual focal species and at single trophic levels, ignoring the role of phenotypic variation in multiple taxa within an ecosystem. Given the ubiquitous nature of local adaptation, and thus intraspecific variation, we sought to understand how combinations of intraspecific variation in multiple species within an ecosystem impacts its ecology. Using two species that co-occur and demonstrate adaptation to their natal environments, black cottonwood (Populus trichocarpa) and three-spined stickleback (Gasterosteus aculeatus), we investigated the effects of intraspecific phenotypic variation on both top-down and bottom-up forces using a large-scale aquatic mesocosm experiment. Black cottonwood genotypes exhibit genetic variation in their productivity and consequently their leaf litter subsidies to the aquatic system, which mediates the strength of top-down effects from stickleback on prey abundances. Abundances of four common invertebrate prey species and available phosphorous, the most critically limiting nutrient in freshwater systems, are dictated by the interaction between genetic variation in cottonwood productivity and stickleback morphology. These interactive effects fit with ecological theory on the relationship between productivity and top-down control and are comparable in strength to the effects of predator addition. Our results illustrate that intraspecific variation, which can evolve rapidly, is an under-appreciated driver of community structure and ecosystem function, demonstrating that a multi-trophic perspective is essential to understanding the role of evolution in structuring ecological patterns. PMID:26203004

  2. Interrelationships between leaf heat conductivity and tissue structures of different varieties of Populus tomentosa Carr.

    Institute of Scientific and Technical Information of China (English)

    WANG Min; ZHANG Wen-jie; XIAO Jian; ZHANG Zhi-yi; LIU Jing

    2008-01-01

    Plant heat conductivity largely depends on tissue structure. Different structures lead to different heat conductivity. As well, water transfer also plays a very important role in heat transfer in plants. We have studied leaf heat conductivity and tissue structure of 3- and 30-year-old Populus tomentosa Carr. trees using mildred thermal imaging, steady state heat conductivity surveys and paraffin section and investigated the relationship between leaf heat conductivity, tissue structure and water content of leaves. The results show that the temperature on leaf surfaces among the various varieties of trees was almost the same. Leaf heat conductivity, temperature and water content of leaves are positively correlated. The thicker the leaf tissue structures, the larger the heat resistance. That is, the tighter the cells and the smaller the interspaces, the smaller the heat conductivity, which is not conducive for heat transfer.

  3. Significance of stigma receptivity in intergeneric cross-pollination of Salix × Populus

    Directory of Open Access Journals (Sweden)

    Elżbieta Zenkteler

    2016-09-01

    Full Text Available The pollen–stigma interaction plays an important role in reproductive process and has been continuously studied in many interspecific and intergeneric crossing experiments. The aim of this study was to investigate stigma receptivity (SR of willow in order to determine the most suitable period for its pollination with poplar pollen and improve the effectiveness of Salix × Populus crosses. Tissue samples were examined histologically using light, epifluorescent, scanning, and transmission electron microscopy. Willow SR was determined by stigma morphological traits, test of pollen germination rate, Peroxtesmo test of peroxidase and esterase activity on stigma surface as well as papilla ultrastructure at anthesis. We have ascertained that the SR duration in willow is short, lasting from 1 to 2 DA. The poplar pollen germination rate on willow stigmas on 1 DA ranged from 26.3 to 11.2%.

  4. Conversion of water consumption of a single tree and a forest stand of Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xiao-you; MENG Tong-tong; KANG Er-si

    2008-01-01

    Our study dear with the determination of sapwood sap flow of a single Populus euphratica tree by heat pulse technique and the calculation of water consumption of an entire forest stand, given the correlation between sap flow and sapwood area of P. euphratica. The relation between diameter at breast height (DBH) and sapwood area constitutes a powerful model; these variables are highly correlated. By means of an analysis of DBH in the sample plot, the distribution of the sapwood area of the forest land was obtained and the water consumption of this P. euphratica forest, in the lower reaches of the Heihe River, calculated as 214.9 mm by standard specific conductivity of the sample tree.

  5. [Spatial structural characteristics of natural Populus davidiana - Betula platyphylla secondary forest].

    Science.gov (United States)

    Shao, Fang-Li; Yu, Xin-Xiao; Song, Si-Ming; Zhao, Yang

    2011-11-01

    This paper analyzed the spatial structural characteristics of natural Populus davidiana - Betula platyphylla secondary forest in a 4 hm2 plot of Mulan Paddock, based on the diameter distribution and the spatial structure parameters mingling degree, neighborhood comparison, and angle index. In the forest, the diameter distribution of the stands presented as an inverse 'J' curve, the average mingling degree was 0.4, with the individuals at weak and zero mingling degree reached 51.6%, and the average mingling degree of P. davidiana and B. platyphylla was 0.25 and 0.39, respectively. The neighborhood comparison based on the diameter at breast height (DBH) and tree height was almost the same, suggesting that the P. davidiana and B. platyphylla were in the transition state from subdominant to middle. The horizontal distribution pattern had a close relation to the minimum measured DBH, being clustered when the DBH was > or = 1 cm and or = 6 cm.

  6. Scale dependence of disease impacts on quaking aspen (Populus tremuloides) mortality in the southwestern United States

    Science.gov (United States)

    Bell, David M.; Bradford, John B.; Lauenroth, William K.

    2015-01-01

    Depending on how disease impacts tree exposure to risk, both the prevalence of disease and disease effects on survival may contribute to patterns of mortality risk across a species' range. Disease may accelerate tree species' declines in response to global change factors, such as drought, biotic interactions, such as competition, or functional traits, such as allometry. To assess the role of disease in mediating mortality risk in quaking aspen (Populus tremuloides), we developed hierarchical Bayesian models for both disease prevalence in live aspen stems and the resulting survival rates of healthy and diseased aspen near the species' southern range limit using 5088 individual trees on 281 United States Forest Service Forest Inventory and Analysis plots in the southwestern United States.

  7. TCF Bleaching of Populus tomentosa Kraft Pulps with H2O2 Pretreatment under Acid Condition

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The process of peroxide bleaching of Populus tomentosa kraft pulp with H2O2 pretreatment under acid condition was studied. The variations of pulp characteristics such as brightness, Kappa number and viscosity during the peroxide bleaching process were discussed and the concept of the A/B value was presented for the first time. The results show that acid pretreatment with H2O2 is essential to improve pulp brightness and avoid viscosity loss. The conclusion is reached that the A/B value has great influence on pulp properties when the total amount of peroxide used in the bleaching process is 2%-5%. Pulp with a high viscosity and brightness can be obtained when A/B is about 0.15.

  8. Impact du stress hydrique sur le fonctionnement hydraulique foliaire du peuplier Populus tremula x alba

    OpenAIRE

    Daaboul, Philippe

    2015-01-01

    Afin d’aborder l’impact du stress hydrique sur le fonctionnement hydraulique foliaire, des plants de Populus tremula x alba ont été soumis à un stress hydrique modéré ou sévère pendant une semaine par ajout de PEG dans la solution nutritive. La mesure de paramètres écophysiologiques et moléculaires tissus spécifiques a permis de dégager plusieurs tendances sur la caractérisation de l’influence du stress. Les deux types de stress n’ont que peu d’impact sur la croissance et la capacité de synth...

  9. The use of the white poplar (Populus alba L.) biomass as fuel

    Institute of Scientific and Technical Information of China (English)

    Tatiana Griu; Aurel Lunguleasa

    2016-01-01

    We determined the calorific value of white poplar (Populus alba L.) woody biomass to use it as fire-wood. The value of 19.133 MJ kg-1 obtained experimen-tally shows that the white poplar can be quite successfully used as firewood. Being of a lower quality in comparison with usual beech firewood, the white poplar has similar calorific value. The white poplar has a calorific density of 30.7%lower than that of current firewood. That is why the price of this firewood from white poplar is lower accord-ingly. Also, the prognosis of calorific value on the basis of the main chemical elements, being very close to the experimental value (?2.6%), indicates an appropriate value can be achieved to be used for investigation with the chemical element analysis.

  10. Feeding performance of Clostera fulgurita on three clones of Populus deltoides

    Institute of Scientific and Technical Information of China (English)

    K.S.Sangha

    2011-01-01

    Poplar leaf defoliator, Closterafulgurita (Walker) larvae were reared on three Populus deltoides clones (PLI, PL5 and PL7) in the laboratory. The nutritional indices were computed for working out the relationship between food consumption and growth rate of 3rd, 4th and 5th instar larvae on three clones. The result showed that the consumption index (CI), approximate digestibility (AD), growth rate (GR), relative growth rate (RGR) and efficiency of conversion of ingested food (ECl)decreased with the increase in the age of the larvae. Efficiency of conversion of digested food (ECD) increased with increase in age of the larvae. GR and RGR varied significantly, indicating that larval development was enhanced on PLI as compared to PL5 & PL7. The values of AD, ECl and ECD were not affected by the different clones. Feeding and growth indices could be useful to define a defoliation prediction model.

  11. Structural Characteristics and Eco-adaptability of Heteromorphic Leaves of Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    Li Zhao-xia; Zheng Cai-xia

    2005-01-01

    The microstructural and ultrastructural traits of three kinds of typical leaves of Populus euphratica Olive, including lanceolate, broad-ovate and dentate broad-ovate leaves, were studied by using electron microscope and optical microscope. The results showed that with the leaves changing from lanceolate shape to dentate broad-ovate shape, their structure obviously tended to be xeromorph: developed palisade tissue, undeveloped spongy tissue, thick cutin layer and sunken stomas. The amount of mitochondria tended to be increased, and the shape of chloroplasts varied from regular spindle to irregular rotundity or oval. The leaves were covered with wax without cilium, and the stomas on the upper and lower epidermis of the leaves opened unevenly. The stomas on the lower epidermis were deeper than those on the upper epidermis under the scanning electron microscope. The results implied that the structural characteristics of the diversiform-leaves of P. euphratica are related to its eco-adaptability.

  12. Stomata morphological traits in two different genotypes of Populus nigra L.

    Directory of Open Access Journals (Sweden)

    Russo G

    2015-08-01

    Full Text Available Populus nigra L. (black poplar possesses amphistomatic leaves, with large (giant and normal sized stomata. The role of giant stomata in leaf development, and the consequences on stomatal density in adult leaves remains elusive. This paper describes the characteristics of ordinary and giant stomata in leaves of two black poplar genotypes (58-861 with large leaves from northern Italy, and Poli with small leaves from southern Italy. Stomatal traits in both genotypes were studied using light microscopy on mature leaf adaxial and abaxial epidermal impressions. Moreover, scanning electron microscopy was applied to study giant and normal stomata in early, young, and mature leaves. Leaf abaxial surfaces in the two genotypes revealed variable sizes and patterns of stomata related to differences in intrinsic water use efficiency (Wi. These observations provided evidence of different stomatal types in mature black poplar leaves, and new information regarding the presence and potential role of giant stomata in black poplar leaves.

  13. Model of leaf energy distribution and its experimental validation of Populus tomentosa Carr

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wen-jie; WANG Min; SHEN Ying-bai; ZHANG Zhi-yi

    2008-01-01

    Leaf temperature of a plant is the result of heat transfer between the plant and its environment. There are many factors that can affect leaf temperature, such as the solar radiation energy, environmental temperature, wind velocity, evaporation on the leaf surface, photosynthesis, respiration and so on, which have different effects on the temperature of leaves. In first instance, we analyzed the heat transfer on leaves of Populus tomentosa Cart. theoretically and constructed a model of energy distribution. We then validated the model by analyzing seven different kinds of one-year-old P. tomentosa leaves experimentally. The result shows that solar radiation is the main energy input and the dominant ways of thermal diffusion are heat transfer between the upper and lower leaf surfaces and evaporation from the leaf surface.

  14. [Cloning and structure analysis of zinc finger protein gene in Populus euphratica Oliv].

    Science.gov (United States)

    Wang, Jun-Ying; Yin, Wei-Lun; Xia, Xin-Li

    2005-03-01

    Zinc finger proteins belong to a family of nuclear transcription factors which function is to regulate gene expression in both prokaryotic and eukaryotic cells. A pair of primers was designed after analyzing the conservation of salt-tolerant zinc protein Alfin-1 in such diverse plants as alfalfa and Arabidopsis. The zinc finger protein gene is isolated from total RNA with RT-PCR in aquaculture leaves of Populus euphratica . Its full cDNA length is 924bp. Analysis of its amino acid sequence showed it has a typical Cys(2)/His(2) zinc finger structure and a G-rich promoter binding site GTGGGG, starting from position 556. Since transcrptional factors which have the same function show conservation in structure and amino acid sequence of DNA binding region, the structure analysis in this paper indicates the cloned zinc finger protein gene may have functional correlation to Alfin-1.

  15. Genotypic variation in a foundation tree (Populus tremula L.) explains community structure of associated epiphytes.

    Science.gov (United States)

    Davies, Chantel; Ellis, Christopher J; Iason, Glenn R; Ennos, Richard A

    2014-01-01

    Community genetics hypothesizes that within a foundation species, the genotype of an individual significantly influences the assemblage of dependent organisms. To assess whether these intra-specific genetic effects are ecologically important, it is required to compare their impact on dependent organisms with that attributable to environmental variation experienced over relevant spatial scales. We assessed bark epiphytes on 27 aspen (Populus tremula L.) genotypes grown in a randomized experimental array at two contrasting sites spanning the environmental conditions from which the aspen genotypes were collected. We found that variation in aspen genotype significantly influenced bark epiphyte community composition, and to the same degree as environmental variation between the test sites. We conclude that maintaining genotypic diversity of foundation species may be crucial for conservation of associated biodiversity.

  16. In-situ reduced silver nanoparticles on populus fiber and the catalytic application

    Science.gov (United States)

    Li, Miaomiao; Gong, Yumei; Wang, Wenheng; Xu, Guangpeng; Liu, Yuanfa; Guo, Jing

    2017-02-01

    One kind of composites involved in silver nanoparticles (AgNPs) loading in-situ on natural populus fiber (PF) matrix was prepared by polyamidoxime (PAO) functionalized the cellulose fiber. In which PAO worked as trapping and stabilizing agents chelating silver ions and made it reduced in-situ to obtain AgNPs by borohydride at room temperature. The synthesized composites were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), thermogravimetric analysis (TGA) and scanning electron microscopy (SEM). Moreover, the composites showed significant catalytic activity 1.87 s-1 g-1 and repeated usability more than 7 cycles in reducing 4-nitrophenol (4-NP) into 4-aminophenol (4-AP) detected by UV-vis spectrophotometer in aqueous solution due to the surface-enhanced immobility and large amount of AgNPs. The natural cellulose fiber provides a green platform to react and support other noble metals for wide catalytic reactions.

  17. Early events in Populus hybrid and Fagus sylvatica leaves exposed to ozone.

    Science.gov (United States)

    Desotgiu, R; Bussotti, F; Faoro, F; Iriti, M; Agati, G; Marzuoli, R; Gerosa, G; Tani, C

    2010-04-01

    This paper aims to investigate early responses to ozone in leaves of Fagus sylvatica (beech) and Populus maximowiczii x Populus berolinensis (poplar). The experimental setup consisted of four open-air (OA) plots, four charcoal-filtered (CF) open-top chambers (OTCs), and four nonfiltered (NF) OTCs. Qualitative and quantitative analyses were carried out on nonsymptomatic (CF) and symptomatic (NF and OA) leaves of both species. Qualitative analyses were performed applying microscopic techniques: Evans blue staining for detection of cell viability, CeCl3 staining of transmission electron microscope (TEM) samples to detect the accumulation of H2O2, and multispectral fluorescence microimaging and microspectrofluorometry to investigate the accumulation of fluorescent phenolic compounds in the walls of the damaged cells. Quantitative analyses consisted of the analysis of the chlorophyll a fluorescence transients (fast kinetics). The early responses to ozone were demonstrated by the Evans blue and CeCl3 staining techniques that provided evidence of plant responses in both species 1 month before foliar symptoms became visible. The fluorescence transients analysis, too, demonstrated the breakdown of the oxygen evolving system and the inactivation of the end receptors of electrons at a very early stage, both in poplar and in beech. The accumulation of phenolic compounds in the cell walls, on the other hand, was a species-specific response detected in poplar, but not in beech. Evans blue and CeCl3 staining, as well as the multispectral fluorescence microimaging and microspectrofluorometry, can be used to support the field diagnosis of ozone injury, whereas the fast kinetics of chlorophyll fluorescence provides evidence of early physiological responses.

  18. Recovery of Populus tremuloides seedlings following severe drought causing total leaf mortality and extreme stem embolism.

    Science.gov (United States)

    Lu, Yanyuan; Equiza, Maria Alejandra; Deng, Xiping; Tyree, Melvin T

    2010-11-01

    In contrast with other native Populus species in North America, Populus tremuloides (aspen) can successfully establish itself in drought-prone areas, yet no comprehensive analysis has been performed on the ability of seedlings to withstand and recover from a severe drought resulting in complete leaf mortality. Here, we subjected 4-month-old aspen seedlings grown in two contrasting soil media to a progressive drought until total leaf mortality, followed by a rewatering cycle. Stomatal conductance (g(s) ), photosynthesis and transpiration followed a sigmoid decline with declining fraction of extractable soil water values. Cessation of leaf expansion occurred close to the end of the linear-decrease phase, when g(s) was reduced by 95%. Leaf mortality started after g(s) reached the lowest values, which corresponded to a stem-xylem pressure potential (Ψ(xp)) of -2.0 MPa and a percent loss of stem hydraulic conductivity (PLC) of 50%. In plants with 50% leaf mortality, PLC values remained around 50%. Complete leaf mortality occurred at an average stem PLC of 90%, but all seedlings were able to resprout after 6-10 days of being rewatered. Plants decapitated at soil level before rewatering developed root suckers, while those left with a 4-cm stump or with their stems intact resprouted exclusively from axillary buds. Resprouting was accompanied by recovery of stem hydraulic conductivity, with PLC values around 30%. The percentage of resprouted buds was negatively correlated with the stem %PLC. Thus, the recovery of stem hydraulic conductivity appears as an important factor in the resprouting capacity of aspen seedlings following a severe drought. Copyright © Physiologia Plantarum 2010.

  19. Genome-wide transcriptional profiling reveals molecular signatures of secondary xylem differentiation in Populus tomentosa.

    Science.gov (United States)

    Yang, X H; Li, X G; Li, B L; Zhang, D Q

    2014-11-11

    Wood formation occurs via cell division, primary cell wall and secondary wall formation, and programmed cell death in the vascular cambium. Transcriptional profiling of secondary xylem differentiation is essential for understanding the molecular mechanisms underlying wood formation. Differential gene expression in secondary xylem differentiation of Populus has been previously investigated using cDNA microarray analysis. However, little is known about the molecular mechanisms from a genome-wide perspective. In this study, the Affymetrix poplar genome chips containing 61,413 probes were used to investigate the changes in the transcriptome during secondary xylem differentiation in Chinese white poplar (Populus tomentosa). Two xylem tissues (newly formed and lignified) were sampled for genome-wide transcriptional profiling. In total, 6843 genes (~11%) were identified with differential expression in the two xylem tissues. Many genes involved in cell division, primary wall modification, and cellulose synthesis were preferentially expressed in the newly formed xylem. In contrast, many genes, including 4-coumarate:cinnamate-4-hydroxylase (C4H), 4-coumarate:CoA ligase (4CL), cinnamyl alcohol dehydrogenase (CAD), and caffeoyl CoA 3-O-methyltransferase (CCoAOMT), associated with lignin biosynthesis were more transcribed in the lignified xylem. The two xylem tissues also showed differential expression of genes related to various hormones; thus, the secondary xylem differentiation could be regulated by hormone signaling. Furthermore, many transcription factor genes were preferentially expressed in the lignified xylem, suggesting that wood lignification involves extensive transcription regulation. The genome-wide transcriptional profiling of secondary xylem differentiation could provide additional insights into the molecular basis of wood formation in poplar species.

  20. DNA damage in Populus tremuloides clones exposed to elevated O{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Tai, Helen H., E-mail: helen.tai@agr.gc.c [Agriculture and Agri-Food Canada, Potato Research Centre, P.O. Box 20280, Fredericton, New Brunswick, E3B 4Z7 (Canada); Natural Resources Canada, Canadian Forest Service - Atlantic Forestry Centre, 1350 Regent Street S., Fredericton, New Brunswick, E3B 5P7 (Canada); Percy, Kevin E. [Natural Resources Canada, Canadian Forest Service - Atlantic Forestry Centre, 1350 Regent Street S., Fredericton, New Brunswick, E3B 5P7 (Canada); Karnosky, David F. [School of Forest Resources and Environmental Science, Michigan Technological University, Houghton, MI 49931 (United States)

    2010-04-15

    The effects of elevated concentrations of atmospheric tropospheric ozone (O{sub 3}) on DNA damage in five trembling aspen (Populus tremuloides Michx.) clones growing in a free-air enrichment experiment in the presence and absence of elevated concentrations of carbon dioxide (CO{sub 2}) were examined. Growing season mean hourly O{sub 3} concentrations were 36.3 and 47.3 ppb for ambient and elevated O{sub 3} plots, respectively. The 4th highest daily maximum 8-h ambient and elevated O{sub 3} concentrations were 79 and 89 ppb, respectively. Elevated CO{sub 2} averaged 524 ppm (+150 ppm) over the growing season. Exposure to O{sub 3} and CO{sub 2} in combination with O{sub 3} increased DNA damage levels above background as measured by the comet assay. Ozone-tolerant clones 271 and 8L showed the highest levels of DNA damage under elevated O{sub 3} compared with ambient air; whereas less tolerant clone 216 and sensitive clones 42E and 259 had comparably lower levels of DNA damage with no significant differences between elevated O{sub 3} and ambient air. Clone 8L was demonstrated to have the highest level of excision DNA repair. In addition, clone 271 had the highest level of oxidative damage as measured by lipid peroxidation. The results suggest that variation in cellular responses to DNA damage between aspen clones may contribute to O{sub 3} tolerance or sensitivity. - Ozone tolerant clones and sensitive Populus tremuloides clones show differences in DNA damage and repair.

  1. Early Events in Populus Hybrid and Fagus sylvatica Leaves Exposed to Ozone

    Directory of Open Access Journals (Sweden)

    R. Desotgiu

    2010-01-01

    Full Text Available This paper aims to investigate early responses to ozone in leaves of Fagus sylvatica (beech and Populus maximowiczii x Populus berolinensis (poplar. The experimental setup consisted of four open-air (OA plots, four charcoal-filtered (CF open-top chambers (OTCs, and four nonfiltered (NF OTCs. Qualitative and quantitative analyses were carried out on nonsymptomatic (CF and symptomatic (NF and OA leaves of both species. Qualitative analyses were performed applying microscopic techniques: Evans blue staining for detection of cell viability, CeCl3 staining of transmission electron microscope (TEM samples to detect the accumulation of H2O2, and multispectral fluorescence microimaging and microspectrofluorometry to investigate the accumulation of fluorescent phenolic compounds in the walls of the damaged cells. Quantitative analyses consisted of the analysis of the chlorophyll a fluorescence transients (fast kinetics. The early responses to ozone were demonstrated by the Evans blue and CeCl3 staining techniques that provided evidence of plant responses in both species 1 month before foliar symptoms became visible. The fluorescence transients analysis, too, demonstrated the breakdown of the oxygen evolving system and the inactivation of the end receptors of electrons at a very early stage, both in poplar and in beech. The accumulation of phenolic compounds in the cell walls, on the other hand, was a species-specific response detected in poplar, but not in beech. Evans blue and CeCl3 staining, as well as the multispectral fluorescence microimaging and microspectrofluorometry, can be used to support the field diagnosis of ozone injury, whereas the fast kinetics of chlorophyll fluorescence provides evidence of early physiological responses.

  2. Trade-offs between xylem hydraulic properties, wood anatomy and yield in Populus.

    Science.gov (United States)

    Hajek, Peter; Leuschner, Christoph; Hertel, Dietrich; Delzon, Sylvain; Schuldt, Bernhard

    2014-07-01

    Trees face the dilemma that achieving high plant productivity is accompanied by a risk of drought-induced hydraulic failure due to a trade-off in the trees' vascular system between hydraulic efficiency and safety. By investigating the xylem anatomy of branches and coarse roots, and measuring branch axial hydraulic conductivity and vulnerability to cavitation in 4-year-old field-grown aspen plants of five demes (Populus tremula L. and Populus tremuloides Michx.) differing in growth rate, we tested the hypotheses that (i) demes differ in wood anatomical and hydraulic properties, (ii) hydraulic efficiency and safety are related to xylem anatomical traits, and (iii) aboveground productivity and hydraulic efficiency are negatively correlated to cavitation resistance. Significant deme differences existed in seven of the nine investigated branch-related anatomical and hydraulic traits but only in one of the four coarse-root-related anatomical traits; this likely is a consequence of high intra-plant variation in root morphology and the occurrence of a few 'high-conductivity roots'. Growth rate was positively related to branch hydraulic efficiency (xylem-specific conductivity) but not to cavitation resistance; this indicates that no marked trade-off exists between cavitation resistance and growth. Both branch hydraulic safety and hydraulic efficiency significantly depended on vessel size and were related to the genetic distance between the demes, while the xylem pressure causing 88% loss of hydraulic conductivity (P88 value) was more closely related to hydraulic efficiency than the commonly used P50 value. Deme-specific variation in the pit membrane structure may explain why vessel size was not directly linked to growth rate. We conclude that branch hydraulic efficiency is an important growth-influencing trait in aspen, while the assumed trade-off between productivity and hydraulic safety is weak.

  3. Distinct microbial communities within the endosphere and rhizosphere of Populus deltoides roots across contrasting soil types.

    Science.gov (United States)

    Gottel, Neil R; Castro, Hector F; Kerley, Marilyn; Yang, Zamin; Pelletier, Dale A; Podar, Mircea; Karpinets, Tatiana; Uberbacher, Ed; Tuskan, Gerald A; Vilgalys, Rytas; Doktycz, Mitchel J; Schadt, Christopher W

    2011-09-01

    The root-rhizosphere interface of Populus is the nexus of a variety of associations between bacteria, fungi, and the host plant and an ideal model for studying interactions between plants and microorganisms. However, such studies have generally been confined to greenhouse and plantation systems. Here we analyze microbial communities from the root endophytic and rhizospheric habitats of Populus deltoides in mature natural trees from both upland and bottomland sites in central Tennessee. Community profiling utilized 454 pyrosequencing with separate primers targeting the V4 region for bacterial 16S rRNA and the D1/D2 region for fungal 28S rRNA genes. Rhizosphere bacteria were dominated by Acidobacteria (31%) and Alphaproteobacteria (30%), whereas most endophytes were from the Gammaproteobacteria (54%) as well as Alphaproteobacteria (23%). A single Pseudomonas-like operational taxonomic unit (OTU) accounted for 34% of endophytic bacterial sequences. Endophytic bacterial richness was also highly variable and 10-fold lower than in rhizosphere samples originating from the same roots. Fungal rhizosphere and endophyte samples had approximately equal amounts of the Pezizomycotina (40%), while the Agaricomycotina were more abundant in the rhizosphere (34%) than endosphere (17%). Both fungal and bacterial rhizosphere samples were highly clustered compared to the more variable endophyte samples in a UniFrac principal coordinates analysis, regardless of upland or bottomland site origin. Hierarchical clustering of OTU relative abundance patterns also showed that the most abundant bacterial and fungal OTUs tended to be dominant in either the endophyte or rhizosphere samples but not both. Together, these findings demonstrate that root endophytic communities are distinct assemblages rather than opportunistic subsets of the rhizosphere.

  4. Distinct Microbial Communities within the Endosphere and Rhizosphere of Populus deltoides Roots across Contrasting Soil Types.

    Energy Technology Data Exchange (ETDEWEB)

    Gottel, Neil R [ORNL; Castro Gonzalez, Hector F [ORNL; Kerley, Marilyn K [ORNL; Yang, Zamin [ORNL; Pelletier, Dale A [ORNL; Podar, Mircea [ORNL; Karpinets, Tatiana V [ORNL; Uberbacher, Edward C [ORNL; Tuskan, Gerald A [ORNL; Vilgalys, Rytas [Duke University; Doktycz, Mitchel John [ORNL; Schadt, Christopher Warren [ORNL

    2011-01-01

    The root-rhizosphere interface of Populus is the nexus of a variety of associations between bacteria, fungi, and the host plant and an ideal model for studying interactions between plants and microorganisms. However, such studies have generally been confined to greenhouse and plantation systems. Here we analyze microbial communities from the root endophytic and rhizospheric habitats of Populus deltoides in mature natural trees from both upland and bottomland sites in central Tennessee. Community profiling utilized 454 pyrosequencing with separate primers targeting the V4 region for bacterial 16S rRNA and the D1/D2 region for fungal 28S rRNA genes. Rhizosphere bacteria were dominated by Acidobacteria (31%) and Alphaproteobacteria (30%), whereas most endophytes were from the Gammaproteobacteria (54%) as well as Alphaproteobacteria (23%). A single Pseudomonas-like operational taxonomic unit (OTU) accounted for 34% of endophytic bacterial sequences. Endophytic bacterial richness was also highly variable and 10-fold lower than in rhizosphere samples originating from the same roots. Fungal rhizosphere and endophyte samples had approximately equal amounts of the Pezizomycotina (40%), while the Agaricomycotina were more abundant in the rhizosphere (34%) than endosphere (17%). Both fungal and bacterial rhizosphere samples were highly clustered compared to the more variable endophyte samples in a UniFrac principal coordinates analysis, regardless of upland or bottomland site origin. Hierarchical clustering of OTU relative abundance patterns also showed that the most abundant bacterial and fungal OTUs tended to be dominant in either the endophyte or rhizosphere samples but not both. Together, these findings demonstrate that root endophytic communities are distinct assemblages rather than opportunistic subsets of the rhizosphere.

  5. Response of the accumulation of proline in the bodies of Populus euphratica to the change of groundwater level at the lower reaches of Tarim River

    Institute of Scientific and Technical Information of China (English)

    CHEN Yaning; CHEN Yapeng; LI Weihong; ZHANG Hongfeng

    2003-01-01

    The content of proline in the plant bodies is closely related to the converse-succession-resistant capability of the plants. In this paper, the relationship between the proline accumulation in the bodies of Populus euphratica and the change of groundwater level is analyzed by taking Populus euphratica, the main community-building species of the desert riparian forests along the Tarim River, as the research object. The research results show that the accumulation of proline in the bodies of Populus euphratica is closely related to the change of groundwater level gradient under drought stress, it increases with the drawdown of groundwater level and the increase of moisture stress degree; the accumulation of proline in the bodies of Populus euphratica has two extremely high points at the groundwater depth ranges of 3.64-5.14 m and 9.46-10.16 m. Combining the field investigation and the analysis of the plots, it is considered that the groundwater level of 3.5-4.5 m is rational for the growth of Populus euphratica. The stress groundwater depth for the normal growth and the critical one for the survival of Populus euphratica are below 4.5 m and 9-10 m respectively at the lower reaches of the Tarim River.

  6. Pseudomonas aeruginosa Biofilm Formation and Persistence, along with the Production of Quorum Sensing-Dependent Virulence Factors, Are Disrupted by a Triterpenoid Coumarate Ester Isolated from Dalbergia trichocarpa, a Tropical Legume

    Science.gov (United States)

    Pottier, Laurent; Huet, Joelle; Rabemanantsoa, Christian; Kiendrebeogo, Martin; Andriantsimahavandy, Abel; Rasamindrakotroka, Andry; Stévigny, Caroline; Duez, Pierre; El Jaziri, Mondher

    2015-01-01

    Recently, extracts of Dalbergia trichocarpa bark have been shown to disrupt P. aeruginosa PAO1 quorum sensing (QS) mechanisms, which are key regulators of virulence factor expression and implicated in biofilm formation. One of the active compounds has been isolated and identified as oleanolic aldehyde coumarate (OALC), a novel bioactive compound that inhibits the formation of P. aeruginosa PAO1 biofilm and its maintenance as well as the expression of the las and rhl QS systems. Consequently, the production of QS-controlled virulence factors including, rhamnolipids, pyocyanin, elastase and extracellular polysaccharides as well as twitching and swarming motilities is reduced. Native acylhomoserine lactones (AHLs) production is inhibited by OALC but exogenous supply of AHLs does not restore the production of virulence factors by OALC-treated cultures, indicating that OALC exerts its effect beyond AHLs synthesis in the QS pathways. Further experiments provided a significant inhibition of the global virulence factor activator gacA by OALC. OALC disorganizes established biofilm structure and improves the bactericidal activity of tobramycin against biofilm-encapsulated PAO1 cells. Finally, a significant reduction of Caenorhabditis elegans paralysis was recorded when the worms were infected with OALC-pre-treated P. aeruginosa. Taken together, these results show that triterpenoid coumarate esters are suitable chemical backbones to target P. aeruginosa virulence mechanisms. PMID:26186595

  7. Protein (Viridiplantae): 7789 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3646:3627 3688:10495 ... 238069:10495 ... 3689:10495 ... 3694:10495 ... hypothetical protein POPTR_0015s11720g Populus trichocarpa MEGGNGNEV...EREEDDSVSDILQDRFRLSAISIAENEAKKNGVEISEPITSCIADLALNYTEQLAK

  8. Evaluation of the sap flow using heat pulse method to determine transpiration of the Populus euphratica canopy

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xiaoyou; KANG Ersi; ZHOU Maoxian

    2007-01-01

    The sap flow of the sampled Populus euphratica stems at different radial depths and directions had been studied in Ejina Oasis,in the lower reaches of the Heihe River.Based on sap flow measurements,the transpiration of the entire canopy was calculated.Results showed a linear correlation between the sap flow and the sapwood area of the P.euphratica.Through the analysis of the diameter at breast height in the sample plot,it was found that the distribution of the diameters and the corresponding sapwood area was exponentially correlated,with the coefficient of correlation being 0.976,7.The calculated transpiration of the Populus euphratica canopy was 214.9 mm based on the specific conductivity method.

  9. Integration of Palmer Drought Severity Index and remote sensing data to simulate wetland water surface from 1910 to 2009 in Cottonwood Lake area, North Dakota

    Science.gov (United States)

    Huang, S.; Dahal, D.; Young, Caitlin; Chander, G.; Liu, S.

    2011-01-01

    Spatiotemporal variations of wetland water in the Prairie Pothole Region are controlled by many factors; two of them are temperature and precipitation that form the basis of the Palmer Drought Severity Index (PDSI). Taking the 196km2 Cottonwood Lake area in North Dakota as our pilot study site, we integrated PDSI, Landsat images, and aerial photography records to simulate monthly water surface. First, we developed a new Wetland Water Area Index (WWAI) from PDSI to predict water surface area. Second, we developed a water allocation model to simulate the spatial distribution of water bodies at a resolution of 30m. Third, we used an additional procedure to model the small wetlands (less than 0.8ha) that could not be detected by Landsat. Our results showed that i) WWAI was highly correlated with water area with an R2 of 0.90, resulting in a simple regression prediction of monthly water area to capture the intra- and inter-annual water change from 1910 to 2009; ii) the spatial distribution of water bodies modeled from our approach agreed well with the water locations visually identified from the aerial photography records; and iii) the R2 between our modeled water bodies (including both large and small wetlands) and those from aerial photography records could be up to 0.83 with a mean average error of 0.64km2 within the study area where the modeled wetland water areas ranged from about 2 to 14km2. These results indicate that our approach holds great potential to simulate major changes in wetland water surface for ecosystem service; however, our products could capture neither the short-term water change caused by intensive rainstorm events nor the wetland change caused by human activities. ?? 2011.

  10. Transcriptional profiling by cDNA-AFLP analysis showed differential transcript abundance in response to water stress in Populus hopeiensis

    OpenAIRE

    Song, Yuepeng; Wang, Zeliang; Bo, Wenhao; Ren, Yuanyuan; Zhang, Zhiyi; Zhang, Deqiang

    2012-01-01

    Background Drought is one of the main environmental factors limiting tree growth and productivity of plantation forests worldwide. Populus hopeiensis Hu et Chow is one of the most important commercial plantation tree species in China. However, the genes controlling drought tolerance in this species have not been identified or characterized. Here, we conducted differential expression analyses and identified a number of genes that were up- or downregulated in P. hopeiensis during water stress. ...

  11. RNA sequencing of Populus x canadensis roots identifies key molecular mechanisms underlying physiological adaption to excess zinc.

    Science.gov (United States)

    Ariani, Andrea; Di Baccio, Daniela; Romeo, Stefania; Lombardi, Lara; Andreucci, Andrea; Lux, Alexander; Horner, David Stephen; Sebastiani, Luca

    2015-01-01

    Populus x canadensis clone I-214 exhibits a general indicator phenotype in response to excess Zn, and a higher metal uptake in roots than in shoots with a reduced translocation to aerial parts under hydroponic conditions. This physiological adaptation seems mainly regulated by roots, although the molecular mechanisms that underlie these processes are still poorly understood. Here, differential expression analysis using RNA-sequencing technology was used to identify the molecular mechanisms involved in the response to excess Zn in root. In order to maximize specificity of detection of differentially expressed (DE) genes, we consider the intersection of genes identified by three distinct statistical approaches (61 up- and 19 down-regulated) and validate them by RT-qPCR, yielding an agreement of 93% between the two experimental techniques. Gene Ontology (GO) terms related to oxidation-reduction processes, transport and cellular iron ion homeostasis were enriched among DE genes, highlighting the importance of metal homeostasis in adaptation to excess Zn by P. x canadensis clone I-214. We identified the up-regulation of two Populus metal transporters (ZIP2 and NRAMP1) probably involved in metal uptake, and the down-regulation of a NAS4 gene involved in metal translocation. We identified also four Fe-homeostasis transcription factors (two bHLH38 genes, FIT and BTS) that were differentially expressed, probably for reducing Zn-induced Fe-deficiency. In particular, we suggest that the down-regulation of FIT transcription factor could be a mechanism to cope with Zn-induced Fe-deficiency in Populus. These results provide insight into the molecular mechanisms involved in adaption to excess Zn in Populus spp., but could also constitute a starting point for the identification and characterization of molecular markers or biotechnological targets for possible improvement of phytoremediation performances of poplar trees.

  12. RNA sequencing of Populus x canadensis roots identifies key molecular mechanisms underlying physiological adaption to excess zinc.

    Directory of Open Access Journals (Sweden)

    Andrea Ariani

    Full Text Available Populus x canadensis clone I-214 exhibits a general indicator phenotype in response to excess Zn, and a higher metal uptake in roots than in shoots with a reduced translocation to aerial parts under hydroponic conditions. This physiological adaptation seems mainly regulated by roots, although the molecular mechanisms that underlie these processes are still poorly understood. Here, differential expression analysis using RNA-sequencing technology was used to identify the molecular mechanisms involved in the response to excess Zn in root. In order to maximize specificity of detection of differentially expressed (DE genes, we consider the intersection of genes identified by three distinct statistical approaches (61 up- and 19 down-regulated and validate them by RT-qPCR, yielding an agreement of 93% between the two experimental techniques. Gene Ontology (GO terms related to oxidation-reduction processes, transport and cellular iron ion homeostasis were enriched among DE genes, highlighting the importance of metal homeostasis in adaptation to excess Zn by P. x canadensis clone I-214. We identified the up-regulation of two Populus metal transporters (ZIP2 and NRAMP1 probably involved in metal uptake, and the down-regulation of a NAS4 gene involved in metal translocation. We identified also four Fe-homeostasis transcription factors (two bHLH38 genes, FIT and BTS that were differentially expressed, probably for reducing Zn-induced Fe-deficiency. In particular, we suggest that the down-regulation of FIT transcription factor could be a mechanism to cope with Zn-induced Fe-deficiency in Populus. These results provide insight into the molecular mechanisms involved in adaption to excess Zn in Populus spp., but could also constitute a starting point for the identification and characterization of molecular markers or biotechnological targets for possible improvement of phytoremediation performances of poplar trees.

  13. Thidiazuron: A potent cytokinin for efficient plant regeneration in Himalayan poplar (Populus ciliata Wall. using leaf explants

    Directory of Open Access Journals (Sweden)

    Gaurav Aggarwal

    2012-11-01

    Full Text Available Populus species are important resource for certain branches of industry and have special roles for scientific study on biological and agricultural systems. The present investigation was undertaken with an objective of enhancing the frequency of plant regeneration in Himalayan poplar (Populus ciliata Wall.. The effect of Thiadizuron (TDZ alone and in combination with adenine and α-Naphthalene acetic acid (NAA were studied on the regeneration potential of leaf explants. A high efficiency of shoot regeneration was observed in leaf (80.00% explants on MS basal medium supplemented with 0.024 mg/l TDZ and 79.7 mg/l adenine. Elongation and multiplication of shoots were obtained on Murashige and Skoog (MS basal medium, containing 0.5 mg/l 6. Benzyl aminopurine (BAP + 0.2mg/l Indole 3-acetic acid (IAA + 0.3 mg/l Gibberellic acid (GA3. High frequency root regeneration from in vitro developed shoots was observed on MS basal medium supplemented with 0.10 mg/l Indole 3-butyric acid(IBA. Maximum of the in vitro rooted plantlets were well accomplished to the mixture of sand: soil (1:1 and exhibited similar morphology with the field plants. A high efficiency plant regeneration protocol has been developedfrom leaf explants in Himalayan poplar (Populus ciliata Wall..

  14. Field Supervisory Test of DREB-Transgenic Populus: Salt Tolerance, Long-Term Gene Stability and Horizontal Gene Transfer

    Directory of Open Access Journals (Sweden)

    Nan Lu

    2014-05-01

    Full Text Available Improving saline resistance may be useful for reducing environmental susceptibility and improving yields in poplar plantations. However, the instability of genetically engineered traits and gene transfer reduce their usefulness and commercial value. To investigate whether the foreign gene is still present in the genome of receptor plants after seven years (i.e., long-term foreign gene stability and gene transfer, we randomly analyzed ten field-grown transgenic hybrid Populus ((Populus tomentosa × Populus bolleana × P. tomentosa carrying the DREB1 gene from Atriplex hortensis. The results of PCR and tissue culture experiments showed that AhDREB1 was present in the transgenic trees and was still expressed. However, the transcriptional expression level had decreased compared with that four years earlier. The PCR results also indicated no foreign gene in the genomic DNA of microorganisms in the soil near the transgenic poplars, indicating that no significant gene transfer had occurred from the transgenic poplars to the microorganisms at seven years after planting.

  15. Defining the Boundaries and Characterizing the Landscape of Genome Expression in Vascular Tissues of Populus using Shotgun Proteomics

    Energy Technology Data Exchange (ETDEWEB)

    Abraham, Paul E [ORNL; Adams, Rachel M [ORNL; Giannone, Richard J [ORNL; Kalluri, Udaya C [ORNL; Ranjan, Priya [ORNL; Erickson, Brian K [ORNL; Shah, Manesh B [ORNL; Tuskan, Gerald A [ORNL; Hettich, Robert {Bob} L [ORNL

    2012-01-01

    Current state-of-the-art experimental and computational proteomic approaches were integrated to obtain a comprehensive protein profile of Populus vascular tissue. This featured: 1) a large sample set consisting of two genotypes grown under normal and tension stress conditions, 2) bioinformatics clustering to effectively handle gene duplication, and 3) an informatics approach to track and identify single amino acid polymorphisms (SAAPs). By applying a clustering algorithm to the Populus database, the number of protein entries decreased from 64,689 proteins to a total of 43,069 protein groups, thereby reducing 7,505 identified proteins to a total of 4,226 protein groups, in which 2,016 were singletons. This reduction implies that ~50% of the measured proteins were clustered into groups that shared extensive sequence homology. Using conservative search criteria, we were able to identify 1,354 peptides containing a SAAP and 201 peptides that become tryptic due to a K or R substitution. These newly identified peptides correspond to 502 proteins, including 97 proteins that were not previously identified. In total, the integration of deep proteome measurements on an extensive sample set with protein clustering and peptide sequence variants provided an unprecedented level of proteome characterization for Populus, allowing us to spatially resolve the vascular tissue proteome.

  16. Changes in sulphur metabolism of grey poplar (Populus x canescens) leaves during salt stress: a metabolic link to photorespiration.

    Science.gov (United States)

    Herschbach, Cornelia; Teuber, Markus; Eiblmeier, Monika; Ehlting, Barbara; Ache, Peter; Polle, Andrea; Schnitzler, Jörg-Peter; Rennenberg, Heinz

    2010-09-01

    The poplar hybrid Populus x canescens (syn. Populus tremula x Populus alba) was subjected to salt stress by applying 75 mM NaCl for 2 weeks in hydroponic cultures. Decreasing maximum quantum yield (Fv/Fm) indicated damage of photosystem II (PS II), which was more pronounced under nitrate compared with ammonium nutrition. In vivo staining with diaminobenzidine showed no accumulation of H(2)O(2) in the leaf lamina; moreover, staining intensity even decreased. But at the leaf margins, development of necrotic tissue was associated with a strong accumulation of H(2)O(2). Glutathione (GSH) contents increased in response to NaCl stress in leaves but not in roots, the primary site of salt exposure. The increasing leaf GSH concentrations correlated with stress-induced decreases in transpiration and net CO(2) assimilation rates at light saturation. Enhanced rates of photorespiration could also be involved in preventing reactive oxygen species formation in chloroplasts and, thus, in protecting PS II from damage. Accumulation of Gly and Ser in leaves indeed indicates increasing rates of photorespiration. Since Ser and Gly are both immediate precursors of GSH that can limit GSH synthesis, it is concluded that the salt-induced accumulation of leaf GSH results from enhanced photorespiration and is thus probably restricted to the cytosol.

  17. Efficient Agrobacterium-mediated transformation of commercial hybrid poplar Populus nigra L. x P. maximowiczii A. Henry.

    Science.gov (United States)

    Yevtushenko, Dmytro P; Misra, Santosh

    2010-03-01

    Many economically important species of Populus, especially those in sections Aigeiros and Tacamahaca, remain recalcitrant to genetic transformation. In this study, a simple and reliable protocol was developed for the efficient Agrobacterium-mediated transformation of a difficult-to-transform, but commercially viable, hybrid poplar Populus nigra L. x P. maximowiczii A. Henry (NM6). A plant transformation vector designed to express the beta-glucuronidase (GUS) gene was used to detect transformation events at early stages of plant regeneration and to optimize parameters affecting poplar transformation. The use of zeatin riboside in shoot-induction medium, regeneration of shoots via indirect organogenesis, and early selection pressure were the major modifications that drastically improved the efficiency of poplar transformation and minimized the number of untransformed regenerants. Transgenic shoots were routinely obtained 4-10 weeks after co-culture with A. tumefaciens, with a greater than 90% rate of plant recovery. Stable transgene integration, ranging from a single insertion to ten copies per genome, was confirmed by Southern blot analysis. The mean transformation frequency was 36.3% and about two-thirds of the lines had 1-2 transgene copies. Among the explants, petioles and leaves had a higher transformation frequency than did stem segments. Growth characteristics and the morphology of transgenic poplar plants were identical to untransformed controls. These findings will accelerate the development of P. nigra x P. maximowiczii plants with novel traits, and may also be useful to improve transformation procedures for other Populus species.

  18. The applications of populus fiber in removal of Cr{sup (VI)} from aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Li, Miaomiao; Gong, Yumei, E-mail: ymgong@dlpu.edu.cn; Lyu, Aichao; Liu, Yuanfa, E-mail: morning309@126.com; Zhang, Hong, E-mail: zhang_hong1234@sina.com

    2016-10-15

    Highlights: • A sorbent for heavy metal ions based on populus fibers is prepared by a green way. • The chromium adsorption on the sorbent accords with the pseudo-second-order kinetics. • The proposed adsorption involves static attraction and chelation by the sorbent on chromium. • The sorbent is expected to be applied in universal conditions. - Abstract: The surface modification of natural materials to be applied in removal of Cr{sup (VI)} from aqueous solutions has attracted much attention. A natural sorbent for Cr{sup (VI)} based on natural populus fibers (PF) is prepared by transforming the cyano groups (AN) in polyacrylonitriles (PAN) grafted from PF into amidoxime groups (AO), which has strong ability to attract and chelate heavy metal ions. The prepared sorbent is characterized by Fourier Transform Infrared Spectra (FT-IR), thermogravimetric analysis (TGA), solid-state nuclear magnetic resonance ({sup 13}C NMR) and scanning electron microscope (SEM). As potassium dichromate solution (K{sub 2}Cr{sub 2}O{sub 7}) is used as a target solution for detecting adsorption capacity of the sorbent, the adsorption kinetics of the sorbent for chromiun is consistent with the pseudo-second-order kinetic model by analyzing the adsorption amount as a function of the sorbent dispersed duration in solution at pH = 2. The expected adsorption mechanism is that the Cr{sup (VI)} in anionic ions Cr{sub 2}O{sub 7}{sup 2−} and HCrO{sub 4}{sup −} are adsorbed through electrostatic attraction but when Cr{sup (VI)} is reduced to Cr{sup (III)} by AO, the electronegative nitrogen and oxygen in AO chelate it through coordination bond. The as-prepared PF derivant with high adsorption efficiency of chromium 180.5 mg/g (3.47 mmol/g), low cost, reusability and greenly preparation process suggests that the development of natural PF as a sorbent in removal of Cr{sup (VI)} from aqueous solutions is a destined significant approach.

  19. Genotypic Variation in Nutrient Selectivity in Populus under NaCl Stress

    Institute of Scientific and Technical Information of China (English)

    Chen Shaoliang; Bai Genben; Liu Xiangfen; Li Jinke; Wang Shasheng; Andrea Polle; Aloys Huttermann

    2003-01-01

    We used a salt-resistant poplar genotype Populus euphratica and two salt-sensitive genotypes, Populus ‘popularis35-44' (P. popularis) and the hybrid P. talassica Kom × (P. euphratica + Salix alba L.) to examine genotypic differences in nutrientselectivity under NaCl stress. One-year-old seedlings ofP. euphratica and one-year-old hardwood cuttings ofP. popularis were usedin a short-term study (24 hours), while in a long-term study, up to 4 weeks, two-year-old seedlings ofP. euphratica and the hybrid P.talassica Kom × (P. euphratica + Salix alba L.) were compared. In the short-term study, K+ concentration in the xylem sap ([K+]xylem)of P. euphratica significantly increased after salt stress was initiated, and maintained 1-2 fold higher than control levels during theperiod of salt stress (24 hours). Xylem Ca2+ and Mg2+ concentrations ([Ca2+]xylem, [Mg2+]xylem) in P. euphratica resembled the patternof K+ despite a lesser magnitude in elevation. However, [K+]xylem, [Ca2+]xylem and [Mg2+]xylem in P. popularis exhibited a transient in-crease at the beginning of salt treatment, thereafter, they all returned to control levels at 4 hours and no further rise was observed inthe following hours. Xylem Na+/K+, Na+/Ca2+ and Na+/Mg2+ in P. popularis increased sharply upon NaCl stress and steadily reachedthe maximum at 24 hours. In contrast, xylem Na+/K+, Na+/Ca2+ and Na+/Mg2+ in NaCl-treated plants of P. euphratica did not signifi-cantly increase during the period of salt stress (24 hours). Noteworthy, Na+/K+ markedly declined after the onset of stress. These re-sults suggest that P. euphratica had a higher nutrient selectivity in face of salinity. A same trend was observed in a 4-week study.Xylem Na+/K+, Na+/Ca2+ and Na+/Mg2+ in salinised plants of the hybrid abruptly increased after 4 days of stress, and then continu-ously increased to reach the highest level at day 8 or day 15. In comparison, the magnitude of Na+/K+, Na+/Ca2+ and Na+/Mg2+ eleva-tion in the xylem of P

  20. Incremento volumétrico de un ensayo con híbridos de Populus spp.

    Directory of Open Access Journals (Sweden)

    Oscar Vallejos-Barra

    2015-09-01

    Full Text Available El aumento de los requerimientos energéticos demandados por la sociedad ha impulsado el interés por establecer ensayos para seleccionar especies o híbridos que en el menor tiempo posible generen la mayor cantidad de volumen o biomasa. En esta investigación, se determinó el incremento medio anual del volumen de un ensayo con híbridos de Populus con la finalidad de dar a conocer la potencialidad de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca. De este catálogo se escogieron los seis híbridos más promisorios y se compararon con seis híbridos comerciales. El ensayo se estableció a 10 km al norte de la ciudad de Talca, en la estación experimental Panguilemo de la Universidad de Talca. En terreno se midió el diámetro basal y la altura por tres años a las seis plantas centrales de cada parcela, con cuatro repeticiones por híbrido para ambas densidades de plantación (5.000 y 10.000 plantas por hectárea. El volumen se calculó utilizando el exponente mórfico de un Paracono. El incremento volumétrico varió entre 5,306 y 15,828 m3 ha-1 año-1, detectando diferencias significativas entre los híbridos. El grupo de mayor productividad estuvo compuesto por cinco híbridos todos del catálogo del CTA. Este resultado demuestra que si se desea una mayor productividad en plantaciones dendroenergéticas que utilicen híbridos de Populus se deberían considerar algunos de los híbridos del catálogo del Centro Tecnológico del Álamo (CTA de la Universidad de Talca.

  1. Pharmacological potential of Populus nigra extract as antioxidant, anti-inflammatory, cardiovascular and hepatoprotective agent

    Institute of Scientific and Technical Information of China (English)

    Nadjet Debbache-Benaida; Dina Atmani-Kilani; Valrie Barbara Schini-Keirth; Nouredine Djebbli; Djebbar Atmani

    2013-01-01

    Objective: To evaluate antioxidant, anti-inflammatory, hepatoprotective and vasorelaxant activities of Populus nigra flower buds ethanolic extract. Methods: Antioxidant and anti-inflammatory activities of the extract were assessed using respectively the ABTS test and the animal model of carrageenan-induced paw edema. Protection from hepatic toxicity caused by aluminum was examined by histopathologic analysis of liver sections. Vasorelaxant effect was estimated in endothelium-intact and-rubbed rings of porcine coronary arteries precontracted with high concentration of U46619. Results:The results showed a moderate antioxidant activity (40%), but potent anti-inflammatory activity (49.9%) on carrageenan-induced mice paw edema, and also as revealed by histopathologic examination, complete protection against AlCl3-induced hepatic toxicity. Relaxant effects of the same extract on vascular preparation from porcine aorta precontracted with high concentration of U46619 were considerable at 10-1 g/L, and comparable (P>0.05) between endothelium-intact (67.74%, IC50=0.04 mg/mL) and-rubbed (72.72%, IC50=0.075 mg/mL) aortic rings. Conclusions: The extract exerted significant anti-inflammatory, hepatoprotective and vasorelaxant activities, the latter being endothelium-independent believed to be mediated mainly by the ability of components present in the extract to exert antioxidant properties, probably related to an inhibition of Ca2+influx.

  2. The Populus homeobox gene ARBORKNOX2 regulates cell differentiation during secondary growth.

    Science.gov (United States)

    Du, Juan; Mansfield, Shawn D; Groover, Andrew T

    2009-12-01

    The stem cells of the vascular cambium divide to produce daughter cells, which in turn divide before undergoing differentiation during the radial growth of woody stems. The genetic regulation of these developmental events is poorly understood, however. We report here the cloning and functional characterization of a Populus class-I KNOX homeobox gene, ARBORKNOX2 (ARK2), which we show influences terminal cell differentiation and cell wall properties during secondary growth. In the early stages of secondary growth, ARK2 is expressed broadly in the cambial zone and in terminally differentiating cell types, before becoming progressively restricted to the cambium. ARK2 overexpression and synthetic miRNA-suppression transgenics reveal positive correlations between ARK2 expression level and the timing of cambium formation, the width of the cambial zone and inhibition of cambial daughter cell differentiation. These phenotypes in turn correlate with changes in the expression of genes affecting transcription, cell division, auxin and cell wall synthesis. Notably, wood properties associated with secondary cell wall synthesis are negatively associated with ARK2 expression, including lignin and cellulose content. Together, our results suggest that ARK2 functions primarily to regulate a complex suite of genes that together influence cell differentiation during secondary growth. We propose that ARK2 may represent a co-evolved transcriptional module that influences complex, adaptive wood properties.

  3. Duplication of Locus Coding of Malate Dehydrogenase in Populus tomentosa Carr.

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Horizontal starch-gel electrophoresis was used to study crude enzyme extraction from young leaves of 234 clones of Populus tomentosa Carr. selected from nine provenances in North China. Ten enzyme systems were resolved. One hundred and fifty-six clones showing unusual allozyme band patterns at locus Mdh-1 were found. Three allozyme bands at locus Mdh-1 were 9:6:1 in concentration. Further studies on the electrophoretic patterns of ground mixed pollen extraction of 30 male clones selected at random from the 156 clones were conducted and it was found that allozyme bands at locus Mdh-1 were composed of two dark-stained bands and a weak band. Only one group of the malate dehydrogenase (MDH) zymogram composed of two bands was obtained from the electrophoretic segregation of pollen leachate of the same clones. A comparison of the electrophoretic patterns one another suggested that the locus Mdh-1 coding malate dehydrogenase in diploid species of P. tomentosa was duplicated. The duplicate gene locus possessed three same alleles and was located in mitochondria. The locus duplication of alleles coding malate dehydrogenase in P. tomentosa was discovered and reported for the first time.

  4. Effects of Planting Density on Growth of New Clones in Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    Zhang Zihui; Zhang Zhiyi; Lin Shanzhi; Li Xinguo

    2003-01-01

    Effects of seven planting densities on the growth and tree form of nine 5-year-old new clones in Populus tomentosa were studied. The plantations, arranged with completely random block design, were located in Wuzhi County, Henan Province. Results indicated that effects of planting density on the diameter at breast height (DBH), individual volume and growing stock increment of all new clones in P. tomentosa were significant at the 1% level of probability, effects of planting density on the tree height increment of new clones B2 and B31 and on the live branches height (LBH) increment of new clones B5 and B30 were significant at the 5% level of probability, while the interaction between planting density and clone was not significant at the 5% level of probability. It was concluded that the degree of differences among new clones within the same planting density was different with different planting densities and traits. For short rotation industrial timber, clones B1, B3, B4, B5, B7, B9, B31 were suitable with the density of 1 000-2 500 trees per hectare, while for bigger diameter timber, clones B1, B3, B4, B7, B9, B31 could be used with the planting density of 660-833 trees per hectare. Clonal repeatability was also different in different planting densities.

  5. Variation Analysis of Seed and Seedling Traits of Cross Combination Progenies in Populus

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Twenty-five species and hybrids in Populus were used as parents, and 26 cross combinations, including more than 5 000 seedlings, were obtained by artificial cross breeding. The length of infructescence, number of seeds per infructescence, thousand-seed weight, germination rate of seeds among these cross combinations were tested. The results indicated that the cross combinational effects were significant for these traits, and demonstrated that the length of infructescence, thousand-seed weight were positively affected by female parent. In addition, seedling height, diameter above ground, diameter at breast height (DBH) of 17 cross combination progenies were investigated. The analysis of mean and standard deviation of these three traits showed that seedling height, diameter above ground, DBH had extensive variation among combinations and individuals within combination. Variance analysis and estimate of heritability indicated that the three traits had wide variation and were controlled by heredity. It was feasible to select superior cross combinations and seedlings. Further more, the result of multiple comparison showed that P. deltoides 'Lux' × P. deltoides 'D324', P. ussuriensis cl. 'U4' × P. deltoides 'T66', P. ussuriensis cl. 'U4' × P. deltoides 'T26', P. deltoides 'Lux' × P. ussuriensis cl. 'U3', (P. tomentosa × P. bolleana) × (P. alba × P. glandulosa), (P. alba × P. tomentosa) × (P. alba × P. glandulosa ), and (P. alba × P. glandulosa 'No. 2') × P. tomentosa 'Lumao 50' were superior cross combinations with higher growth rate. Finally, 123 elite seedlings were selected for further test.

  6. Photosynthesis of Populus euphratica and its response to elevated CO2 concentration in an arid environment

    Institute of Scientific and Technical Information of China (English)

    Honghua Zhou; Yaning Chen; Weihong Li; Yapeng Chen; Lixin Fu

    2009-01-01

    The photosynthetic characterization of Populus euphratica and its response to the elevated carbon dioxide concentration ([CO2]) were analyzed based on its net photosynthetic rate (Pn),stomatal conductance (gs),intercellular CO2 concentration (Ci),transpiration rate (Tr),and water use efficiency (WUE) at different groundwater depths measured by a portable gas exchange system (LI-6400) in the lower reaches of the Tarim River.The results showed that the elevation of [CO2]decreased the gs,and increased the Pn,Ci and WUE of P.euphratica.However,the effects of the elevated [CO2]on gs,Pn,Ci and WUE varied considerably with groundwater depth.The response of photosynthesis to rising [CO2]was stronger at the greater groundwater depth (more than 6 m) than that at the shallower groundwater depth (less than 6 m).The critical groundwater depth required to maintain the normal survival of P.euphratica was less than 6 m.When the groundwater depth increased to more than 6 m,P.euphratica encountered moderate water stress,and the plant suffered severe water stress when the groundwater depth increased to more than 7 m.

  7. Diversity of soil microorganisms in natural Populus euphratica forests in Xinjiang, northwestern China

    Institute of Scientific and Technical Information of China (English)

    Haili QIAO; Chengming TIAN; Youqing LUO; Jianhua SUN; Xiaofeng FENG

    2008-01-01

    To better understand the distribution of soil microorganisms in Populus euphratica forests in Xin-jiang, northwestern China, we studied and compared the populations and numbers of bacteria, fungi and actino-mycetes in the soil at four different age stages of natural P. euphratica forests, i.e., juvenile forests, middle-aged for-ests, over-mature forests and degraded forests. Results showed that there were clear differences in the amount of microorganism biomass and composition rates across the four forest stages. Dominant and special microorgan-isms were present in each of the four different soil layers.The vertical distribution showed that the microorganism biomass decreased with increasing soil depth. The popu-lation of microorganisms was the lowest at 31-40 cm of soil depth. The microorganisms consisted of bacteria, actinomycetes, as well as fungi. Bacteria were the chief component of microorganisms and were widely distribu-ted, but fungi were scarce in some soil layers. Aspergillus was the dominant genus among the 11 genera of fungi isolated from the soil in different age stages of P. euphra-tica forests.

  8. A transcriptomic network underlies microstructural and physiological responses to cadmium in Populus x canescens.

    Science.gov (United States)

    He, Jiali; Li, Hong; Luo, Jie; Ma, Chaofeng; Li, Shaojun; Qu, Long; Gai, Ying; Jiang, Xiangning; Janz, Dennis; Polle, Andrea; Tyree, Melvin; Luo, Zhi-Bin

    2013-05-01

    Bark tissue of Populus × canescens can hyperaccumulate cadmium, but microstructural, transcriptomic, and physiological response mechanisms are poorly understood. Histochemical assays, transmission electron microscopic observations, energy-dispersive x-ray microanalysis, and transcriptomic and physiological analyses have been performed to enhance our understanding of cadmium accumulation and detoxification in P. × canescens. Cadmium was allocated to the phloem of the bark, and subcellular cadmium compartmentalization occurred mainly in vacuoles of phloem cells. Transcripts involved in microstructural alteration, changes in nutrition and primary metabolism, and stimulation of stress responses showed significantly differential expression in the bark of P. × canescens exposed to cadmium. About 48% of the differentially regulated transcripts formed a coregulation network in which 43 hub genes played a central role both in cross talk among distinct biological processes and in coordinating the transcriptomic regulation in the bark of P. × canescens in response to cadmium. The cadmium transcriptome in the bark of P. × canescens was mirrored by physiological readouts. Cadmium accumulation led to decreased total nitrogen, phosphorus, and calcium and increased sulfur in the bark. Cadmium inhibited photosynthesis, resulting in decreased carbohydrate levels. Cadmium induced oxidative stress and antioxidants, including free proline, soluble phenolics, ascorbate, and thiol compounds. These results suggest that orchestrated microstructural, transcriptomic, and physiological regulation may sustain cadmium hyperaccumulation in P. × canescens bark and provide new insights into engineering woody plants for phytoremediation.

  9. Genetic variation in functional traits influences arthropod community composition in aspen (Populus tremula L..

    Directory of Open Access Journals (Sweden)

    Kathryn M Robinson

    Full Text Available We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores.

  10. Comparative physiological and proteomic analyses of poplar (Populus yunnanensis plantlets exposed to high temperature and drought.

    Directory of Open Access Journals (Sweden)

    Xiong Li

    Full Text Available Plantlets of Populus yunnanensis Dode were examined in a greenhouse for 48 h to analyze their physiological and proteomic responses to sustained heat, drought, and combined heat and drought. Compared with the application of a single stress, simultaneous treatment with both stresses damaged the plantlets more heavily. The plantlets experienced two apparent response stages under sustained heat and drought. During the first stage, malondialdehyde and reactive oxygen species (ROS contents were induced by heat, but many protective substances, including antioxidant enzymes, proline, abscisic acid (ABA, dehydrin, and small heat shock proteins (sHSPs, were also stimulated. The plants thus actively defended themselves against stress and exhibited few pathological morphological features, most likely because a new cellular homeostasis was established through the collaborative operation of physiological and proteomic responses. During the second stage, ROS homeostasis was overwhelmed by substantial ROS production and a sharp decline in antioxidant enzyme activities, while the synthesis of some protective elements, such as proline and ABA, was suppressed. As a result, photosynthetic levels in P. yunnanensis decreased sharply and buds began to die, despite continued accumulation of sHSPs and dehydrin. This study supplies important information about the effects of extreme abiotic environments on woody plants.

  11. Gibberellins regulate lateral root formation in Populus through interactions with auxin and other hormones.

    Science.gov (United States)

    Gou, Jiqing; Strauss, Steven H; Tsai, Chung Jui; Fang, Kai; Chen, Yiru; Jiang, Xiangning; Busov, Victor B

    2010-03-01

    The role of gibberellins (GAs) in regulation of lateral root development is poorly understood. We show that GA-deficient (35S:PcGA2ox1) and GA-insensitive (35S:rgl1) transgenic Populus exhibited increased lateral root proliferation and elongation under in vitro and greenhouse conditions, and these effects were reversed by exogenous GA treatment. In addition, RNA interference suppression of two poplar GA 2-oxidases predominantly expressed in roots also decreased lateral root formation. GAs negatively affected lateral root formation by inhibiting lateral root primordium initiation. A whole-genome microarray analysis of root development in GA-modified transgenic plants revealed 2069 genes with significantly altered expression. The expression of 1178 genes, including genes that promote cell proliferation, growth, and cell wall loosening, corresponded to the phenotypic severity of the root traits when transgenic events with differential phenotypic expression were compared. The array data and direct hormone measurements suggested crosstalk of GA signaling with other hormone pathways, including auxin and abscisic acid. Transgenic modification of a differentially expressed gene encoding an auxin efflux carrier suggests that GA modulation of lateral root development is at least partly imparted by polar auxin transport modification. These results suggest a mechanism for GA-regulated modulation of lateral root proliferation associated with regulation of plant allometry during the stress response.

  12. Overexpression of phospholipase Dα gene enhances drought and salt tolerance of Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    ZHANG TingTing; SONG YunZhi; LIU YuDong; GUO XingQi; ZHU ChangXiang; WEN FuJiang

    2008-01-01

    The cDNA of AtPLDα (Arabidopsis thaliana Phospholipase Da) gene was introduced into P. tomentosa (Populus tomentosa) under the control of the Cauliflower mosaic virus 35S promoter. Southern and Northern blot analyses suggested that the AtPLDα gene has been transferred into the P. tomentosa genome. No obvious morphological or developmental difference was observed between the transgenic and wild-type (WT) plants. Drought and salt tolerance and gene expression of seedlings of several transgenic lines and WT plants (control) were studied. The results showed that the rhizogenesis rate and the average root-length of transgenic lines were significantly higher than WT plants after mannitol and NaCl treatment under the same growth conditions. Northern blot analysis indicated that the higher the PLDα expression in the transgenic plants, the more tolerant the transgenic plants are to drought and salt treatment. Meanwhile, another group of these transgenic lines and WT plants (control) were treated with PEG6000 and NaCI separately. The contents of chlorophylls and the activities of some antioxidant enzymes (superoxide dismutase, guaiacol peroxidase and catalase) as well as malondialdehyde and relative electrical conductivity were analyzed. Altogether, our results demonstrated that overexpression of the PLDα gene can enhance the drought and salt tolerance in transgenic P. tomentosa plants.

  13. [Simulation of soil water dynamics in triploid Populus tomentosa root zone under subsurface drip irrigation].

    Science.gov (United States)

    Xi, Ben-Ye; Jia, Li-Ming; Wang, Ye; Li, Guang-De

    2011-01-01

    Based on the observed data of triploid Populus tomentosa root distribution, a one-dimensional root water uptake model was proposed. Taking the root water uptake into account, the soil water dynamics in triploid P. tomentosa root zone under subsurface drip irrigation was simulated by using HYDRUS model, and the results were validated with field experiment. Besides, the HYDRUS model was used to study the effects of various irrigation technique parameters on soil wetting patterns. The RMAE for the simulated soil water content by the end of irrigation and approximately 24 h later was 7.8% and 6.0%, and the RMSE was 0.036 and 0.026 cm3 x cm(-3), respectively, illustrating that the HYDRUS model performed well in simulating the short-term soil water dynamics in triploid P. tomentosa root zone under drip irrigation, and the root water uptake model was reasonable. Comparing with 2 and 4 L x h(-1) of drip discharge and continuous irrigation, both the 1 L x h(-1) of drip discharge and the pulsed irrigation with water applied intermittently in 30 min periods could increase the volume of wetted soil and reduce deep percolation. It was concluded that the combination of 1 L x h(-1) of drip discharge and pulsed irrigation should be the first choice when applying drip irrigation to triploid P. tomentosa root zone at the experiment site.

  14. Water and energy consumption of Populus spp. bioenergy systems: A case study in Southern Europe

    Energy Technology Data Exchange (ETDEWEB)

    Sevigne, Eva [SosteniPrA (UAB-IRTA), Institut de Ciencia i Tecnologia Ambientals (ICTA), Universitat Autonoma de Barcelona (UAB), 08193 Bellaterra, Barcelona (Spain); Gasol, Carles M. [SosteniPrA (UAB-IRTA), Institut de Ciencia i Tecnologia Ambientals (ICTA), Universitat Autonoma de Barcelona (UAB), 08193 Bellaterra, Barcelona (Spain); Inedit Innovacio S.L. Parc de Recerca de la Universitat Autonoma de Barcelona (UAB), Carretera de Cabrils Km2, 08348 Barcelona (Spain); Brun, Filippo [Dipartimento di Economia e Ingegneria Agraria Forestale e Ambientale, University of Torino (Italy); Rovira, Laura; Pages, Josep Maria; Camps, Francesc [IRTA-Mas Badia, Institut de Recerca i Tecnologia Agroalimentaria (IRTA), Estacion Experimental Fundacion Mas Badia Ctra, De la Tallada, s/n, 17134 La Tallada, Girona (Spain); Rieradevall, Joan; Gabarrell, Xavier [SosteniPrA (UAB-IRTA), Institut de Ciencia i Tecnologia Ambientals (ICTA), Universitat Autonoma de Barcelona (UAB), 08193 Bellaterra, Barcelona (Spain); Chemical Engineering Department, Universitat Autonoma de Barcelona (UAB), 08193 Bellaterra, Barcelona (Spain)

    2011-02-15

    With the objectives of climate change mitigation and energy independence, energy crops have been proposed as an alternative to fossil fuels. In recent years short rotation energy crops have been promoted because they provide biomass in short periods of time. However, the impacts of water consumption, in both the impact on the energy balance due to the consumption of irrigation as the impacts on existing water resources, have not been analyzed in depth. This study evaluates the relationship between water, energy and CO{sub 2} emissions of a plot of Populus spp. in Spain with the aim of evaluating the feasibility of its implementation as large-scale cultivation. For the energy and environmental assessment it has been used the life cycle analysis methodology. The results show positive energy balance and environmental improvement respect other energies such as natural gas. Consumption of water required to avoid a kg of CO{sub 2} is 4.6 m{sup 3} and per unit of energy obtained is 45 m{sup 3} GJ{sup -1} considering a life cycle approach and in relation to the water availability of the basin could increase the pressure. Hence, in order to establish energy crops for climate change mitigation water consumption associated must be taken into account for future energy planning. (author)

  15. Genetic variation in functional traits influences arthropod community composition in aspen (Populus tremula L.).

    Science.gov (United States)

    Robinson, Kathryn M; Ingvarsson, Pär K; Jansson, Stefan; Albrectsen, Benedicte R

    2012-01-01

    We conducted a study of natural variation in functional leaf traits and herbivory in 116 clones of European aspen, Populus tremula L., the Swedish Aspen (SwAsp) collection, originating from ten degrees of latitude across Sweden and grown in a common garden. In surveys of phytophagous arthropods over two years, we found the aspen canopy supports nearly 100 morphospecies. We identified significant broad-sense heritability of plant functional traits, basic plant defence chemistry, and arthropod community traits. The majority of arthropods were specialists, those coevolved with P. tremula to tolerate and even utilize leaf defence compounds. Arthropod abundance and richness were more closely related to plant growth rates than general chemical defences and relationships were identified between the arthropod community and stem growth, leaf and petiole morphology, anthocyanins, and condensed tannins. Heritable genetic variation in plant traits in young aspen was found to structure arthropod community; however no single trait drives the preferences of arthropod folivores among young aspen genotypes. The influence of natural variation in plant traits on the arthropod community indicates the importance of maintaining genetic variation in wild trees as keystone species for biodiversity. It further suggests that aspen can be a resource for the study of mechanisms of natural resistance to herbivores.

  16. Sex-related adaptive responses to interaction of drought and salinity in Populus yunnanensis.

    Science.gov (United States)

    Chen, Lianghua; Zhang, Sheng; Zhao, Hongxia; Korpelainen, Helena; Li, Chunyang

    2010-10-01

    We used Populus yunnanensis Dode., a native dioecious species in southwestern China, as a model species to study morphological, physiological, biochemical and ultrastructural responses to drought, salinity and their combination. Females exhibited more growth inhibition, gas exchange rate depression and reactive oxygen species (ROS) accumulation; higher lipid peroxide levels, lower osmotic adjustment capacity and ascorbate-glutathione cycle enzyme activities; and more damage to cell organelles than did males under drought, salinity and especially under their combination. In addition, we found sex-specific responses in total chlorophyll content (TC), carotenoid concentration and carbon isotope composition under different osmotic stresses. Our results indicated that: (1) females are more sensitive and suffer from greater negative effects than do males under drought, salinity and especially under their combination; (2) sexual differences in adaptive responses to drought, salinity and their combination are context dependent; and (3) sex-specific reactions under a combination of stresses are distinct from single-stress responses. Thus, these results provide evidence for adaptive differentiation between sexes in responses to osmotic stresses and in the sensitivity to environmental change. © 2010 Blackwell Publishing Ltd.

  17. Phenology and climate relationships in aspen (Populus tremuloides Michx.) forest and woodland communities of southwestern Colorado

    Science.gov (United States)

    Meier, Gretchen A.; Brown, Jesslyn F.; Evelsizer, Ross J.; Vogelmann, James E.

    2014-01-01

    Trembling aspen (Populus tremuloides Michx.) occurs over wide geographical, latitudinal, elevational, and environmental gradients, making it a favorable candidate for a study of phenology and climate relationships. Aspen forests and woodlands provide numerous ecosystem services, such as high primary productivity and biodiversity, retention and storage of environmental variables (precipitation, temperature, snow–water equivalent) that affect the spring and fall phenology of the aspen woodland communities of southwestern Colorado. We assessed the land surface phenology of aspen woodlands using two phenology indices, start of season time (SOST) and end of season time (EOST), from the U.S. Geological Survey (USGS) database of conterminous U.S. phenological indicators over an 11-year time period (2001–2011). These indicators were developed with 250 m resolution remotely sensed data from the Moderate Resolution Imaging Spectroradiometer processed to highlight vegetation response. We compiled data on SOST, EOST, elevation, precipitation, air temperature, and snow water equivalent (SWE) for selected sites having more than 80% cover by aspen woodland communities. In the 11-year time frame of our study, EOST had significant positive correlation with minimum fall temperature and significant negative correlation with fall precipitation. SOST had a significant positive correlation with spring SWE and spring maximum temperature.

  18. Map and analysis of microsatellites in the genome of Populus: The first sequenced perennial plant

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    We mapped and analyzed the microsatellites throughout 284295605 base pairs of the unambiguously assembled sequence scaffolds along 19 chromosomes of the haploid poplar genome. Totally, we found 150985 SSRs with repeat unit lengths between 2 and 5 bp. The established microsatellite physical map demonstrated trat SSRs were distributed relatively evenly across the genome of Populus. On average, These SSRs occurred every 1883 bp within the poplar genome and the SSR densities in intergenic regions, introns, exons and UTRs were 85.4%, 10.7%, 2.7% and 1.2%, respectively. We took di-, tri-, tetra-and pentamers as the four classes of repeat units and found that the density of each class of SSRs decreased with the repeat unit lengths except for the tetranucleotide repeats. It was noteworthy that the length diversification of microsatellite sequences was negatively correlated with their repeat unit length and the SSRs with shorter repeat units gained repeats faster than the SSRs with longer repeat units. We also found that the GC content of poplar sequence significantly correlated with densities of SSRs with uneven repeat unit lengths (tri- and penta-), but had no significant correlation with densities of SSRs with even repeat unit lengths (di- and tetra-). In poplar genome, there were evidences that the occurrence of different microsatellites was under selection and the GC content in SSR sequences was found to significantly relate to the functional importance of microsatellites.

  19. Characteristics and dynamics analysis of Populus euphratica populations in the middle reaches of Tarim River

    Institute of Scientific and Technical Information of China (English)

    JunXia WU; XiMing ZHANG; ChaoZhou DENG; GuoJun LIU; Hong LI

    2010-01-01

    Populus euphratica Oliv.is widely distributed along the Tarim River.Maintaining stability of P.euphratica population is important to local development.This study explored the static life table,survivorship curves and four function curves(survival rate,cumulative mortality rate,mortality density,and hazard rate),and development index of P.euphratica population in the middle reaches of Tarim River.The results indicated that the age structure of P.euphratica population belonged to positive pyramidal type,which meant young age-class individuals occupied most populations.The number of Ⅰ-Ⅱ age classes accounted for 66.2% of whole population,and this indicated that there were abundant subsequent seedlings resources to support the growth of P.euphratica population in the middle reaches of Tarim River.The survivorship curve of P.euphratica belonged to the Deevey Ⅲ(concave-type)and the development index was 47.72%.Four function curves revealed that the individuals of P.euphratica sharply decreased at the initial stage and then leveled off at the late stage of survival curve.Time sequence prediction models predicted that the number of midlife individuals would increase in future 10,20,30 years,and P.euphratica population grew steadily as a result of rich saplings.

  20. Analysis of synonymous codon usage in chloroplast genome of Populus alba

    Institute of Scientific and Technical Information of China (English)

    ZHOU Meng; LONG Wei; LI Xia

    2008-01-01

    The pattern of codon usage in the chloroplast genome of Populus alba was investigated.Correspondence analysis (a commonly used multivariate statistical approach) and method of effective number of codons (ENc)-plot were conducted to analyze synonymous codon usage.The results of correspondence analysis showed that the distribution of genes on the major axis was significantly correlated with the frequency of use of G+C in synonymously variable third position of sense codon (GC3S),(r=0.349),and the positions of genes on the axis 2 and axis 3 were significantly correlated with CAI (r=-0.348,p<0.01 and r=0.602,p<0.01).The ENc for most genes was similar to that for the expected ENc based on the GC3S,but several genes with low ENC values were lying below the expected curve.All of these data indicated that codon usage was dominated by a mutational bias in chloroplast genome of P.alba.The selection in nature for translational efficiency only played a minor role in shaping codon usage in the chloroplast genome of P.alba.

  1. Inositol Hexakis Phosphate is the Seasonal Phosphorus Reservoir in the Deciduous Woody Plant Populus alba L.

    Science.gov (United States)

    Kurita, Yuko; Baba, Kei'ichi; Ohnishi, Miwa; Matsubara, Ryosuke; Kosuge, Keiko; Anegawa, Aya; Shichijo, Chizuko; Ishizaki, Kimitsune; Kaneko, Yasuko; Hayashi, Masahiko; Suzaki, Toshinobu; Fukaki, Hidehiro; Mimura, Tetsuro

    2017-09-01

    Seasonal recycling of nutrients is an important strategy for deciduous perennials. Deciduous perennials maintain and expand their nutrient pools by the autumn nutrient remobilization and the subsequent winter storage throughout their long life. Phosphorus (P), one of the most important elements in living organisms, is remobilized from senescing leaves during autumn in deciduous trees. However, it remains unknown how phosphate is stored over winter. Here we show that in poplar trees (Populus alba L.), organic phosphates are accumulated in twigs from late summer to winter, and that IP6 (myo-inositol-1,2,3,4,5,6-hexakis phosphate: phytic acid) is the primary storage form. IP6 was found in high concentrations in twigs during winter and quickly decreased in early spring. In parenchyma cells of winter twigs, P was associated with electron-dense structures, similar to globoids found in seeds of higher plants. Various other deciduous trees were also found to accumulate IP6 in twigs during winter. We conclude that IP6 is the primary storage form of P in poplar trees during winter, and that it may be a common strategy for seasonal P storage in deciduous woody plants. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  2. Spatial distribution characteristics of fine roots of Populus euphratica in a desert riparian forest

    Institute of Scientific and Technical Information of China (English)

    Jianhua SI; Qi FENG; Jianlin LI; Jian ZHAO

    2008-01-01

    The soil-plant system is a very important sub-system of the soil-plant-atmosphere continuum (SPAC). The water uptake by plant roots is an important subject in the research on water transport in this SPAC and is also the most active study direction in the fields of ecology, hydrology and environment. The study of the spatial dis-tribution pattern of fine roots of plants is the basis of constructing a water absorption model of plant roots. Our study on the spatial distribution pattern of fine roots of Populus euphratica in a desert riparian forest shows that the density distribution of its root lengths can be expressed horizontally as a parabola. The fine roots are concen-trated within the range of 0-350 cm from the tree trunk and their amount accounts for 91.9% of the total root mass within the space of 0-500 cm. In the vertical dir-ection, the density distribution of the fine root lengths shows a negative exponential relation with soil depth. The fine roots are concentrated in the 0-80 cm soil layer, accounting for 96.8% of the total root mass in the 0-140 cm soil layer.

  3. Allergic contact dermatitis from salicyl alcohol and salicylaldehyde in aspen bark (Populus tremula).

    Science.gov (United States)

    Aalto-Korte, Kristiina; Välimaa, Jarmo; Henriks-Eckerman, Maj-Len; Jolanki, Riitta

    2005-02-01

    Salicyl alcohol or 2-methylolphenol is a well-known allergen in phenol-formaldehyde resins and a strong sensitizer in guinea pigs. There is 1 previous report of allergic contact dermatitis from salicyl alcohol in aspen bark. We describe a second case with concomitant allergy to salicylaldehyde. An elk researcher who had handled leaves from various trees presented with eczema of the hands, face, flexures, trunk and extremities. Patch testing showed sensitivity to salicyl alcohol, salicylaldehyde, balsam of Peru (Myroxylon pereirae resin), aspen wood dust and an extract prepared from the bark of aspen (Populus tremula). Weaker reactions were observed to bark extracts of rowan (Sorbus aucuparia), tea-leaved willow (Salix phylicifolia) and goat willow (Salix caprea). We analysed salicyl alcohol and salicylaldehyde in the bark extracts and found the 2 chemicals in equal amounts, about 0.9 microg/mg in aspen bark and in lower concentrations in rowan and the willows. We did not find either of the chemicals in the test substance of balsam of Peru (Myroxylon pereirae). Besides salicyl alcohol, salicylaldehyde is also recommended to be used to screen for contact allergy to aspen. Both of these chemicals should be tested in forest workers in areas where aspen is growing.

  4. Quantitative Genetic Analysis of Biomass and Wood Chemistry of Populus under Different Nitrogen Levels

    Energy Technology Data Exchange (ETDEWEB)

    Novaes, E.; Osorio, L.; Drost, D. R.; Miles, B. L.; Boaventura-Novaes, C. R. D.; Benedict, C.; Dervinis, C.; Yu, Q.; Sykes, R.; Davis, M.; Martin, T. A.; Peter, G. F.; Kirst, M.

    2009-01-01

    The genetic control of carbon allocation and partitioning in woody perennial plants is poorly understood despite its importance for carbon sequestration, biofuels and other wood-based industries. It is also unclear how environmental cues, such as nitrogen availability, impact the genes that regulate growth, biomass allocation and wood composition in trees. We phenotyped 396 clonally replicated genotypes of an interspecific pseudo-backcross pedigree of Populus for wood composition and biomass traits in above- and below-ground organs. The loci that regulate growth, carbon allocation and partitioning under two nitrogen conditions were identified, defining the contribution of environmental cues to their genetic control. Sixty-three quantitative trait loci were identified for the 20 traits analyzed. The majority of quantitative trait loci are specific to one of the two nitrogen treatments, demonstrating significant nitrogen-dependent genetic control. A highly significant genetic correlation was observed between plant growth and lignin/cellulose composition, and quantitative trait loci co-localization identified the genomic position of potential pleiotropic regulators. Pleiotropic loci linking higher growth rates to wood with less lignin are excellent targets to engineer tree germplasm improved for pulp, paper and cellulosic ethanol production. The causative genes are being identified with a genetical genomics approach.

  5. Identification and characterization of nuclear genes involved in photosynthesis in Populus.

    Science.gov (United States)

    Wang, Bowen; Du, Qingzhang; Yang, Xiaohui; Zhang, Deqiang

    2014-03-27

    The gap between the real and potential photosynthetic rate under field conditions suggests that photosynthesis could potentially be improved. Nuclear genes provide possible targets for improving photosynthetic efficiency. Hence, genome-wide identification and characterization of the nuclear genes affecting photosynthetic traits in woody plants would provide key insights on genetic regulation of photosynthesis and identify candidate processes for improvement of photosynthesis. Using microarray and bulked segregant analysis strategies, we identified differentially expressed nuclear genes for photosynthesis traits in a segregating population of poplar. We identified 515 differentially expressed genes in this population (FC ≥ 2 or FC ≤ 0.5, P photosynthesis by the nuclear genome mainly involves transport, metabolism and response to stimulus functions. This study provides new genome-scale strategies for the discovery of potential candidate genes affecting photosynthesis in Populus, and for identification of the functions of genes involved in regulation of photosynthesis. This work also suggests that improving photosynthetic efficiency under field conditions will require the consideration of multiple factors, such as stress responses.

  6. Identification and characterization of nuclear genes involved in photosynthesis in Populus

    Science.gov (United States)

    2014-01-01

    Background The gap between the real and potential photosynthetic rate under field conditions suggests that photosynthesis could potentially be improved. Nuclear genes provide possible targets for improving photosynthetic efficiency. Hence, genome-wide identification and characterization of the nuclear genes affecting photosynthetic traits in woody plants would provide key insights on genetic regulation of photosynthesis and identify candidate processes for improvement of photosynthesis. Results Using microarray and bulked segregant analysis strategies, we identified differentially expressed nuclear genes for photosynthesis traits in a segregating population of poplar. We identified 515 differentially expressed genes in this population (FC ≥ 2 or FC ≤ 0.5, P photosynthesis by the nuclear genome mainly involves transport, metabolism and response to stimulus functions. Conclusions This study provides new genome-scale strategies for the discovery of potential candidate genes affecting photosynthesis in Populus, and for identification of the functions of genes involved in regulation of photosynthesis. This work also suggests that improving photosynthetic efficiency under field conditions will require the consideration of multiple factors, such as stress responses. PMID:24673936

  7. The effects of exogenous putrescine on sex-specific responses of Populus cathayana to copper stress.

    Science.gov (United States)

    Chen, Lianghua; Wang, Ling; Chen, Fugui; Korpelainen, Helena; Li, Chunyang

    2013-11-01

    We used the dioecious tree, Populus cathayana, as a model species to study plants' physiological and biochemical responses to copper (Cu) stress, exogenous putrescine (Put) treatment and their interaction. Although males accumulated higher Cu concentrations in leaves than did females under Cu stress, they did not suffer more damage than females, as reflected by changes in gas exchange, pigment contents, membrane lipid peroxidation (thiobarbituric acid reactive substances, TBARS) and protein oxidation (carbonyl). Higher Cu tolerance of males was correlated with a higher H2O2 scavenging ability and proline responses, and a better maintenance of non-protein thiols (NP-SHs) and spermine (Spm) contents. We also discovered that mitigation effects of exogenous Put on Cu stress occurred, as visible as a recovery of the total chlorophyll content, and lower TBARS and carbonyl under interaction treatment when compared to Cu stress alone. Exogenous Put decreased the Cu concentration in leaves of both sexes, but to different degrees. Such effects of exogenous Put suggested that Put may play important roles in the stabilization of membrane integrity and protein structures, and it may modulate the uptake and transportation of Cu. Our results indicated that (1) males are more tolerant to Cu stress than females; (2) Put could mitigate Cu toxicity in P. cathayana, but to a different degree in males and females; (3) males are better candidates than females for Cu extraction and phytoremediation.

  8. Metabolic functions of Pseudomonas fluorescens strains from Populus deltoides depend on rhizosphere or endosphere isolation compartment

    Directory of Open Access Journals (Sweden)

    Collin M Timm

    2015-10-01

    Full Text Available The bacterial microbiota of plants is diverse, with 1,000s of operational taxonomic units (OTUs associated with any individual plant. In this work we investigate the differences between 19 sequenced Pseudomonas fluorescens strains, isolated from Populus deltoides rhizosphere and endosphere and which represent a single OTU, using phenotypic analysis, comparative genomics, and metabolic models. While no traits were exclusive to either endosphere or rhizosphere P. fluorescens isolates, multiple pathways relevant for plant-bacterial interactions are enriched in endosphere isolate genomes. Further, growth phenotypes such as phosphate solubilization, protease activity, denitrification and root growth promotion are biased towards endosphere isolates. Endosphere isolates have significantly more metabolic pathways for plant signaling compounds and an increased metabolic range that includes utilization of energy rich nucleotides and sugars, consistent with endosphere colonization. Rhizosphere P. fluorescens have fewer pathways representative of plant-bacterial interactions but show metabolic bias towards chemical substrates often found in root exudates. This work reveals the diverse functions that may contribute to colonization of the endosphere by bacteria and are enriched among closely related isolates.

  9. OVER- EXPRESSION OF AN AUX1 HOMOLOG TRIGGERS OVARY INITIATION IN VITRO OF POPULUS TOMENTOSA CARR.

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    PtAUX1, an ortholog of Arabidopsis AtAUX1 ( encoding auxin influx carrier protein), has been cloned from Populus tomentosa. PtAUX1 protein is similar to Arabidopsis AtAUX1 in structure, but PtAUX1 contains an additional cAMP/cGMP - dependent protein kinase phosphorylation site. Its overexpression lines driven by 35S promoter exhibits a novel phenotype related flower development which has not been revealed in AtAUX1 mutants. Ovary - like structures each with 1 ~ 2 styles, but without a cup - like disc and a bract, can initial from regenerated transgenic bud in cluster,resembling an inflorescence. The histological dissections illuminate that the ovary - like structures have womb and transmitting tissue inner its styles, but no ovules. PtAUX1 expression pattern are ubiquitous and various in different organs,which is coincident with its candidate auxin influx, functioning in distributing auxin thorough a plant body. These results suggest that PtAUX1 or polar auxin transport has a substantial function in floral organ initiation.

  10. Characteristics and dynamics analysis of Populus euphratica populations in the middle reaches of Tarim River

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Populus euphratica Oliv. is widely distributed along the Tarim River. Maintaining stability of P. euphratica population is important to local development. This study explored the static life table, survivorship curves and four function curves (survival rate, cumulative mortality rate, mortality density, and hazard rate), and development index of P. euphratica population in the middle reaches of Tarim River. The results indicated that the age structure of P. euphratica population belonged to positive pyramidal type, which meant young age-class individuals occupied most populations. The number ofⅠ-Ⅱage classes accounted for 66.2% of whole population, and this indicated that there were abundant subsequent seedlings resources to support the growth of P. euphratica population in the middle reaches of Tarim River. The survivorship curve of P. euphratica belonged to the Deevey Ⅲ (concave-type) and the development index was 47.72%. Four function curves revealed that the individuals of P. euphratica sharply decreased at the initial stage and then leveled off at the late stage of survival curve. Time sequence prediction models predicted that the number of midlife individuals would increase in future 10, 20, 30 years, and P. euphratica population grew steadily as a result of rich saplings.

  11. Biochemical and Physiological Studies on the Effects of Senescence Leaves of Populus deltoides on Triticum vulgare

    Directory of Open Access Journals (Sweden)

    Tejinder Pal Khaket

    2014-01-01

    Full Text Available Triticum vulgare (Wheat based products are the major dietary source of food in developing countries. In India, it grows in association with boundary plantations of Populus deltoids (poplar. During winter, poplar enters in dormancy which cause a heavy leaf fall at the time of wheat seed germination. Large number of poplar senescence leaves may adversely affect the wheat. Therefore, the present study was performed to examine the effect of senescence poplar leaves on wheat germ and some other biochemical parameters. Seed’s germination rate was determined by measuring root and shoot lengths, percent germination, germination index, and inhibition percentage. Biochemical parameters, namely, pigment, carbohydrate, protein, and phenol content, were estimated. Activities of catalase and polyphenol oxidase which are stress marker enzymes were also measured. Results revealed that germination and other biochemical parameters of wheat were severely affected by senescence poplar leaves even at very low concentration. So, intercropping of poplar along with wheat may be chosen carefully as wheat is the major dietary staple.

  12. Description of Acinetobacter populi sp. nov. isolated from symptomatic bark of Populus x euramericana canker.

    Science.gov (United States)

    Li, Yong; Chang, Jupu; Guo, Li-min; Wang, Hai-Ming; Xie, Shou-jiang; Piao, Chun-gen; He, Wei

    2015-12-01

    Five Gram-negative, non-motile, rod-shaped bacterial strains were isolated from cankers of Populus x euramericana collected from different locations in Puyang city, Henan Province, China. The five strains were characterized by nutritional and physiological testing and DNA sequence analysis. Haemolysis was not observed on agar media supplemented with sheep erythrocytes. The strains could be distinguished from members of most species of the genus Acinetobacter by their inability to assimilate L-arginine and benzoate. The five strains formed a single branch in phylogenetic trees based on 16S rRNA, gyrB and rpoB individual gene sequence analysis,indicating that they all belonged to a single taxon within the genus Acinetobacter. DNA-DNA hybridization results indicated that the five isolates represented to a single species that was separate from Acinetobacter puyangensis. On the basis of the phenotypic, genotypic and phylogenetic characteristics, the five strains are considered to represent a novel species of the genus Acinetobacter, for which the name Acinetobacter populi sp. nov. is proposed. The typestrain of A. populi sp. nov. is PBJ7T (CFCC 11170T=KCTC 42272T).

  13. In vitro shoot regeneration from leaf mesophyll protoplasts of hybrid poplar (Populus nigra x P. maximowiczii).

    Science.gov (United States)

    Park, Y G; Son, S H

    1992-02-01

    Protoplasts were isolated from leaf mesophyll of hybrid poplar (Populus nigra X P. maximowiczii) with a mean yield of 10.4 x 10(6) protoplasts per g fresh weight using 2.0% Cellulase 'Onozuka' R-10, 0.8% Macerozyme R-10, 1.2% Hemicellulase, 2.0% Driselase, and 0.05% Pectolyase Y-23 with CPW salts solution containing 0.6 M mannitol, 0.002 M DTT, 3 mM MES at pH 5.6. A liquid plating method produced the highest frequency of dividing protoplasts (48.6%) using an MS medium without NH4NO3. The highest percent of colony formation was 22.8%, produced with fabric supported semi-solid (0.5% w/v) agar plating method using the same culture medium. Growing cell colonies and/or micro-calli were transferred to a fresh semisolid agar medium containing 0.44 μM BAP and 9.0 μM 2,4-D. Multiple shoots were produced from protoplast-derived callus after culture on MS medium containing 6.8 μM zeatin. After root induction on half-strength MS medium that lacked growth regulators, shoots were transferred to pots containing artificial soil mix.

  14. Identification and characterization of CBF/DREB1-related genes in Populus hopeiensis

    Institute of Scientific and Technical Information of China (English)

    WANG Ze-liang; AN Xin-min; LI Bo; REN Yuan-yuan; JIANG Xi-bing; BO Wen-hao; ZHANG Zhi-yi

    2008-01-01

    The dehydration-responsive element-binding factor (DREB) is a plant-specific family of transcription factors and plays an important role in plant response and adaptation to abiotic stress. In the present work, two highly similar CBF/DREBl-like genes, designated as PhCBF4a and PhCBF4b, were identified from Populus hopeiensis. These two genes contain all conserved domains known to exist in other CBF/DREBI genes. In the AP2 domain, there is only one different amino acid residue between PhCBF4a and PhCBF4b, alanine or valine, a nonpolar amino acid, suggesting that PhCBF4a and PhCBF4b may have similar DNA binding ability. Their expression is induced by water-loss treatment and their expression patterns axe similar. Moreover, with a genomic DNA as template, the presence of the same bands in PCR products as those in expression pattern analysis indicated that PhCBF4a and PhCBF4b exist in the genome of P. hopeiensis. Their detailed functions are discussed and will need further study.

  15. Differential transcriptome analysis between Populus and its synthesized allotriploids driven by second-division restitution.

    Science.gov (United States)

    Cheng, Shiping; Huang, Zhen; Li, Yun; Liao, Ting; Suo, Yujing; Zhang, Pingdong; Wang, Jun; Kang, Xiangyang

    2015-12-01

    In this report, we compared transcriptomic differences between a synthetic Populus section Tacamahaca triploid driven by second-division restitution and its parents using a high-throughput RNA-seq method. A total of 4,080 genes were differentially expressed between the high-growth vigor allotriploids (SDR-H) and their parents, and 719 genes were non-additively expressed in SDR-H. Differences in gene expression between the allotriploid and male parent were more significant than those between the allotriploid and female parent, which may be caused by maternal effects. We observed 3,559 differentially expressed genes (DEGs) between the SDR-H and male parent. Notably, the genes were mainly involved in metabolic process, cell proliferation, DNA methylation, cell division, and meristem and developmental growth. Among the 1,056 DEGs between SDR-H and female parent, many genes were associated with metabolic process and carbon utilization. In addition, 1,789 DEGs between high- and low-growth vigor allotriploid were mainly associated with metabolic process, auxin poplar transport, and regulation of meristem growth. Our results indicated that the higher poplar ploidy level can generate extensive transcriptomic diversity compared with its parents. Overall, these results increased our understanding of the driving force for phenotypic variation and adaptation in allopolyploids driven by second-division restitution.

  16. Hydrological Response of Populus euphratica Olve. Radial Growth in Ejinaa Banner, Inner Mongolia

    Institute of Scientific and Technical Information of China (English)

    Pu-Xing Liu; Jian-Feng Peng; Fa-Hu Chen

    2007-01-01

    Populus euphratica Olve. is a dominant tree species in Ejinaa Oasis of the lower reaches of the Helhe River, Inner Mongolia, China. In recent years, the population of this species has shown signs of degradation that are suggested to be probably associated with the decrease of surface water. In this study, the history of river runoff In this region was examined with a dendrochronological study of P. euphratica from four sites. it is found that tree-ring widths in the all sites have negative correlation with runoffs of all months at the Zhengyixia hydrological station. Principal component (PC) analysis of the tree-ring chronologies shows that the first PC (PC1) accounts for 49.98% of the total variances. The first PC is found to have a significantly negative correlation with runoffs In March and April (-0.52 and- 0.43, respectively, P<0.05). This negative correlation might be related to varlatlons In the depth of underground water.

  17. Thermo-mechanical Densification of Populus tomentosa var. tomentosa with Low Moisture Content

    Directory of Open Access Journals (Sweden)

    Dengyun Tu

    2014-05-01

    Full Text Available This study used thermo-mechanical densification technology to compress low-moisture content (3~5% rapid-growth Populus tomentosa var. tomentosa trees to produce specimens with a low-compression ratio (small volume loss and a uniform density profile and desirable properties. Furthermore, the densified specimens were subjected to post-heat treatment at 180, 190, and 200 °C for 2, 3, and 4 h, respectively. Microscopic examination was performed to observe the changes that occurred in the wood vessels after densification. To determine the influence of post-heat treatment on the set recovery, the specimens were subjected to eight cycles of soaking and drying in 20 °C water and two cycles in boiling water. The density profile tendencies of the densified specimens were in accord with undensified specimens. Microscopic observation revealed that the deformations present in the densified wood resulted from the viscous buckling of cell walls without fracture. The volume of the void areas in the specimens decreased uniformly. Post-heat treatment can decrease compressive deformation, especially when applied at 200 °C for 4 h. After two boiling water cycles of soaking and drying, the densified wood still had a certain set recovery. Therefore, densified wood should be used sparingly in high temperature and high humidity environments.

  18. Expression analysis of a Na~+/H~+ antiporter gene PeNHX1 from Populus euphratica

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Na+/H+ antiporters play an important role in the salt tolerance of a wide variety of plants.Using the rapid amplification of cDNA ends method,a Na+/H+ antiporter gene (PeNHX1) was isolated from Populus euphratica.The deduced amino acid sequence contained 528 amino acid residues with a conserved amiloride-binding domain (77LFFIYLLPPI86) and shared more than 68% identity with that of AtNHX1 from Arabidopsis thaliana.PeNHX1 can confer resistance to Na+,as well as Li+,to (EP432) an Escherichia coli strain deficient in both nhaA and nhaB,thus proving that it is a functional Na+/H+ antiporter.PeNHX1 expression profile in EP432 reflected pH independent manner.PeNHX1 expression was regulated by salt at the transcriptional level.Meanwhile,results demonstrated that transcripts of PeNHX1 in P.euphratica calli showed a salt dependent response,and thus provide a valuable tool for studying signaling and biochemical pathways involved in salt recognition and response in P.euphratica.

  19. Isolation and characterization of two genes encoding polygalacturonase-inhibiting protein from Populus deltoides

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Polygalacturonase-inhibiting proteins (PGIPs) are extracellular proteins that belong to the leucine-rich repeat (LRR) protein superfamily. PGIPs inhibit fungal polygalacturonases (PGs) and promote accumulation of oligogalacturonides, which activate plant defense responses. PGIPs play important roles in resistance to infection of pathogens. In this study, reverse transcriptase-polymerase chain reaction (RT-PCR) and RNA ligase-mediated rapid amplification of cDNA ends (RLM-RACE) were used to isolate the full-length PGIP cDNA from Populus deltoides (GenBank accession no. Of PdPGIP2 and PdPGIP4:EF684913 and EF684912). Domain analysis revealed that the deduced amino acid sequences of PdPGIP2 and PdPGIP4 had a typical POIP topology. Phylogenetic analysis of known PGIPs indicated that the two PdPGIPs were clustered to the defense-related PGIP clade. Using real-time RT-PCR, the expression patterns of the two PdPGIPs following treatment with a fungal pathogen and defense-related signaling molecules were studied. The expression levels of PdPGIP2 and PdPGIP4 were both up-regulated when inoculated with the phytopathogenic fungus Marssonina brunnea. Therefore, it was proposed that the two PGIPs might be involved in the resistance to Marssonina brunnea in P. Deltoides.

  20. Genic diversity of natural populations of a clone-forming tree Populus tremuloides

    Energy Technology Data Exchange (ETDEWEB)

    Cheliak, W.M.; Dancik, B.P.

    1982-01-01

    Effects of asexual reproduction as a primary reproductive strategy on population structure and levels of variability were investigated electrophoretically in natural populations of a woody plant species, trembling aspen (Populus tremuloides Michx.). from Alberta. As expected, levels of genic diversity, 42%, and proportion of polymorphic loci, 92%, averaged over all clones are considerably greater than those reported for comparable samples of sexually reproducing plant and animal species. These measures of genic variability of a primary asexual plant species are similar to those reported for asexual species of insects, fish and bacteria. In addition, each of 222 clones was electrophoretically unique. Since neutral theory would predict each individual clone to be heterozygous for a unique mutation at each gene locus at equilibrium, these results can be interpreted in a number of ways: (i) insufficient time to reach equilibrium, (ii) inability of electrophoresis to detect all variation at a locus, (iii) periodic establishment of sexually derived propagules in the population, and (iv) selection for similar genotypes at each location or against mutations at particular gene loci. Re-invasion of Pleistocene-glaciated areas by trembling aspen was likely by sexual means, with subsequent reproduction being primarily asexual. (Refs. 26)

  1. Assessment of Rhizospheric Microorganisms of Transgenic Populus tomentosa with Cowpea Trypsin Inhibitor (CpTI) Gene

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    To have a preliminary insight into biosafety of genetically transformed hybrid triploid poplars (Populus tomentosa × P. bolleana) × P. tomentosa with the cowpea trypsin inhibitor (CpTI) gene, two layers of rhizospheric soil (from 0 to 20 cm deep and from 20 to 40 cm deep, respectively) were collected for microorganism culture, counting assay and PCR analysis to assess the potential impact of transgenic poplars on non-target microorganism population and transgene dispersal. When the same soil layer of suspension stock solution was diluted at both 1:1 000 and 1:10 000 rates, there were no significant differences in bacterium colony numbers between the inoculation plates of both transgenic and non-transgenic poplars. The uniform results were revealed for both soil layer suspension solutions of identical poplars at both dilution rates except for non-transgenic poplars at 1:10 000 dilution rates from the same type of soil. No significant variation in morphology of both Gram-positive and Gram-negative bacteria was observed under the microscope. The potential transgene dispersal from root exudates or fallen leaves to non-target microbes was repudiated by PCR analysis, in which no CpTI gene specific DNA band was amplified for 15 sites of transgenic rhizospheric soil samples. It can be concluded that transgenic poplar with the CpTI gene has no severe impact on rhizospheric microorganisms and is tentatively safe to surrounding soil micro-ecosystem.

  2. Different Proteome Profiles between Male and Female Populus cathayana Exposed to UV-B Radiation

    Science.gov (United States)

    Zhang, Yunxiang; Feng, Lihua; Jiang, Hao; Zhang, Yuanbin; Zhang, Sheng

    2017-01-01

    With increasing altitude, solar UV-B radiation is enhanced. Based on the phenomenon of male-biased sex ratio of Populus cathayana Rehder in high altitude alpine area, we hypothesized that males have a faster and more sophisticated responsive mechanism to high UV-B radiation than that of females. Our previous studies have shown sexually different responses to high UV-B radiation were existed in P. cathayana at the morphological, physiological, and transcriptomic levels. However, the responses at the proteomic level remain unclear. In this study, an isobaric tag for relative and absolute quantification (iTRAQ)-based quantitative proteome analysis was performed in P. cathayana females and males. A total of 2,405 proteins were identified, with 331 proteins defined as differentially expressed proteins (DEPs). Among of these, 79 and 138 DEPs were decreased and 47 and 107 DEPs were increased under high solar UV-B radiation in females and males, respectively. A bioinformatics analysis categorized the common responsive proteins in the sexes as related to carbohydrate and energy metabolism, translation/transcription/post-transcriptional modification, photosynthesis, and redox reactions. The responsive proteins that showed differences in sex were mainly those involved in amino acid metabolism, stress response, and translation/transcription/post-transcriptional modification. This study provides proteomic profiles that poplars responding to solar UV-B radiation, and it also provides new insights into differentially sex-related responses to UV-B radiation.

  3. Comparison of stomatal characteristics and photosynthesis of polymorphic Populus euphratica leaves

    Institute of Scientific and Technical Information of China (English)

    ZHENG Caixia; QIU Jian; JIANG Chunning; YUE Ning; WANG Xiuqin; WANG Wanfu

    2007-01-01

    The leaf shapes of adult Populus euphratica vary from lanceolate to dentate broad-ovate.In order to find the mechanism regarding the ecological adaptation of the polymorphic leaves,the dentate broad-ovate,broad-ovate,and lanceolate leaves were chosen to study their stomatal and photosynthetic characteristics.It is observed that the stomas on the adaxial and abaxial epidermis of the same leaves open non-uniformly with similar densities.The stomatal densities are different among the three typical leaves,which decrease from broad-ovate to lanceolate leaves.Their stomatal sunken degree varied obviously,decreasing from broad-ovate to lanceolate leaves.The changes of the diurnal photosynthetic rate of the three typical leaves follow a single peak curve.The mean diurnal photosynthetic rates of these leaves rank from high to low as broad-ovate>dentate broad-ovate>lanceolate leaves.The light compensation points are similar in the three typical leaves,while the light saturation points vary obviously.The efficiency of solar energy conversion and potential activity of the PSⅡ in the leaves differ significantly,with the dentate broad-ovate leaves the highest.The results suggest that their leaf shapes,anatomic structures,and photosynthetic characteristics change during the leaf development.

  4. Variations in wood anatomical properties and specific gravity of half sib progenies of Populus deltoides

    Institute of Scientific and Technical Information of China (English)

    P. K. Pande; R. C. Dhiman

    2012-01-01

    We studied radial and inter-progeny variations in the dimensions of the wood elements and specific gravity of 21 half sib progenies of Populus deltoides Bartr.ex Marsh.The female parents of half sib progenies were G48 and S7C13 clones.Variance ratio (F) test indicated that inter-progeny variations in the dimensions of wood elements and specific gravity were significant for all wood traits while variations were significant for radial location for specific gravity only.Hierarchical cluster analysis was done by Squared Euclidean Distance for all of 21 progenies considering six wood traits.21 progenies were grouped into 4 clusters.Cluster 1 was the largest cluster with 11 progenies,whereas cluster 3 had only one progeny.Selected progenies in dusters 3 (progeny 155,male) and 4 (progeny 108,196,both female) were highly divergent from the other progenies so they were used in combinations as parents of hybrids to develop new clones with desired characters.Progeny 155 showed higher growth,fiber dimensions,and specific gravity,thus,should be used for the development of new clones.

  5. Epidermal Micromorphology and Mesophyll Structure of Populus euphratica Heteromorphic Leaves at Different Development Stages.

    Science.gov (United States)

    Liu, Yubing; Li, Xinrong; Chen, Guoxiong; Li, Mengmeng; Liu, Meiling; Liu, Dan

    2015-01-01

    Leaf epidermal micromorphology and mesophyll structure during the development of Populus euphratica heteromorphic leaves, including linear, lanceolate, ovate, dentate ovate, dentate rhombic, dentate broad-ovate and dentate fan-shaped leaves, were studied by using electron and light microscopy. During development of heteromorphic leaves, epidermal appendages (wax crystals and trichomes) and special cells (mucilage cells and crystal idioblasts) increased in all leaf types while chloroplast ultrastructure and stomatal characters show maximum photosynthetic activity in dentate ovate and rhombic leaves. Also, functional analysis by subordinate function values shows that the maximum adaptability to adverse stress was exhibited in the broad type of mature leaves. The 12 heteromorphic leaf types are classified into three major groups by hierarchical cluster analysis: young, developing and mature leaves. Mature leaves can effectively obtain the highest stress resistance by combining the protection of xerophytic anatomy from drought stress, regulation of water uptake in micro-environment by mucilage and crystal idioblasts, and assistant defense of transpiration reduction through leaf epidermal appendages, which improves photosynthetic activity under arid desert conditions. Our data confirms that the main leaf function is differentiated during the developing process of heteromorphic leaves.

  6. Construction of a bidirectional promoter and its transient expression in Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    Chunxiao ZHANG; Ying GAI; Yanyan ZHU; Xuemei CHEN; Xiangning JIANG

    2008-01-01

    Simultaneous introduction of multiple genes into plants is a critical step in plant genetic engineering to manipulate multiple functional genes in metabolic engineering and trait stacking. It is important to construct a bidirectional promoter for transforming two or more genes into plants simultaneously. The widely used unidirectional CaMV35S promoter has been mod-ified to a bidirectional promoter in this work by fusing a CaMV35S minimal promoter (Pmini) at its end in opposite orientation to the original promoter. To test its bi-directional transcriptional activities, two widely used histochemically visible reporter genes, gusA (β-glucuronidase) from Escherichia coli and gfp (Green Fluorescent Protein) from Aequorea victoria, were fused to the terminus of the bidirectional promoter in different orientations ending with NOS terminator sequences. The transient expression of the gusA and gfp genes were detected by histochemical staining for GUS and by fluorescence microscopy for GFP. The direction of transient expression of GUS and GFP in Agro-bacterium mediated 3-4 days transformed leaf discs of Populus tomentosa, indicating that the promoter did have bidirectional transcriptional activities simultaneously in cells and tissues. It was discussed that this bidirectional promoter could possibly be applied in woody plant engineering.

  7. Improvement in salt tolerance of Populus tomentosa from transformation by a mtl-D gene

    Institute of Scientific and Technical Information of China (English)

    Li Min; Wang Hua-fang; Yin Wei-lun; He Si-jie; Chen Shou-yi

    2006-01-01

    Transgenic lines were achieved by transforming the E. coli 1-phosphate mannitol dehydrogenase gene (mtl-D) into the Populus tomentosa Carr. genome. An Agrobacterium tumefaciens strain (AGL1), constructed by cloning mtl-D into the disarmed plasmid pBin438, was used to infect leaves of the clone YW2. The infected leaf discs were cultured on a medium containing 30mg·L-1 kanamycin and 500 mg·L-1 cefotaxime. Transgenic plantlets regenerated from the infected leaves, rooted on the medium containing 30 mg·L-1 kanamycin. PCR and a Southern blotting test verified that the exogenous mtl-D gene had integrated into the transformation plants of the P. tomentosa genome. The mannitol content in control plant was 69 μg·g-1 FW, and the mannitol contents of the transgenic lines T1 to T5 ranged between 103.7 and 289.5 μg·g-1 FW. Of the shoots of the control plants 20% survived; on the medium containing 0.6% NaCl, 60% and 70% of two transgenic shoots survived on a medium containing 0.8% NaCl.

  8. Relations between continuous real-time turbidity data and discrete suspended-sediment concentration samples in the Neosho and Cottonwood Rivers, east-central Kansas, 2009-2012

    Science.gov (United States)

    Foster, Guy M.

    2014-01-01

    The Neosho River and its primary tributary, the Cottonwood River, are the primary sources of inflow to the John Redmond Reservoir in east-central Kansas. Sedimentation rate in the John Redmond Reservoir was estimated as 743 acre-feet per year for 1964–2006. This estimated sedimentation rate is more than 80 percent larger than the projected design sedimentation rate of 404 acre-feet per year, and resulted in a loss of 40 percent of the conservation pool since its construction in 1964. To reduce sediment input into the reservoir, the Kansas Water Office implemented stream bank stabilization techniques along an 8.3 mile reach of the Neosho River during 2010 through 2011. The U.S. Geological Survey, in cooperation with the Kansas Water Office and funded in part through the Kansas State Water Plan Fund, operated continuous real-time water-quality monitors upstream and downstream from stream bank stabilization efforts before, during, and after construction. Continuously measured water-quality properties include streamflow, specific conductance, water temperature, and turbidity. Discrete sediment samples were collected from June 2009 through September 2012 and analyzed for suspended-sediment concentration (SSC), percentage of sediments less than 63 micrometers (sand-fine break), and loss of material on ignition (analogous to amount of organic matter). Regression models were developed to establish relations between discretely measured SSC samples, and turbidity or streamflow to estimate continuously SSC. Continuous water-quality monitors represented between 96 and 99 percent of the cross-sectional variability for turbidity, and had slopes between 0.91 and 0.98. Because consistent bias was not observed, values from continuous water-quality monitors were considered representative of stream conditions. On average, turbidity-based SSC models explained 96 percent of the variance in SSC. Streamflow-based regressions explained 53 to 60 percent of the variance. Mean squared

  9. A genomics investigation of partitioning into and among flavonoid-derived condensed tannins for carbon sequestration in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Harding, Scott, A; Tsai, Chung-jui; Lindroth, Richard, L

    2013-03-24

    The project set out to use comparative (genotype and treatment) and transgenic approaches to investigate the determinants of condensed tannin (CT) accrual and chemical variability in Populus. CT type and amount are thought to effect the decomposition of plant detritus in the soil, and thereby the sequestering of carbon in the soil. The stated objectives were: 1. Genome-wide transcriptome profiling (microarrays) to analyze structural gene, transcription factor and metabolite control of CT partitioning; 2. Transcriptomic (microarray) and chemical analysis of ontogenetic effects on CT and PG partitioning; and 3. Transgenic manipulation of flavonoid biosynthetic pathway genes to modify the control of CT composition. Objective 1: A number of approaches for perturbing CT content and chemistry were tested in Objective 1, and those included nitrogen deficit, leaf wounding, drought, and salicylic acid spraying. Drought had little effect on CTs in the genotypes we used. Plants exhibited unpredictability in their response to salicylic acid spraying, leading us to abandon its use. Reduced plant nitrogen status and leaf wounding caused reproducible and magnitudinally striking increases in leaf CT content. Microarray submissions to NCBI from those experiments are the following: GSE ID 14515: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 1979. Public on Jan 04, 2010; Contributor(s) Harding SA, Tsai C GSE ID 14893: Comparative transcriptomics analysis of Populus leaves under nitrogen limitation: clone 3200. Public on Feb 19, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16783 Wound-induced gene expression changes in Populus: 1 week; clone RM5. Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C GSE ID 16785 Wound-induced gene expression changes in Populus: 90 hours; clone RM5 Status Public on Dec 01, 2009; Contributor(s) Harding SA, Tsai C Although CT amount changed in response to treatments, CT composition was essentially

  10. Geochemical peculiarities of black poplar leaves (Populus nigra L.) in the sites with heavy metals intensive fallouts

    Science.gov (United States)

    Yalaltdinova, Albina; Baranovskaya, Natalya; Rikhvanov, Leonid; Matveenko, Irina

    2013-04-01

    The article deals with the content of 28 chemical elements in the leaves ash of black poplar (Populus nigra L.) growing in Ust-Kamenogorsk city area. It is the major industrial center of Kazakhstan Republic on the territory where the industrial giants of non-ferrous metallurgy and nuclear energy are situated. Comparative analysis with the similar data obtained from leaves ash of Populus nigra L. in Tomsk, Ekibastuz, and Pavlodar cities has revealed that in comparison with other urban areas, leaves ash of black poplar (Populus nigra L.) from Ust-Kamenogorsk city is characterized by elevated concentration rates of Ta, U, Zn, Ag, As, Sb, Br, Sr and Na. Within the city, the sites and areas with abnormal contents of typomorphic pollutants have been revealed. In the central part of the city, in the vicinity of lead-zinc plant and Ulba metallurgical plant, the highest concentrations of Ta, U, Zn, Ag, Au, As, Sb, Cr and Fe were marked. In the northeast, where the titanium-magnesium plant is located, elevated concentrations of Br and Sr were stated. Thus, the impact of major city enterprises which are the main sources of heavy metals is reflected in the element composition. Zn, As, Sb, Ag and Au comes from lead-zinc plant and its refinery plants, while Ulba metallurgical plant can be considered source of Ta and U in the environment, producing tantalum and fuel pellets for nuclear power plants. These companies, due to the current objective circumstances, are located in the central part of the city, have a significant negative effect on the environment and form the risk factors for human health.

  11. Industrial robustness: understanding the mechanism of tolerance for the Populus hydrolysate-tolerant mutant strain of Clostridium thermocellum.

    Directory of Open Access Journals (Sweden)

    Jessica L Linville

    Full Text Available BACKGROUND: An industrially robust microorganism that can efficiently degrade and convert lignocellulosic biomass into ethanol and next-generation fuels is required to economically produce future sustainable liquid transportation fuels. The anaerobic, thermophilic, cellulolytic bacterium Clostridium thermocellum is a candidate microorganism for such conversions but it, like many bacteria, is sensitive to potential toxic inhibitors developed in the liquid hydrolysate produced during biomass processing. Microbial processes leading to tolerance of these inhibitory compounds found in the pretreated biomass hydrolysate are likely complex and involve multiple genes. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we developed a 17.5% v/v Populus hydrolysate tolerant mutant strain of C. thermocellum by directed evolution. The genome of the wild type strain, six intermediate population samples and seven single colony isolates were sequenced to elucidate the mechanism of tolerance. Analysis of the 224 putative mutations revealed 73 high confidence mutations. A longitudinal analysis of the intermediate population samples, a pan-genomic analysis of the isolates, and a hotspot analysis revealed 24 core genes common to all seven isolates and 8 hotspots. Genetic mutations were matched with the observed phenotype through comparison of RNA expression levels during fermentation by the wild type strain and mutant isolate 6 in various concentrations of Populus hydrolysate (0%, 10%, and 17.5% v/v. CONCLUSION/SIGNIFICANCE: The findings suggest that there are multiple mutations responsible for the Populus hydrolysate tolerant phenotype resulting in several simultaneous mechanisms of action, including increases in cellular repair, and altered energy metabolism. To date, this study provides the most comprehensive elucidation of the mechanism of tolerance to a pretreated biomass hydrolysate by C. thermocellum. These findings make important contributions to the

  12. CHANGES OF CUTICLE SURFACE LIPIDS OF POPULUS ITALICA AND BETULA PENDULA CAUSED BY POLLUTION

    Directory of Open Access Journals (Sweden)

    O. M. Zubrovskaya

    2014-08-01

    Full Text Available Arboreal plants intensively accumulate heavy metals, resulting in a corresponding revocation level of physiological processes. The lipid components operate an important role in the formation of plant resistance. Therefore, it was very important to determine the characteristics of lipid peroxidation flow in leaves of arboreal plants, and changes in the composition of cuticle surface lipids at different levels of heavy metal accumulation. Research objects were Populus italica (Du Roi Moench and Betula pendula Roth. of second age group, growing on the industrial site РJSC ‘Kryvyi Rig Factory of minium’ (with strong contamination and in the arboretum of Kryvyi Rig Botanic Garden, National Academy of Science of Ukraine (conventional control. Leaves were taken from the middle of the crown southwest exposure in phase of leaf full separation and 5-10 day of phase finishing point of their growth. It was shown that P. italica maximally accumulated zinc, content of which was increased in the phase of leaf full separation and on 5-10 day of phase of leaf growth finishing point relative to the control to 12,6 and 23 times respectively. The accumulation level of heavy metals was typically less significant for assimilation organs of B. pendula compared to P. italica. Thus, the content of zinc and lead in the leaves during the study increased only in 2 times towards control. The leaves of B. pendula, unlike P. italica, more intensively accumulated cadmium in the phase of leaf full separation and on 5-10 day of phase finishing point of their growth (it was 6 and 15 times higher relative to control respectively. It was obviously connected to the fact that the surface texture of poplar leaves may cause intense sticking of dust particles containing heavy metals and penetration into the leaves. The effect of heavy metals in both phases of leaf morphogenesis caused an increase in lipid peroxidation by 40-52% for P. italica and almost by 3 times for B

  13. Isolation of protoplast from callus of Populus euphratica and H+ fluxes across plasma membrane under NaCl stress

    Institute of Scientific and Technical Information of China (English)

    Gao Zhun; Dai Song-xiang; Chen Shao-liang; Shen Xin; Wang Rui-gang

    2007-01-01

    We used callus of Populus euphratica Olive to isolate protoplasts, and H+ fluxes across plasma membrane were investigated. The concentration of enzymes for protoplast isolation, e.g. cellulase, pectolyase, macerozyme, hemicellulase, and sorbitol content, incubation time were systemically studied. High yield and viability of protoplast was achieved after 6-8 hours incubation of P. euphratica callus in enzyme solution containing 1.5% (w:v) cellulase R-10, 0.1% (w:v) pectolyase Y-23, 0.2% (w:v) macerozyme membrane of P. euphratica cells. The shift of H+ flux response to NaCl shock and the relevance to salt tolerance were discussed.

  14. Spatio-temporal variations of functional groups in a Populus nigra L. entomocenosis in the Mitidja plain (Algeria).

    Science.gov (United States)

    Djazouli, Zahr-Eddine; Doumandji-Mitiche, Bahia; Petit, Daniel

    2009-09-01

    This study presents the first data describing the communities of insects and arachnida colonizing 4 aerial compartments of Populus nigra. In terms of temporal variation and total abundance, the analyses show that the communities are structurally and functionally different. It also appears that the taxonomic richness of the communities, and partly their temporal distribution, change according to the gradient of the energy and defense resources under the effect of seasonal variations. The highest species richness recorded on the leaves compartment is due to the amplitude of histo-physiological modifications observed throughout the growing season.

  15. Energy dynamics in Populus deltoides G{sub 3} Marsh agroforestry systems in eastern India

    Energy Technology Data Exchange (ETDEWEB)

    Chaturvedi, O.P. [National Research Centre for Agroforestry, Jhansi (India); Das, D.K. [Rajendra Agricultural Univ., Dept. of Forestry, Bihar (India)

    2005-08-01

    Energy efficiency of Populus deltoides G{sub 3} Marsh agroforestry of a 3-year-old system with intercropping of maize-wheat in crop I and pigeonpea in crop II and of a 9-year-old system with turmeric, a shade loving crop was studied at Pusa, Bihar in eastern India. Energy fixation, storage, net allocation in agronomic yield and energy released and exit from the 9-year-old system was 1.53, 4.30, 0.43 and 3.37 times in crop I and 1.67, 4.60, 0.53 and 3.30 times in crop II of the 3-year-old agroforestry system. The energy conservation efficiency in the 9-year-old system was higher (1.91%) as compared to crop I (1.24%) and crop II (1.15%) of the 3-year-old agroforestry system. The energy accumulation ratio in the 9-year-old system was 2.82 and 2.77 times higher in crop I and crop II, respectively, of the 3-year-old agroforestry system. The 3-year-old agroforestry system showed lower energy accumulation ratio resulting from less energy accumulation in perennial turnover in the form of leaf of tree and agricultural crops. The crop II system of the 3-year-old poplar agroforestry was more efficient system of management due to higher quanta of energy and higher cash return but one has to opt for shade loving intercrop turmeric with increase in age of the poplar plantation and more canopy closure. (Author)

  16. Sex-specific responses of Populus yunnanensis exposed to elevated CO{sub 2} and salinity

    Energy Technology Data Exchange (ETDEWEB)

    Ling Li; Yuanbin Zhang; Chunyang Li [Chinese Academy of Sciences. Chengdu Institute of Biology, Chengdu (Switzerland); Jianxun Luo, Sichuan Academy of Forestry, Chengdu (Switzerland)); Korpelainen, H. [Univ. of Helsinki. Dept. of Agricultural Sciences, Helsinki (Finland)

    2013-04-15

    Populus yunnanensis Dode., a native dioecious woody plant in southwestern China, was employed as a model species to study sex-specific morphological, physiological and biochemical responses to elevated CO{sub 2} and salinity. To investigate the effects of elevated CO{sub 2}, salinity and their combination, the cuttings were exposed to two CO{sub 2} regimes (ambient CO{sub 2} and double ambient CO{sub 2}) and two salt treatments in growth chambers. Males exhibited greater downregulation of net photosynthesis rate (A{sub net}) and carboxylation efficiency (CE) than females at elevated CO{sub 2}, whereas these sexual differences were lessened under salt stress. On the other hand, salinity induced a higher decrease in Anet and CE, more growth inhibition and leaf Cl{sup -} accumulation and more damage to cell organelles in females than in males, whereas the sexual differences in photosynthesis and growth were lessened at elevated CO{sub 2}. Moreover, elevated CO{sub 2} exacerbated membrane lipid peroxidation and organelle damage in females but not in males under salt stress. Our results indicated that: (1) females are more sensitive and suffer from greater negative effects than do males under salt stress, and elevated CO{sub 2} lessens the sexual differences in photosynthesis and growth under salt stress; (2) elevated CO{sub 2} tends to aggravate the negative effects of salinity in females; and (3) sex-specific reactions under the combination of elevated CO{sub 2} and salinity are distinct from single-stress responses. Therefore, these results provide evidence for different adaptive responses between plants of different sexes exposed to elevated CO{sub 2} and salinity. (Author)

  17. Effect of tree-crop intercropping on a young Populus tomentosa plantation

    Institute of Scientific and Technical Information of China (English)

    JIANG Yuezhong; QIN Guanghua

    2007-01-01

    In order to study the effect of tree crop intercropping on a young plantation ofPopulus tomentosa in the plains along the Yellow River,field experiments were conducted by observing the growth of the plantation,the nutrient content in leaves,the nutrient and water content in the soil,and the output of crops.The relationship between forest growth and nutrient content in the tree leaves and the soil were analyzed.Results show that tree crop intercropping in young plantations can not only improve soil water content,but also enhance the contents of organic matter and the available nitrogen,phosphorus and potassium in soil resulting in the vigorous growth of the individual trees.Diameter at breast height (DBH) was positively related to the contents of organic matter in the soil,and the contents of N,P and K in the tree leaves had correlation coefficients of 0.967,0.955,0.988 and 0.972,respectively.Whole tree leaf area,crown width,number of branches and the mean length of branches in the intercropped plantation (intercropped with watermelon and vegetables,peanut and winter wheat,and soybean) were,respectively,1.70-3.0 times,2.22-2.47 times,1.0-1.41 times and 1.70-2.32 times of those of CK (without intercropping).Diameter at breast height (DBH) and tree height in the intercropped plantation were 50.5%-136.7% and 27%-59.5% higher than those of the CK,respectively.The study also showed that intercropping with watermelon and vegetables proved to have the highest economic return among the treatments adopted.Tree crop intercropping in young plantations is an effective measure to increase forest growth and economic benefit.

  18. Genetic variations and miRNA-target interactions contribute to natural phenotypic variations in Populus.

    Science.gov (United States)

    Chen, Jinhui; Xie, Jianbo; Chen, Beibei; Quan, Mingyang; Li, Ying; Li, Bailian; Zhang, Deqiang

    2016-10-01

    Variation in regulatory factors, including microRNAs (miRNAs), contributes to variation in quantitative and complex traits. However, in plants, variants in miRNAs and their target genes that contribute to natural phenotypic variation, and the underlying regulatory networks, remain poorly characterized. We investigated the associations and interactions of single-nucleotide polymorphisms (SNPs) in miRNAs and their target genes with phenotypes in 435 individuals from a natural population of Populus. We used RNA-seq to identify 217 miRNAs differentially expressed in a tension wood system, and identified 1196 candidate target genes; degradome sequencing confirmed 60 of the target sites. In addition, 72 miRNA-target pairs showed significant co-expression. Gene ontology (GO) term analysis showed that most of the genes in the co-regulated pairs participate in biological regulation. Genome resequencing found 5383 common SNPs (frequency ≥ 0.05) in 139 miRNAs and 31 037 SNPs in 819 target genes. Single-SNP association analyses identified 232 significant associations between wood traits (P ≤ 0.05) and SNPs in 102 miRNAs and 1387 associations with 478 target genes. Among these, 102 miRNA-target pairs associated with the same traits. Multi-SNP associations found 102 epistatic pairs associated with traits. Furthermore, a reconstructed regulatory network contained 12 significantly co-expressed pairs, including eight miRNAs and nine targets associated with traits. Lastly, both expression and genetic association showed that miR156i, miR156j, miR396a and miR6445b were involved in the formation of tension wood. This study shows that variants in miRNAs and target genes contribute to natural phenotypic variation and annotated roles and interactions of miRNAs and their target genes by genetic association analysis. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  19. Diversification in the genetic architecture of gene expression and transcriptional networks in organ differentiation of Populus.

    Science.gov (United States)

    Drost, Derek R; Benedict, Catherine I; Berg, Arthur; Novaes, Evandro; Novaes, Carolina R D B; Yu, Qibin; Dervinis, Christopher; Maia, Jessica M; Yap, John; Miles, Brianna; Kirst, Matias

    2010-05-04

    A fundamental goal of systems biology is to identify genetic elements that contribute to complex phenotypes and to understand how they interact in networks predictive of system response to genetic variation. Few studies in plants have developed such networks, and none have examined their conservation among functionally specialized organs. Here we used genetical genomics in an interspecific hybrid population of the model hardwood plant Populus to uncover transcriptional networks in xylem, leaves, and roots. Pleiotropic eQTL hotspots were detected and used to construct coexpression networks a posteriori, for which regulators were predicted based on cis-acting expression regulation. Networks were shown to be enriched for groups of genes that function in biologically coherent processes and for cis-acting promoter motifs with known roles in regulating common groups of genes. When contrasted among xylem, leaves, and roots, transcriptional networks were frequently conserved in composition, but almost invariably regulated by different loci. Similarly, the genetic architecture of gene expression regulation is highly diversified among plant organs, with less than one-third of genes with eQTL detected in two organs being regulated by the same locus. However, colocalization in eQTL position increases to 50% when they are detected in all three organs, suggesting conservation in the genetic regulation is a function of ubiquitous expression. Genes conserved in their genetic regulation among all organs are primarily cis regulated (approximately 92%), whereas genes with eQTL in only one organ are largely trans regulated. Trans-acting regulation may therefore be the primary driver of differentiation in function between plant organs.

  20. Males exhibit competitive advantages over females of Populus deltoides under salinity stress.

    Science.gov (United States)

    Li, Yan; Duan, Baoli; Chen, Juan; Korpelainen, Helena; Niinemets, Ülo; Li, Chunyang

    2016-12-01

    Sexual competition among dioecious plants affects sex ratios and the spatial distribution of the sexes in different environments. At present, little is known about sexual dimorphisms induced by different competition patterns under salinity stress. We employed Populus deltoides as a model to investigate sex-related growth as well as physiological and biochemical responses to salinity stress under conditions of intrasexual and intersexual competition. Potted seedlings (two seedlings per pot; two females, two males, or one female and one male) were exposed to two salt levels (0 and 50 mM NaCl) and salinity- and competition-driven differences in growth, assimilation rate, water use, contents of leaf pigments and osmotica, hydrogen peroxide (H2O2), and antioxidant enzyme and nitrate reductase activity were examined. In the absence of salinity, no significant differences in competitive ability between males and females subjected to intrasexual competition were observed, although the growth of females was moderately greater under intersexual competition. The salinity treatment significantly increased the sex differences in competitive ability, especially under intersexual competition. Under salinity stress, males showed decreased height, but displayed greater capacity for osmotic adjustment, enhancement of long-term water-use efficiency and increase in antioxidant enzyme activities. The absolute values of these traits were greater in salt-stressed males than in females under intersexual competition. In addition, salt-stressed males accumulated less Cl(-) and had lower H2O2 contents than females. These data collectively demonstrate that the competitive advantage of females in non-stressed conditions is lost under salinity. Greater salinity resistance of males growing intermixed with females under salt stress can importantly affect the sex ratio of P. deltoides populations. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions

  1. A Novel Moderate Constitutive Promoter Derived from Poplar (Populus tomentosa Carrière

    Directory of Open Access Journals (Sweden)

    Xin-Min An

    2013-03-01

    Full Text Available A novel sequence that functions as a promoter element for moderate constitutive expression of transgenes, designated as the PtMCP promoter, was isolated from the woody perennial Populus tomentosa. The PtMCP promoter was fused to the GUS reporter gene to characterize its expression pattern in different species. In stable Arabidopsis transformants, transcripts of the GUS reporter gene could be detected by RT-PCR in the root, stem, leaf, flower and silique. Further histochemical and fluorometric GUS activity assays demonstrated that the promoter could direct transgene expression in all tissues and organs, including roots, stems, rosette leaves, cauline leaves and flowers of seedlings and maturing plants. Its constitutive expression pattern was similar to that of the CaMV35S promoter, but the level of GUS activity was significantly lower than in CaMV35S promoter::GUS plants. We also characterized the promoter through transient expression in transgenic tobacco and observed similar expression patterns. Histochemical GUS staining and quantitative analysis detected GUS activity in all tissues and organs of tobacco, including roots, stems, leaves, flower buds and flowers, but GUS activity in PtMCP promoter::GUS plants was significantly lower than in CaMV35S promoter::GUS plants. Our results suggested that the PtMCP promoter from poplar is a constitutive promoter with moderate activity and that its function is presumably conserved in different species. Therefore, the PtMCP promoter may provide a practical choice to direct moderate level constitutive expression of transgenes and could be a valuable new tool in plant genetic engineering.

  2. Genetic differentiation and delimitation between ecologically diverged Populus euphratica and P. pruinosa.

    Directory of Open Access Journals (Sweden)

    Juan Wang

    Full Text Available BACKGROUND: The fixed genetic differences between ecologically divergent species were found to change greatly depending on the markers examined. With such species it is difficult to differentiate between shared ancestral polymorphisms and past introgressions between the diverging species. In order to disentangle these possibilities and provide a further case for DNA barcoding of plants, we examine genetic differentiation between two ecologically divergent poplar species, Populus euphratica Oliver and P. pruinosa Schrenk using three different types of genetic marker. METHODOLOGY/PRINCIPAL FINDINGS: We genotyped 290 individuals from 29 allopatric and sympatric populations, using chloroplast (cp DNA, nuclear (nr ITS sequences and eight simple sequence repeat (SSR loci. Three major cpDNA haplotypes were widely shared between the two species and between-species cpDNA differentiation (F(CT was very low, even lower than among single species populations. The average SSR F(CT values were higher. Bayesian clustering analysis of all loci allowed a clear delineation of the two species. Gene flow, determined by examining all SSR loci, was obvious but only slightly asymmetrical. However, the two species were almost fixed for two different nrITS genotypes that had the highest F(CT, although a few introgressed individuals were detected both in allopatric and sympatric populations. CONCLUSIONS: The two species shared numerous ancestral polymorphisms at cpDNA and a few SSR loci. Both ITS and a combination of nuclear SSR data could be used to differentiate between the two species. Introgressions and gene flow were obvious between the two species either during or after their divergence. Our findings underscore the complex genetic differentiations between ecologically diverged species and highlight the importance of nuclear DNA (especially ITS differentiation for delimiting closely related plant species.

  3. The applications of populus fiber in removal of Cr(VI) from aqueous solution

    Science.gov (United States)

    Li, Miaomiao; Gong, Yumei; Lyu, Aichao; Liu, Yuanfa; Zhang, Hong

    2016-10-01

    The surface modification of natural materials to be applied in removal of Cr(VI) from aqueous solutions has attracted much attention. A natural sorbent for Cr(VI) based on natural populus fibers (PF) is prepared by transforming the cyano groups (AN) in polyacrylonitriles (PAN) grafted from PF into amidoxime groups (AO), which has strong ability to attract and chelate heavy metal ions. The prepared sorbent is characterized by Fourier Transform Infrared Spectra (FT-IR), thermogravimetric analysis (TGA), solid-state nuclear magnetic resonance (13C NMR) and scanning electron microscope (SEM). As potassium dichromate solution (K2Cr2O7) is used as a target solution for detecting adsorption capacity of the sorbent, the adsorption kinetics of the sorbent for chromiun is consistent with the pseudo-second-order kinetic model by analyzing the adsorption amount as a function of the sorbent dispersed duration in solution at pH = 2. The expected adsorption mechanism is that the Cr(VI) in anionic ions Cr2O72- and HCrO4- are adsorbed through electrostatic attraction but when Cr(VI) is reduced to Cr(III) by AO, the electronegative nitrogen and oxygen in AO chelate it through coordination bond. The as-prepared PF derivant with high adsorption efficiency of chromium 180.5 mg/g (3.47 mmol/g), low cost, reusability and greenly preparation process suggests that the development of natural PF as a sorbent in removal of Cr(VI) from aqueous solutions is a destined significant approach.

  4. The role of antioxidant system in freezing acclimation-induced freezing resistance of Populus suaveolens cuttings

    Institute of Scientific and Technical Information of China (English)

    Luo Lei; Lin Shan-zhi; Zheng Hui-quan; Lei Yang; Zhang Qian; Zhang Zhi-yi

    2007-01-01

    We investigated the changes in the contents of H2O2, malonaldehyde (MDA) and endogenous antioxidants, the activities of protective enzymes and some critical enzymes involved in the ascorbate-glutathione (ASA-GSH) cycle as well as freezing resistance(expressed as LT50) and correlations mentioned above, in detail using Populus suaveolens cuttings. The purpose was to explore the physiological mechanism of the enhancement of freezing resistance induced by freezing acclimation at -20℃, and to elucidate the physiological mechanisms by which trees adapt to freezing. The results showed that freezing acclimation enhanced the activities of superoxide dismutase (SOD), peroxidase (POD), catalase (CAT), monodehydroascorbate reductase (MDAR), ascorbate peroxidase(APX), dehydroascorbate reductase (DHAR) and glutathione reductase (GR). And it increased the contents of reduced ascorbate(ASA), reduced glutathione (GSH), dehydroascorbate (DHA) and oxidized glutathione (GSSG). However, H2O2 and MDA contents and LT50 of cuttings were decreased. LT50 in cuttings was found to be closely correlated to the levels of SOD, POD, CAT, APX,DHAR, MDAR, GR, H2O2, MDA, ASA, GSH, DHA and GSSG during freezing acclimation. This suggested that the enhancement of freezing resistance of cuttings induced by freezing acclimation may relate to the distinct increase for the levels of SOD, POD, CAT,APX, DHAR, MDAR,GR,ASA, GSH, DHA, and GSSG. In addition, the observed levels of APX, DHAR, MDAR, GR, ASA, DHA,GSH and GSSG were higher than those of SOD, POD and CAT during freezing acclimation. It indicated that a higher capacity of the ASA-GSH cycle is required for H2O2 detoxification, and growth and development of cuttings. Based on the obtained results, it can be concluded that the ASA-GSH cycle plays an important role in enhancement of freezing resistance of P. suaveolens cuttings during freezing acclimation.

  5. Sex-specific responses of Populus deltoides to Glomus intraradices colonization and Cd pollution.

    Science.gov (United States)

    Chen, Lianghua; Zhang, Danju; Yang, Wanqin; Liu, Yang; Zhang, Li; Gao, Shun

    2016-07-01

    The positive effects of arbuscular mycorrhizal fungi (AM) on the survival, growth and physiology of plants under various stress conditions have been widely recognized. However, whether sex-dependent susceptibility to AM colonization exists, which can induce a differential tolerance between the sexes to stress conditions, is still unclear. In this study, we investigated the effects of Glomus intraradices on Cd-stressed males and females of Populus deltoides (spiked with 10 mg Cd per kg dry substrate) in terms of morphology, physiology, biochemistry, ultrastructure, and toxin storage and translocation. Exposure to Cd promoted the colonization by G. intraradices in males, but not in females. Generally, females suffered more impairments than males in response to Cd stress, reflected by leaf symptoms, the extent of lipid peroxidation, and integrity of the cellular ultrastructure, whether they were inoculated or not. Inoculation with G. intraradices alleviated the phytotoxic effects of Cd in females by stimulating antioxidant enzymes, decreasing levels of reactive oxygen species (ROS) and restricting Cd transfer to the shoots. In contrast, these beneficial effects induced by AM were not detected in mycorrhizal males compared to non-mycorrhizal males, based on thiobarbituric acid-reactive substances (TBARS) and cellular ultrastructure. Inoculation with AM promoted Cd accumulation in males but not in females, and caused the sequestration of more toxic Cd in the root systems in both sexes. Therefore, our results suggest that inoculated males of P. deltoides are suitable candidates for phytostabilization in Cd-polluted soils, due to their higher accumulation ability and greater tolerance relative to inoculated females.

  6. Streptomyces indoligenes sp. nov., isolated from rhizosphere soil of Populus euphratica.

    Science.gov (United States)

    Luo, Xiaoxia; Sun, Yong; Xie, Sinan; Wan, Chuanxing; Zhang, Lili

    2016-06-01

    A novel actinobacterium, designated TRM 43006T, was isolated from the rhizosphere soil of Populus euphratica in Xinjiang Province, north-west China. Phylogenetic and phenotypic analysis demonstrated that strain TRM 43006T belongs to the genus Streptomyces. The strain was aerobic and Gram-stain-positive; the aerial mycelium branched monopodially, forming chains of arthrospores. The spores were oval to cylindrical with smooth surfaces. The whole-cell sugar pattern of strain TRM 43006T consisted of xylose, mannitol, galactose and ribose. The menaquinones were MK-9(H6), MK-9(H8) and MK-9(H10). The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, phosphatidylinositol, phosphatidylinositol mannosides and four unknown phospholipids. Major fatty acids were iso-C16 : 0, iso-C16 : 1, iso-C14 : 0 and anteiso-C15 : 0. The G+C content of the genomic DNA was 69.0 mol%. Comparative 16S rRNA gene sequence analysis indicated that strain TRM 43006T was phylogenetically most closely related to Streptomyces roseolilacinus NBRC 12815T (98.6 % similarity) and Streptomycessudanensis SD 504T (98.3 %); however, DNA-DNA hybridization studies between S. roseolilacinus NBRC 12815T, S. sudanensis SD 504T and TRM 43006T showed only 30.28 and 30.65  % relatedness, respectively. Based on the evidence from this polyphasic study, strain TRM 43006T represents a novel species of the genus Streptomyces, for which the name Streptomyces indoligenes sp. nov. is proposed. The type strain is TRM 43006T (=KCTC 39611T=CCTCC AA 2015010T).

  7. Responses of germination and radicle growth of two Populus species to water potential and salinity

    Institute of Scientific and Technical Information of China (English)

    Li Li; Zhang Xi-ming; Michael Runge; Li Xiao-ming; He Xing-yuan

    2006-01-01

    The effects of water potential, NaCl and Na2SO4 on germination and radicle growth of two riparian tree species, Populus euphratica Oliv. and P. pruinosa Schrenk (Salicaceae), were tested. Growth chamber studies revealed an optimum temperature range for seed germination of both species between 15-35℃. The final germination percentage of both species decreases with decreasing water potential in all types of solution applied in the experiments. P. pruinosa was less tolerant to low Ψw stress than P. euphratica,especially in salt solutions. Germination percentages fell below 20% for P. pruinosa at -0.6 MPa (NaCl) or -0.4 MPa (Na2SO4) and for P. euphratica at -1.2 MPa (NaCl) or -0.6 MPa (Na2SO4). Radicle growth of both species was inhibited by high concentrations of PEG, NaCl and Na2SO4. However, growth was enhanced at -0.13 and -0.29 MPa in PEG or at -0.13 MPa in NaCl solutions compared to distilled water. Radicle growth of P. euphratica was higher than that of P. pruinosa. Germination and radicle growth of both species exhibited ion toxicity. Na2SO4 was more toxic than iso-osmotic solutions of NaCl. Radicle growth proved to be more sensitive than seed germination. Thus, flooding does not only yield the necessary soil moisture for germination but also favors seedling establishment of both species through leaching of salts from the soil surface. The different sensitivity of the species during their early growth stages might, moreover, contribute to the observed differences in their distribution in the Talim Basin (northwest China).

  8. Effects of Groundwater Levels on Photosynthetic Pigments and Light Response of Chlorophyll Fluorescence Parameters of Populus euphratica and Populus pruinosa%地下水位对胡杨(Populus euphratica)和灰胡杨(Populus pruinosa)叶绿素荧光光响应与光合色素含量的影响

    Institute of Scientific and Technical Information of China (English)

    王海珍; 陈加利; 韩路; 徐雅丽; 贾文锁

    2013-01-01

    Photosynthetic pigments and light response curves of chlorophyll fluorescence parameters in leaves of Populus euphratica and Poulus pruinosa,living with different groundwater depths (2.5 m,3.5 m and 5.0 m) in the upper reaches of Tarmi River,were measured with a portable fluorometer.The results showed that chlorophyll fluorescence parameters of light response curves of P.euphratica and P.pruinosa,such as photosynthetic electron transport rate(ETR),non-photochemical quenching(NPQ),excitation pressure (1-qP),the ratio of antenna thermal dissipation (D),excess excited energy(E),relative limitation of photosynthesis(PED),the deviation from full balance between PSⅠ and PS Ⅱ (β/α-1) increased with increasing photosynthetic active radiation(PAR),but PS Ⅱ actual photochemical efficiency(ΦPSⅡ),photochemistry quenching (qP) and the ratio of absorbed light in photochemistry(P) decreased with increasing PAR under different groundwater levels in arid desert environment.The decrease of groundwater levels led to decrease in leaf water content,maximum electron transport rate (ETRmax),initial slope rate of photochemical reaction(θ),ETR,ΦSⅡ,qP,P and leaf content of chlorophyll a (Chla),leaf content of chlorophyll b (Chlb),total chlorophyll (Chla + Chlb),carotenoids,but it led to increase obviously in the ratio of Chla to Chlb (Chla/ Chlb),NPQ,D,E,PED,1-qP,β/α-1 under the same light intensity.The decrease of groundwater levels influenced significantly the chlorophyll fluorescence parameters of light response curves of two tree species,and it led to changes in light energy absorption,transfer and allocation,further to decrease the photosynthetic efficiency.Greater decreases occurred with the deeper groundwater level and P.pruinosa declined more than P.euphratica,it showed P.euphratica were better ecological adaptation to desert environment than P.pruinosa.P.euphratica could maintain relative high ETR,ETRmax,θ,ΦPSⅡ,qP,P and enhanced radiationless energy dissipation

  9. Microarray and suppression subtractive hybridization analyses of gene expression in hybrid poplar (Populus alba × Populus tremula var. glandulosa) cell suspension cultures after exposure to NaCl.

    Science.gov (United States)

    Bae, Eun-Kyung; Lee, Hyoshin; Lee, Jae-Soon; Noh, Eun-Woon; Choi, Young-Im; Lee, Byung-Hyun; Choi, Dong-Woog

    2012-09-01

    The gene expression profiles of hybrid poplar (Populus alba × Populus tremula var. glandulosa) cells in suspension culture after exposure to salinity (NaCl) induced stress were examined by constructing two suppression subtractive hybridization (SSH) libraries. cDNA from non-treated cells was used as a driver and cDNA samples from cell suspension cultures exposed to 150 mM NaCl for 2 or 10 h were used as testers. Randomly selected clones from each SSH library were sequenced and 727 high-quality expressed sequence tags (ESTs) were obtained and analyzed. Four novel ESTs were identified. Between the two libraries, 542 unique SSH clones were selected for placement on a cDNA microarray. In total, 18 differentially expressed genes were identified with 4 and 12 genes being significantly differentially expressed 2 and 10 h after the treatment, respectively. Genes related to metabolism and protein synthesis and several genes whose protein products are implicated in salt or other abiotic stress-related responses were expressed in the salt-stressed cells.

  10. The Streambank Erosion Control Evaluation and Demonstration Act of 1974, Section 32, Public Law 93-251. Appendix E. Missouri River Demonstration Projects. Volume 1.

    Science.gov (United States)

    1981-12-01

    Peachleaf Willow Salix amygdaloides -. Cottonwood Populus deltoides Russian Olive Elaeagnus angustifolia Buffaloberry Shepherdia argentea In addition, 8,000... Elaeagnus angustifolia Buffaloberry Shepherdia argentea Red-Osier Dogwood Cornus stolonifera Golden Willow Salix alba vitelina Hackberry Celtis

  11. Final Environmental Assessment for the Beddown and Flight Operations of Unmanned Aircraft Systems at Grand Forks Air Force Base, North Dakota

    Science.gov (United States)

    2008-08-01

    from wind, cold and snow. Shelterbelt species include American elm (Ulmus americana), green ash (Fraxinus pennsylvanica), Russian olive ( Elaeagnus ... angustifolia ) and cottonwood (Populus deltoides). Other woody species present on GFAFB include Eastern red cedar (Juniperus virginiana), Norway

  12. The Populus homeobox gene ARBORKNOX1 reveals overlapping mechanisms regulating the shoot apical meristem and the vascular cambium.

    Science.gov (United States)

    Groover, Andrew T; Mansfield, Shawn D; DiFazio, Stephen P; Dupper, Gayle; Fontana, Joseph R; Millar, Ryan; Wang, Yvonne

    2006-08-01

    Secondary growth is supported by a dividing population of meristematic cells within the vascular cambium whose daughter cells are recruited to differentiate within secondary phloem and xylem tissues. We cloned a Populus Class 1 KNOX homeobox gene, ARBORKNOX1 (ARK1), which is orthologous to Arabidopsis SHOOT MERISTEMLESS (STM). ARK1 is expressed in the shoot apical meristem (SAM) and the vascular cambium, and is down-regulated in the terminally differentiated cells of leaves and secondary vascular tissues that are derived from these meristems. Transformation of Populus with either ARK1 or STM over-expression constructs results in similar morphological phenotypes characterized by inhibition of the differentiation of leaves, internode elongation, and secondary vascular cell types in stems. Microarray analysis showed that 41% of genes up-regulated in the stems of ARK1 over-expressing plants encode proteins involved in extracellular matrix synthesis or modification, including proteins involved in cell identity and signaling, cell adhesion, or cell differentiation. These gene expression differences are reflected in alterations of cell wall biochemistry and lignin composition in ARK1 over-expressing plants. Our results suggest that ARK1 has a complex mode of action that may include regulating cell fates through modification of the extracellular matrix. Our findings support the hypothesis that the SAM and vascular cambium are regulated by overlapping genetic programs.

  13. Phytoremediation of landfill leachate and compost wastewater by irrigation of Populus and Salix: Biomass and growth response.

    Science.gov (United States)

    Justin, Maja Zupancic; Pajk, Nastja; Zupanc, Vesna; Zupancic, Marija

    2010-06-01

    A pot experiment is described with a fast-growing poplar clone and two native willows (Populus deltoides Bartr. cl. I-69/55 (Lux)), Salix viminalis L. and Salix purpurea L.), irrigated with landfill leachate and compost wastewater over a 1-year growing period. The use of leachate resulted in up to 155% increased aboveground biomass compared to control water treatments and in up to 28% reduced aboveground biomass compared to a complete nutrient solution. The use of compost wastewater resulted in up to 62% reduced aboveground biomass compared to the control treatments and in up to 86% reduced aboveground biomass compared to the complete nutrient solution. Populus was the most effective in biomass production due to the highest leaf production, whereas S. purpurea was the least effective in biomass accumulation, but less sensitive to high ionic strength of the irrigation water compared to S. viminalis. The results showed a high potential for landfill leachate application (with up to 2144 kg N ha(-1), 144 kg P ha(-1), 709 kg K ha(-1), 1010 kg Cl ha(-1), and 1678 kg Na ha(-1) average mass load in the experiment). High-strength compost wastewater demonstrated less potential for application as irrigation and fertilization source even in high water-diluted treatments (1:8 by volume). Copyright 2010 Elsevier Ltd. All rights reserved.

  14. Genome-wide search for segregation distortion loci associated with the expression of complex traits in Populus tomentosa

    Institute of Scientific and Technical Information of China (English)

    Zhang De-qiang; Zhang Zhi-yi; Yang Kai

    2007-01-01

    Segregation distortion of molecular markers has been reported in a broad range of organisms. It has been detected in an interspecific BC1 Populus pedigree established by controlled crossing between clone "LM50" (Populus tomentosa) and its hybrid clone "TB01" (P. tomentosa×P. bolleana). The study with a total of 150 AFLP markers (approximately 18.9% of the total loci)exhibited significant deviation from the Mendelian ratio (1:1) (p<0.01). Twenty-five percent of the markers were mapped on the parental specific genetic linkage maps of clones "LM50" and "TB01" with a pseudo-test-cross mapping strategy. Twelve linkage groups had markers with skewed segregation ratios, but the major regions were on linkage groups TLG2, TLG4 and TLG6 in the linkage map of clone "LM50". We also analyzed the association between distorted loci and expression of complex traits with Mapmaker/QTL software. A total of 16 putative QTLs affecting 12 traits were identified in the distorted regions on seven linkage groups.Therefore we could detect the distribution of skewed loci along the entire genome and identify the association between quantitative traits and segregation loci via genetic mapping in an interspecific BC1 P. tomentosa family. Furthermore, the genetic nature and possible causes of these segregation distortions for differentiation between female and male parents were also discussed.

  15. Comparative analysis of GT14/GT14-like family genes in Arabidopsis, Oryza, Populus, Sorghum and Vitis

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Chuyu [ORNL; Li, Ting [ORNL; Tuskan, Gerald A [ORNL; Tschaplinski, Timothy J [ORNL; Yang, Xiaohan [ORNL

    2011-01-01

    Glycosyltransferase family14 (GT14) belongs to the glycosyltransferase (GT) superfamily that plays important roles in the biosynthesis of cell walls, the most abundant source of cellulosic biomass for bioethanol production. It has been hypothesized that DUF266 proteins are a new class of GTs related to GT14. In this study, we identified 62 GT14 and 106 DUF266 genes (named GT14-like herein) in Arabidopsis, Oryza, Populus, Sorghum and Vitis. Our phylogenetic analysis separated GT14 and GT14-like genes into two distinct clades, which were further divided into eight and five groups, respectively. Similarities in protein domain, 3D structure and gene expression were uncovered between the two phylogenetic clades, supporting the hypothesis that GT14 and GT14-like genes belong to one family. Therefore, we proposed a new family name, GT14/GT14-like family that combines both subfamilies. Variation in gene expression and protein subcellular localization within the GT14-like subfamily were greater than those within the GT14 subfamily. One-half of the Arabidopsis and Populus GT14/GT14-like genes were found to be preferentially expressed in stem/xylem, indicating that they are likely involved in cell wall biosynthesis. This study provided new insights into the evolution and functional diversification of the GT14/GT14-like family genes.

  16. Moderate drought did not affect the effectiveness of ethylenediurea (EDU) in protecting Populus cathayana from ambient ozone.

    Science.gov (United States)

    Xin, Yue; Yuan, Xiangyang; Shang, Bo; Manning, William J; Yang, Aizhen; Wang, Younian; Feng, Zhaozhong

    2016-11-01

    A field study was conducted to evaluate the effects of ambient ozone (O3) on an O3-sensitive poplar (Populus cathayana) by using ethylenediurea (EDU) as a chemical protectant under two soil water treatments (well-watered (WW) and moderate drought (MD, 50-60% of WW in volumetric soil water content). EDU was applied as foliar spray at 0, 300, 450, and 600ppm. Photosynthetic parameters, pigment contents, leaf nitrogen, antioxidant capacity, growth, and biomass were measured. The 8h (9:00-17:00) average ambient O3 concentration was 71.7ppb, and AOT40 was 29.2ppmh during the experimental period (9 June to 21 September), which was high enough to cause plant injury. MD had significantly negative effects on P. cathayana, as indicated by reduced photosynthesis, growth, and biomass, and higher MDA contents. On the other hand, EDU significantly increased photosynthesis rate, chlorophyll a fluorescence, Vcmax and Jmax, photosynthetic pigments, total antioxidant capacity, tree growth and biomass accumulation, and reduced lipid peroxidation, but there was no significant interaction between EDU and drought for most parameters, indicating that EDU can efficiently protect Populus cathayana against ambient O3 and the protection was not affected by soil water contents when soil water reached moderate drought level. Among all doses, EDU at 450ppm provided maximum protection. Comparison of EDU-treated and non-treated P. cathayana could be used as a biomarker system in risk assessment of the effects of ambient O3 on forest health.

  17. Natural hybridization between Populus nigra L. and P. x canadensis Moench. Hybrid offspring competes for niches along the Rhine river in the Netherlands

    NARCIS (Netherlands)

    Smulders, M.J.M.; Beringen, R.; Volosyanchuk, R.; Vanden Broeck, A.; Schoot, van der J.; Arens, P.F.P.; Vosman, B.

    2008-01-01

    Black poplar (Populus nigra L.) is a major species for European riparian forests but its abundance has decreased over the decades due to human influences. For restoration of floodplain woodlands, the remaining black poplar stands may act as source population. A potential problem is that P. nigra and

  18. A review of the potential effects of climate change on quaking aspen (Populus tremuloides) in the Western United States and a new tool for surveying sudden aspen decline

    Science.gov (United States)

    Toni Lyn Morelli; Susan C. Carr

    2011-01-01

    We conducted a literature review of the effects of climate on the distribution and growth of quaking aspen (Populus tremuloides Michx.) in the Western United States. Based on our review, we summarize models of historical climate determinants of contemporary aspen distribution. Most quantitative climate-based models linked aspen presence and growth...

  19. Expression and molecular evolution of two DREB1 genes in black poplar (Populus nigra).

    Science.gov (United States)

    Chu, Yanguang; Huang, Qinjun; Zhang, Bingyu; Ding, Changjun; Su, Xiaohua

    2014-01-01

    Environmental stresses such as low temperature, drought, and high salinity significantly affect plant growth and yield. As selective forces, these adverse factors play essential roles in shaping phenotypic variation in plant populations. Black poplar (Populus nigra) is an economically and ecologically important forest tree species with widely distributed populations and is thus suitable for experiments detecting evolutionary footprints left by stress. Here, we performed expression and evolutionary analysis of two duplicated DREB A1-subgroup (DREB1) genes, PnDREB68 and PnDREB69, encoding transcription factors that are involved in stress responses. The two genes showed partially overlapping but distinct expression patterns in response to stresses. These genes were strongly and rapidly induced by cold stress in leaves, stems, and roots. In leaf tissue, dehydration stress induced the expression of PnDREB68 but not PnDREB69. PnDREB69 displayed more rapid responses and longer expression durations than PnDREB68 under salt and ABA stress, respectively. Based on single nucleotide polymorphism (SNP) analysis, we found significant population genetic differentiation, with a greater FST value (0.09189) for PnDREB69 than for PnDREB68 (0.07743). Nucleotide diversity analysis revealed a two-fold higher πT for PnDREB68 than for PnDREB69 (0.00563 vs. 0.00243), reflecting strong purifying selection acting on the former. The results suggest that positive selection acted on PnDREB69, as evidenced by neutral testing using Tajima's D statistic. The distinct selective forces to which each of the genes was subjected may be associated with expression divergence. Linkage disequilibrium (LD) was low for the sequenced region, with a higher level for PnDREB68 than for PnDREB69. Additionally, analysis of the relationship among carbon isotope ratios, SNP classes and gene expression, together with motif and domain analysis, suggested that 14 polymorphisms within the two genes may be candidates

  20. Expression and molecular evolution of two DREB1 genes in black poplar (Populus nigra.

    Directory of Open Access Journals (Sweden)

    Yanguang Chu

    Full Text Available Environmental stresses such as low temperature, drought, and high salinity significantly affect plant growth and yield. As selective forces, these adverse factors play essential roles in shaping phenotypic variation in plant populations. Black poplar (Populus nigra is an economically and ecologically important forest tree species with widely distributed populations and is thus suitable for experiments detecting evolutionary footprints left by stress. Here, we performed expression and evolutionary analysis of two duplicated DREB A1-subgroup (DREB1 genes, PnDREB68 and PnDREB69, encoding transcription factors that are involved in stress responses. The two genes showed partially overlapping but distinct expression patterns in response to stresses. These genes were strongly and rapidly induced by cold stress in leaves, stems, and roots. In leaf tissue, dehydration stress induced the expression of PnDREB68 but not PnDREB69. PnDREB69 displayed more rapid responses and longer expression durations than PnDREB68 under salt and ABA stress, respectively. Based on single nucleotide polymorphism (SNP analysis, we found significant population genetic differentiation, with a greater FST value (0.09189 for PnDREB69 than for PnDREB68 (0.07743. Nucleotide diversity analysis revealed a two-fold higher πT for PnDREB68 than for PnDREB69 (0.00563 vs. 0.00243, reflecting strong purifying selection acting on the former. The results suggest that positive selection acted on PnDREB69, as evidenced by neutral testing using Tajima's D statistic. The distinct selective forces to which each of the genes was subjected may be associated with expression divergence. Linkage disequilibrium (LD was low for the sequenced region, with a higher level for PnDREB68 than for PnDREB69. Additionally, analysis of the relationship among carbon isotope ratios, SNP classes and gene expression, together with motif and domain analysis, suggested that 14 polymorphisms within the two genes may be

  1. Transcriptome responses to aluminum stress in roots of aspen (Populus tremula

    Directory of Open Access Journals (Sweden)

    Grisel Nadine

    2010-08-01

    Full Text Available Abstract Background Ionic aluminum (mainly Al3+ is rhizotoxic and can be present in acid soils at concentrations high enough to inhibit root growth. Many forest tree species grow naturally in acid soils and often tolerate high concentrations of Al. Previously, we have shown that aspen (Populus tremula releases citrate and oxalate from roots in response to Al exposure. To obtain further insights into the root responses of aspen to Al, we investigated root gene expression at Al conditions that inhibit root growth. Results Treatment of the aspen roots with 500 μM Al induced a strong inhibition of root growth within 6 h of exposure time. The root growth subsequently recovered, reaching growth rates comparable to that of control plants. Changes in gene expression were determined after 6 h, 2 d, and 10 d of Al exposure. Replicated transcriptome analyses using the Affymetrix poplar genome array revealed a total of 175 significantly up-regulated and 69 down-regulated genes, of which 70% could be annotated based on Arabidopsis genome resources. Between 6 h and 2 d, the number of responsive genes strongly decreased from 202 to 26, and then the number of changes remained low. The responses after 6 h were characterized by genes involved in cell wall modification, ion transport, and oxidative stress. Two genes with prolonged induction were closely related to the Arabidopsis Al tolerance genes ALS3 (for Al sensitive 3 and MATE (for multidrug and toxin efflux protein, mediating citrate efflux. Patterns of expression in different plant organs and in response to Al indicated that the two aspen genes are homologs of the Arabidopsis ALS3 and MATE. Conclusion Exposure of aspen roots to Al results in a rapid inhibition of root growth and a large change in root gene expression. The subsequent root growth recovery and the concomitant reduction in the number of responsive genes presumably reflect the success of the roots in activating Al tolerance mechanisms. The

  2. CHANGES OF CUTICLE SURFACE LIPIDS OF POPULUS ITALICA AND BETULA PENDULA CAUSED BY POLLUTION

    Directory of Open Access Journals (Sweden)

    Zubrovskaya O. M.

    2014-08-01

    Full Text Available Arboreal plants intensively accumulate heavy metals, resulting in a corresponding revocation level of physiological processes. The lipid components operate an important role in the formation of plant resistance. Therefore, it was very important to determine the characteristics of lipid peroxidation flow in leaves of arboreal plants, and changes in the composition of cuticle surface lipids at different levels of heavy metal accumulation. Research objects were Populus italica (Du Roi Moench and Betula pendula Roth. of second age group, growing on the industrial site РJSC ‘Kryvyi Rig Factory of minium’ (with strong contamination and in the arboretum of Kryvyi Rig Botanic Garden, National Academy of Science of Ukraine (conventional control. Leaves were taken from the middle of the crown southwest exposure in phase of leaf full separation and 5-10 day of phase finishing point of their growth. It was shown that P. italica maximally accumulated zinc, content of which was increased in the phase of leaf full separation and on 5-10 day of phase of leaf growth finishing point relative to the control to 12,6 and 23 times respectively. The accumulation level of heavy metals was typically less significant for assimilation organs of B. pendula compared to P. italica. Thus, the content of zinc and lead in the leaves during the study increased only in 2 times towards control. The leaves of B. pendula, unlike P. italica, more intensively accumulated cadmium in the phase of leaf full separation and on 5-10 day of phase finishing point of their growth (it was 6 and 15 times higher relative to control respectively. It was obviously connected to the fact that the surface texture of poplar leaves may cause intense sticking of dust particles containing heavy metals and penetration into the leaves. The effect of heavy metals in both phases of leaf morphogenesis caused an increase in lipid peroxidation by 40-52% for P. italica and almost by 3 times for B. pendula

  3. Rhizobium populi sp. nov., an endophytic bacterium isolated from Populus euphratica.

    Science.gov (United States)

    Rozahon, Manziram; Ismayil, Nurimangul; Hamood, Buayshem; Erkin, Raziya; Abdurahman, Mehfuzem; Mamtimin, Hormathan; Abdukerim, Muhtar; Lal, Rup; Rahman, Erkin

    2014-09-01

    An endophytic bacterium, designated K-38(T), was isolated from the storage liquid in the stems of Populus euphratica trees at the ancient Ugan River in Xinjiang, PR China. Strain K-38(T) was found to be rod-shaped, Gram-stain-negative, aerobic, non-motile and non-spore-forming. Strain K-38(T) grew at temperatures of 25-37 °C (optimum, 28 °C), at pH 6.0-9.0 (optimum, pH 7.5) and in the presence of 0-3 % (w/v) NaCl with 1 % as the optimum concentration for growth. According to phylogenetic analysis based on 16S rRNA gene sequences, strain K-38(T) was assigned to the genus Rhizobium with highest 16S rRNA gene sequence similarity of 97.2 % to Rhizobium rosettiformans W3(T), followed by Rhizobium nepotum 39/7(T) (96.5 %) and Rhizobium borbori DN316(T) (96.2 %). Phylogenetic analysis of strain K-38(T) based on the protein coding genes recA, atpD and nifH confirmed (similarities were less than 90 %) it to be a representative of a distinctly delineated species of the genus Rhizobium. The DNA G+C content was determined to be 63.5 mol%. DNA-DNA relatedness between K-38(T) and R. rosettiformans W3(T) was 48.4 %, indicating genetic separation of strain K-38(T) from the latter strain. The major components of the cellular fatty acids in strain K-38(T) were revealed to be summed feature 8 (comprising C18 : 1ω7c and/or C18 : 1ω6c; 57.2 %), C16 : 0 (13.6 %) and summed feature 2 (comprising C12 : 0 aldehyde, C14 : 0 3-OH/iso-C16 : 1 I and/or unknown ECL 10.928; 11.0 %). Polar lipids of strain K-38(T) include phosphatidylethanolamine, phosphatidylmonomethylethanolamine, phosphatidylcholine, phosphatidylglycerol, diphosphatidylglycerol, two unidentified aminophospholipids and two unidentified phospholipids. Q-10 was the major quinone in strain K-38(T). Based on phenotypic, chemotaxonomic and phylogenetic properties, strain K-38(T) represents a novel species of the genus Rhizobium, for which the name Rhizobium populi sp. nov. is proposed

  4. The UDP-glucuronate decarboxylase gene family in Populus: structure, expression, and association genetics.

    Directory of Open Access Journals (Sweden)

    Qingzhang Du

    Full Text Available In woody crop plants, the oligosaccharide components of the cell wall are essential for important traits such as bioenergy content, growth, and structural wood properties. UDP-glucuronate decarboxylase (UXS is a key enzyme in the synthesis of UDP-xylose for the formation of xylans during cell wall biosynthesis. Here, we isolated a multigene family of seven members (PtUXS1-7 encoding UXS from Populus tomentosa, the first investigation of UXSs in a tree species. Analysis of gene structure and phylogeny showed that the PtUXS family could be divided into three groups (PtUXS1/4, PtUXS2/5, and PtUXS3/6/7, consistent with the tissue-specific expression patterns of each PtUXS. We further evaluated the functional consequences of nucleotide polymorphisms in PtUXS1. In total, 243 single-nucleotide polymorphisms (SNPs were identified, with a high frequency of SNPs (1/18 bp and nucleotide diversity (πT = 0.01033, θw = 0.01280. Linkage disequilibrium (LD analysis showed that LD did not extend over the entire gene (r (2<0.1, P<0.001, within 700 bp. SNP- and haplotype-based association analysis showed that nine SNPs (Q <0.10 and 12 haplotypes (P<0.05 were significantly associated with growth and wood property traits in the association population (426 individuals, with 2.70% to 12.37% of the phenotypic variation explained. Four significant single-marker associations (Q <0.10 were validated in a linkage mapping population of 1200 individuals. Also, RNA transcript accumulation varies among genotypic classes of SNP10 was further confirmed in the association population. This is the first comprehensive study of the UXS gene family in woody plants, and lays the foundation for genetic improvements of wood properties and growth in trees using genetic engineering or marker-assisted breeding.

  5. Elevated Rocky Mountain elk numbers prevent positive effects of fire on quaking aspen (Populus tremuloides) recruitment

    Science.gov (United States)

    Smith, David Solance; Fettig, Stephen M.; Bowker, Matthew A.

    2016-01-01

    Quaking aspen (Populus tremuloides) is the most widespread tree species in North America and has supported a unique ecosystem for tens of thousands of years, yet is currently threatened by dramatic loss and possible local extinctions. While multiple factors such as climate change and fire suppression are thought to contribute to aspen’s decline, increased browsing by elk (Cervus elaphus), which have experienced dramatic population increases in the last ∼80 years, may severely inhibit aspen growth and regeneration. Fires are known to favor aspen recovery, but in the last several decades the spatial scale and intensity of wildfires has greatly increased, with poorly understood ramifications for aspen growth. Here, focusing on the 2000 Cerro Grande fire in central New Mexico – one of the earliest fires described as a “mega-fire” - we use three methods to examine the impact of elk browsing on aspen regeneration after a mega-fire. First, we use an exclosure experiment to show that aspen growing in the absence of elk were 3× taller than trees growing in the presence of elk. Further, aspen that were both protected from elk and experienced burning were 8.5× taller than unburned trees growing in the presence of elk, suggesting that the combination of release from herbivores and stimulation from fire creates the largest aspen growth rates. Second, using surveys at the landscape level, we found a correlation between elk browsing intensity and aspen height, such that where elk browsing was highest, aspen were shortest. This relationship between elk browsing intensity and aspen height was stronger in burned (r = −0.53) compared to unburned (r = −0.24) areas. Third, in conjunction with the landscape-level surveys, we identified possible natural refugia, microsites containing downed logs, shrubs etc. that may inhibit elk browsing by physically blocking aspen from elk or by impeding elk’s ability to move through the forest patch. We did not find any

  6. Comparative Study on Antioxidative System in Normal and Vitrified Shoots of Populus suaveolens in Tissue Culture

    Institute of Scientific and Technical Information of China (English)

    Lin Shanzhi; Zhang Zhiyi; Lin Yuanzhen; Liu Wenfeng; Guo Huan; Zhang Wei; Zhang Chong

    2004-01-01

    To explore the physiological and biochemical mechanism of the occurrence of vitrified shoots of Populus suaveolens in tissue culture, the changes in water, chlorphyll, lignin, H2O2, phenylalanine ammonialyase (PAL), malonaldehyde (MDA), protective enzymatic systems, and some key enzymes involved in the ascorbate- glutathione cycle were comparatively studied in both normal and vitrified shoots of P. Suaveolens. The results show that the lower activities of peroxidase (POD), catalase (CAT), ascorbate peroxidase (APX), dehydroascorbate reductase (DHAR), glutathione reductase (GR) and PAL, and the less contents of chlorphyll, lignin, ascorbate (ASA) and reduced glutathione (GSH) as well as the lower ratios of ASA / DHA and GSH / GSSG are observed in vitrified shoots than in normal ones during the whole culture period. While in comparison with normal shoots, the higher activity of superoxide dismutase (SOD) and the more concentrations of water, H2O2, MDA, dehydroascorbate (DHA) and oxidized glutathione (GSSG) are found in vitrified shoots. Statistical analysis indicates that the enhanced activity of SOD and the decreased activities of CAT and POD as well as some enzymes involved in the ascorbate-glutathione cycle might be closely correlated to the accumulation of H2O2. The less regeneration of ASA and GSH and the lower capacity of the ascorbate-glutathione cycle observed in vitrified shoots might be due to a significant decrease in APX, MDAR, DHAR and GR activities and a decline in redox status of ASA and GSH. The decreases in chlorphyll content might result in a decline in photosynthesis. The lower activities of POD and PAL could result in the decrease of lignin synthesis and cell wall ligination, which might be the key factor leading to the increase in water content. It is concluded that the deficiency of detoxification capacity caused by the lower capacity of the ascorbate-glutathione pathway and the decreased activity of protective enzymatic system might lead to the

  7. Does freezing and dynamic flexing of frozen branches impact the cavitation resistance of Malus domestica and the Populus clone Walker?

    Science.gov (United States)

    Christensen-Dalsgaard, Karen K; Tyree, Melvin T

    2013-11-01

    Frost damage to the xylem conduits of trees is a phenomenon of eco-physiological importance. It is often documented in terms of the percentage loss of conductivity (PLC), an indicator of air filling of the conduits. However, trees that refill their conduits in spring could be impacted more by damage to the conduits that reduce cavitation resistance, making them more susceptible to future drought events. We investigated whether ice formation, dynamic flexing of frozen branches or freeze-thaw events could reduce the cavitation resistance (cause "frost fatigue") in first-year shoots of apple (Malus domestica) and clonal hybrid cottonwood (Walker). Frost fatigue was measured in terms of P50 (the negative xylem pressure required to cause a 50 % loss of conductivity). All treatment groups showed significant frost fatigue, with the exception of the pre-flushed, constantly frozen poplar branches. The P50 following freeze treatments was approximately 50 % of the pre-freeze values. The effect tended to be greater in freeze-thawed branches. Dynamic bending of the branches had no effect on either PLC or P50. In three out of four cases, there was a significant correlation between P50 and PLC. Frost fatigue occurred in both apple and poplar, two unrelated species with different drought and frost tolerances, suggesting that it may be a widespread phenomenon that could impact the ecophysiology of temperate forests.

  8. Cloning and characterization of a FLORICAULA/LEAFY ortholog, PFL, in polygamous papaya

    Institute of Scientific and Technical Information of China (English)

    Qingyi YU; Paul H. MOORE; Henrik H. ALBERT; Adrienne H.K. ROADER; Ray MING

    2005-01-01

    The homologous genes FLORICAULA (FLO) in Antirrhinum and LEAFY (LFY) in Arabidopsis are known to regulate the initiation of flowering in these two distantly related plant species. These genes are necessary also for the expression of downstream genes that control floral organ identity. We used Arabidopsis LFY cDNA as a probe to clone and sequence a papaya ortholog of LFY, PFL. It encodes a protein that shares 61% identity with the Arabidopsis LFY gene and 71% identity with the LFYhomologs of the two woody tree species: California sycamore (Platanus racemosa) and black cottonwood (Populus trichocarpa). Despite the high sequence similarity within two conserved regions, the N-terminal proline-rich motif in papaya PFL differs from other members in the family. This difference may not affect the gene function of papaya PFL, since an equally divergent but a functional LFY ortholog NEEDLY of Pinus radiata has been reported. Genomic and BAC Southern analyses indicated that there is only one copy of PFL in the papaya genome. In situ hybridization experiments demonstrated that PFL is expressed at a relatively low level in leaf primordia,but it is expressed at a high level in the floral meristem. Quantitative PCR analyses revealed that PFL was expressed in flower buds of all three sex types - male, female, and hermaphrodite with marginal difference between hermaphrodite and unisexual flowers. These data suggest that PFL may play a similar role as LFY in flower development and has limited effect on sex differentiation in papaya.

  9. Acetylesterase-Mediated Deacetylation of Pectin Impairs Cell Elongation, Pollen Germination, and Plant Reproduction

    Energy Technology Data Exchange (ETDEWEB)

    Gou J. Y.; Liu C.; Miller, L. M.; Hou, G.; Yu, X.-H.; Chen, X.-Y.

    2012-01-01

    Pectin is a major component of the primary cell wall of higher plants. Some galacturonyl residues in the backbone of pectinaceous polysaccharides are often O-acetylated at the C-2 or C-3 position, and the resulting acetylesters change dynamically during the growth and development of plants. The processes involve both enzymatic acetylation and deacetylation. Through genomic sequence analysis, we identified a pectin acetylesterase (PAE1) from black cottonwood (Populus trichocarpa). Recombinant Pt PAE1 exhibited preferential activity in releasing the acetate moiety from sugar beet (Beta vulgaris) and potato (Solanum tuberosum) pectin in vitro. Overexpressing Pt PAE1 in tobacco (Nicotiana tabacum) decreased the level of acetyl esters of pectin but not of xylan. Deacetylation engendered differential changes in the composition and/or structure of cell wall polysaccharides that subsequently impaired the cellular elongation of floral styles and filaments, the germination of pollen grains, and the growth of pollen tubes. Consequently, plants overexpressing PAE1 exhibited severe male sterility. Furthermore, in contrast to the conventional view, PAE1-mediated deacetylation substantially lowered the digestibility of pectin. Our data suggest that pectin acetylesterase functions as an important structural regulator in planta by modulating the precise status of pectin acetylation to affect the remodeling and physiochemical properties of the cell wall's polysaccharides, thereby affecting cell extensibility.

  10. [A review of the genomic and gene cloning studies in trees].

    Science.gov (United States)

    Yin, Tong-Ming

    2010-07-01

    Supported by the Department of Energy (DOE) of U.S., the first tree genome, black cottonwood (Populus trichocarpa), has been completely sequenced and publicly release. This is the milestone that indicates the beginning of post-genome era for forest trees. Identification and cloning genes underlying important traits are one of the main tasks for the post-genome-era tree genomic studies. Recently, great achievements have been made in cloning genes coordinating important domestication traits in some crops, such as rice, tomato, maize and so on. Molecular breeding has been applied in the practical breeding programs for many crops. By contrast, molecular studies in trees are lagging behind. Trees possess some characteristics that make them as difficult organisms for studying on locating and cloning of genes. With the advances in techniques, given also the fast growth of tree genomic resources, great achievements are desirable in cloning unknown genes from trees, which will facilitate tree improvement programs by means of molecular breeding. In this paper, the author reviewed the progress in tree genomic and gene cloning studies, and prospected the future achievements in order to provide a useful reference for researchers working in this area.

  11. Transición de madera juvenil a madura en un clon de Populus deltoides implantado en Buenos Aires Argentina

    OpenAIRE

    Cobas,Ana C; María C. Area; Monteoliva,Silvia

    2013-01-01

    El objetivo del trabajo fue determinar la edad de transición de madera juvenil a madura a partir de las propiedades de la madera en un clon de álamo. Se muestrearon cinco árboles de 17 años de Populus deltoides "Australia 129/60" de una plantación comercial. Se tomaron muestras a cinco alturas en el fuste: 0,3 m, 1,3 m, 4,2 m, 8,1 m y 15,9 m y se determinó anualmente: crecimiento, densidad de la madera, morfometría de fibras y vasos y área de pared. La edad de transición de madera juvenil a m...

  12. Cloning and expression of DREBgene from Populus albaxp%银中杨DREB基因的克隆及表达

    Institute of Scientific and Technical Information of China (English)

    翟俊峰; 王法微; 王南; 张闯; 迟晓娟; 宗俊梅; 李海燕

    2012-01-01

    【目的】克隆银中杨抗逆转录因子DREB基因,为其功能的深入研究奠定基础。【方法】根据DREBAP2/EREBP保守区设计1对简并引物,采用PCR方法对银中杨(Populus albaxp)转录因子DREB基因中间片段进行克隆;再利用反向PCR方法对该基因的旁侧序列进行克隆,最终将两侧序列与中间片段拼接得到基因全长;同时,根据基因序列设计1对特异引物,利用荧光定量PCR分析银中杨DREB基因在不同逆境胁迫中的表达情况。【结果】成功地从银中杨中克隆到1个DREB基因,命名为PaDREB(注册号:EF582843)。该基因序列长935bp,ORF为819bp,编码272个氨基酸;同源性比较与系统发育分析证实,银中杨DREB属于DREB转录因子家族,并与月季DREB2C具有较高的同源性;荧光定量PCR检测结果显示,盐、低温、干旱及ABA均能诱导DREB基因的表达。【结论】首次从银中杨中分离并克隆了DREB基因,并证实其参与了银中杨对盐、低温、干旱及ABA的应答。%【Objective】 The study was done to clone the stress induced DREB transcription factor gene from Populus albaxp and provide a starting point for the further studies in functional analysis.【Method】 We firstly cloned the partial fragment of DREB gene from Populus albaxp using homology cloning methods,according to AP2/EREBP conserved sequences.Then,the flanking sequence of DREB gene was obtained using reverse PCR.The flanking sequences and the partial fragment were combined to a full length sequence,named PaDREB.A real-time PCR was performed to observe the expression profiling of PaDREB under various stresses using a pair of specific primers.【Result】 We obtained the full length of PaDREB gene and submitted to Genbank(Accessed Number:EF582843).The full-length of cDNA is 935 bp and the open reading frame(ORF) is 819 bp,encoding 272 amino acids;Phylogenetic trees showed that PaDREB belongs to the DREB super family and shared a higher

  13. Changes in photosynthesis, mesophyll conductance to CO2, and isoprenoid emissions in Populus nigra plants exposed to excess nickel.

    Science.gov (United States)

    Velikova, Violeta; Tsonev, Tsonko; Loreto, Francesco; Centritto, Mauro

    2011-05-01

    Poplar (Populus nigra) plants were grown hydroponically with 30 and 200 μM Ni (Ni30 and Ni200). Photosynthesis limitations and isoprenoid emissions were investigated in two leaf types (mature and developing). Ni stress significantly decreased photosynthesis, and this effect depended on the leaf Ni content, which was lower in mature than in developing leaves. The main limitations to photosynthesis were attributed to mesophyll conductance and metabolism impairment. In Ni-stressed developing leaves, isoprene emission was significantly stimulated. We attribute such stimulation to the lower chloroplastic [CO2] than in control leaves. However chloroplastic [CO2] did not control isoprene emission in mature leaves. Ni stress induced the emission of cis-β-ocimene in mature leaves, and of linalool in both leaf types. Induced biosynthesis and emission of isoprenoids reveal the onset of antioxidant processes that may also contribute to reduce Ni stress, especially in mature poplar leaves. Copyright © 2010 Elsevier Ltd. All rights reserved.

  14. Influences of the Populus deltoids seedlings treated with exogenous methyl jasmonate on the growth and development of Lymantria dispar larvae

    Institute of Scientific and Technical Information of China (English)

    HU Zeng-hui; ZHAO Ling; YANG Di; SHEN Ying-bai; SHEN Fan-yi

    2006-01-01

    Lyantria dispar larvae were fed with the leaves of Populus deltoids seedlings exposed to methyl jasmonate (MeJA) for 24 h. The growth and development of the larvae were investigated, and phenolics contents in treated leaves including pyrocatechol, caffeic acid, coumarin, ferulic acid and benzoic acid were also surveyed by high-pressure liquid chromatography (HPLC). Results indicated that approximate digestibility, efficiency of conversion of ingested food, efficiency of conversion of digested food, and weight of the larvae were inhibited obviously, especially from the sixth day, which may result from the increase of total phenolics contents in treated leaves. This result provides strong supports for MeJA acting as the airborne signal molecule between woody plants.

  15. Age Structure and Growth of Degraded Populus euphratica Floodplain Forests in North-west China and Perspectives for Their Recovery

    Institute of Scientific and Technical Information of China (English)

    Janneke Westermann; Stefan Zerbe; Dieter Eckstein

    2008-01-01

    The Populus euphratica floodplain forests along the lower reaches of the Tarim River in continental-arid Xinjiang (north-west China) have been declining in recent decades as a result of dam constructions and the withdrawal of water from the river. Since 2000, controlled flooding has been carried out to counteract this process of degradation. However, the consequences of a changing water regime for the floodplain ecosystem are not yet sufficiently investigated. In 2004 we sampled a total of 150 P. euphratica trees along two transects at the middle and lower reaches of the Tarim River to compare the age structure and growth of these two tree populations. The anthropogenic drawdown of the groundwater table had no effect on the average growth of the trees at the lower reaches. However, tree growth abruptly increased after controlled flooding, thus showing distinct signs of recovery.

  16. High Level Expression of Glucose-6-phosphate Dehydrogenase Gene PsG6PDH from Populus suaveolens in E. coli

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    In order to investigate the functions of the gene PsG6PDH and the mechanisms underlying freezing tolerance of Populus suaveolens, the recombinant expression vector pET-G (pET30a-G6PDH), which contained full encoding region of PsG6PDH gene, was established. The recombinant was identified by lawn-PCR and double enzyme digestion and then transformed into expression host XA90 and induced by isopropyl-a-D-thiogalactoside (IPTG) to express 100 kD polypeptide of G6PDH fusion protein. The results showed that the expressed amount of the fusion protein culminated after 1 mmol·L-1 IPTG treatment for 4 h and that pET-G product was predominately soluble and not extra-cellular secreting.

  17. Somatic embryogenesis and plant regeneration from cell suspension and tissue cultures of mature himalayan poplar (Populus ciliata).

    Science.gov (United States)

    Cheema, G S

    1989-02-01

    Somatic embryogenesis and plantlet formation were obtained from callus and cell suspension cultures of 40-year- old Himalayan Poplar (Populus ciliata Wall ex Royle). Callus and cell suspensions were obtained by transfer of inoculum of semiorganized leaf cultures, which were maintained on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), to MS with 2,4-dichlorophenoxyacetic acid (2,4-D). Reduction of 2,4-D concentration during subsequent subculture of cell suspensions resulted in the formation of embryoids. These embryoids developed further only after being transferred to agar-based MS medium supplemented with BAP and naphthalene acetic acid. Loss of embryogenic potential was observed in cell suspensions after 6 subcultures. However, callus cultures retained the embryogenic potential even after repeated subcultures for more than a year. Plantlets could be successfully hardened and grown in natural outdoor conditions.

  18. Underground riparian wood: Buried stem and coarse root structures of Black Poplar (Populus nigra L.)

    Science.gov (United States)

    Holloway, James V.; Rillig, Matthias C.; Gurnell, Angela M.

    2017-02-01

    Despite the potential importance of tree species in influencing the processes of wood recruitment, transport, retention, and decay that control river wood budgets, focus has been relatively limited on this theme within fluvial wood research. Furthermore, one of the least investigated topics is the belowground living wood component of riparian trees. This paper presents observations of the morphology and age of buried stem and coarse root structures of eight Populus nigra individuals located in the riparian woodland of two sites on the middle to lower Tagliamento River, Italy. This species was selected because of its wide distribution along European rivers and its frequent dominance of riparian woodland. Each tree was excavated by hand to expose a minimum of half of the root system with complete exposure of the main axis. Smaller roots were then removed and larger protruding roots cut back to permit access to the main axis. The excavated structures were photographed from multiple angles for photogrammetric modelling; the structure and character of the exposed sediments around the tree's main axis were recorded; and wood samples were taken from the main aboveground stem(s), sections of the main buried axis, and major roots for dendrochronological analysis. Results from these field observations and laboratory dating of the wood samples were combined to describe the belowground morphology of each tree and to draw inferences concerning the impact of fluvial disturbances. Common features of these excavated structures included: (i) rooting depths to below the bar surface where the original tree established, with many young roots also existing at depth; (ii) translocation of the main buried axis in a downstream direction; (iii) a main buried axis comprised mainly of stems that have become buried and then generated new shoots, including multistem patches, and adventitious roots; (iv) the presence of steps and bends in the main buried axis associated with the generation of

  19. Allelic variation in PtoPsbW associated with photosynthesis, growth, and wood properties in Populus tomentosa.

    Science.gov (United States)

    Wang, Longxin; Wang, Bowen; Du, Qingzhang; Chen, Jinhui; Tian, Jiaxing; Yang, Xiaohui; Zhang, Deqiang

    2017-02-01

    Photosynthesis is one of the most important reactions on earth. PsbW, a nuclear-encoded subunit of photosystem II (PSII), stabilizes PSII structure and plays an important role in photosynthesis. Here, we used candidate gene-based linkage disequilibrium (LD) mapping to detect significant associations between allelic variations of PtoPsbW and traits related to photosynthesis, growth, and wood properties in Populus tomentosa. PtoPsbW showed the highest expression in leaves and it increased during the development of these leaves, suggesting that PtoPsbW may play an important role in plant growth and development. Analysis of nucleotide diversity and LD revealed that PtoPsbW has low single-nucleotide polymorphism (SNP) diversity (π tot = 0.0048 and θ w = 0.0050) and relatively low average value of LD (0.1500), indicating that PtoPsbW is conserved due to its indispensable function. Using single-SNP associations in an association population of 435 individuals, we identified five significant associations at the threshold of P ≤ 0.05, explaining 3.28-15.98 % of the phenotypic variation. Haplotype-based association analyses indicated that 13 haplotypes (P ≤ 0.05) from six blocks were associated with photosynthesis, growth, and wood properties. Our work shows that identifying allelic variation and LD can help to decipher the genetic basis of photosynthesis and could potentially be applied for molecular marker-assisted selection in Populus.

  20. Distinct Microbial Communities within the Endosphere and Rhizosphere of Populus deltoides Roots across Contrasting Soil Types ▿†

    Science.gov (United States)

    Gottel, Neil R.; Castro, Hector F.; Kerley, Marilyn; Yang, Zamin; Pelletier, Dale A.; Podar, Mircea; Karpinets, Tatiana; Uberbacher, Ed; Tuskan, Gerald A.; Vilgalys, Rytas; Doktycz, Mitchel J.; Schadt, Christopher W.

    2011-01-01

    The root-rhizosphere interface of Populus is the nexus of a variety of associations between bacteria, fungi, and the host plant and an ideal model for studying interactions between plants and microorganisms. However, such studies have generally been confined to greenhouse and plantation systems. Here we analyze microbial communities from the root endophytic and rhizospheric habitats of Populus deltoides in mature natural trees from both upland and bottomland sites in central Tennessee. Community profiling utilized 454 pyrosequencing with separate primers targeting the V4 region for bacterial 16S rRNA and the D1/D2 region for fungal 28S rRNA genes. Rhizosphere bacteria were dominated by Acidobacteria (31%) and Alphaproteobacteria (30%), whereas most endophytes were from the Gammaproteobacteria (54%) as well as Alphaproteobacteria (23%). A single Pseudomonas-like operational taxonomic unit (OTU) accounted for 34% of endophytic bacterial sequences. Endophytic bacterial richness was also highly variable and 10-fold lower than in rhizosphere samples originating from the same roots. Fungal rhizosphere and endophyte samples had approximately equal amounts of the Pezizomycotina (40%), while the Agaricomycotina were more abundant in the rhizosphere (34%) than endosphere (17%). Both fungal and bacterial rhizosphere samples were highly clustered compared to the more variable endophyte samples in a UniFrac principal coordinates analysis, regardless of upland or bottomland site origin. Hierarchical clustering of OTU relative abundance patterns also showed that the most abundant bacterial and fungal OTUs tended to be dominant in either the endophyte or rhizosphere samples but not both. Together, these findings demonstrate that root endophytic communities are distinct assemblages rather than opportunistic subsets of the rhizosphere. PMID:21764952

  1. The sucrose transporter family in Populus: the importance of a tonoplast PtaSUT4 to biomass and carbon partitioning.

    Science.gov (United States)

    Payyavula, Raja S; Tay, Kate H C; Tsai, Chung-Jui; Harding, Scott A

    2011-03-01

    Plasma membrane, proton-coupled Group II sucrose symporters (SUT) mediate apoplastic phloem loading and sucrose efflux from source leaves in Arabidopsis and agricultural crop species that have been studied to date. We now report that the most abundantly expressed SUT isoform in Populus tremula×alba, PtaSUT4, is a tonoplast (Group IV) symporter. PtaSUT4 transcripts were readily detected in conducting as well as mesophyll cells in stems and source leaves. In comparison, Group II orthologs PtaSUT1 and PtaSUT3 were very weakly expressed in leaves. Both Group II and Group IV SUT genes were expressed in secondary stem xylem of Populus. Transgenic poplars with RNAi-suppressed PtaSUT4 exhibited increased leaf-to-stem biomass ratios, elevated sucrose content in source leaves and stems, and altered phenylpropanoid metabolism. Transcript abundance of several carbohydrate-active enzymes and phenylalanine ammonia-lyases was also altered in transgenic source leaves. Nitrogen-limitation led to a down-regulation of vacuolar invertases in all plants, which resulted in an augmentation of sucrose pooling and hexose depletion in source leaves and secondary xylem of the transgenic plants. These results are consistent with a major role for PtaSUT4 in orchestrating the intracellular partitioning, and consequently, the efflux of sucrose from source leaves and the utilization of sucrose by lateral and terminal sinks. Our findings also support the idea that PtaSUT4 modulates sucrose efflux and utilization in concert with plant N-status.

  2. Mountain Hike North of Big Cottonwood Canyon Road, Begining at the S-Turn at Mill B., Near Hidden Falls, and Taking Trail Leading to Mt. Raymond and Other Intersting Places.

    Science.gov (United States)

    McDonald, Keith L.

    2004-11-01

    Our first objective is to leave the highway via Mill B North Fork by taking the Big Cottonwood Canyon trail that leads to Maxfield Basin, where 3 trails intersect, just s. of Mount Raymond (Elev. 10,241 ft.) the n. trail takes us down to the Mill Creek Canyon Road, at about 1 mi. (+) east of intersection with Church Park Picnic Ground road. At Maxfield Basin, again, the east trail skirts around Mt. Raymond and has another intersection with a trail running n. thru the area of Gobblers Knob (elev. 10,246 ft.), to White Fir Pass and turns w. at Bowman Fk. until it connects with Porter Fork and then the Mill Creek Road. The remaining trail at Mill A Basin, just e. of Mount Raymond, long before Gobblers Knob is seen, runs east past a spring, and connects to Butler Fork (which begins at 3.775 mi., measured along highway from Mill B, North Fork), which leads directly to Dog Lake. Evidently both Dog Lake and Lake Desolation (changing U.S. Geological Survey maps from Mount Aire, Utah to Park City West, Utah) have connected outlets, at least during certain times of the year. Following the trail s. e. (down) that follows near Summit Co. and Salt Lake County, we pass by the radio transmitters shown on Park City, West, Utah, map and finally enter the Brighton, Utah map with Scott Hill, Scott Pass, the important highway leading to Midway Reservoir, and beyond, Bloods Lake ( 9500 ft.), Clayton Peak (10,721 ft.) and Lake Lackawaxen ( 9980 ft.), our final destination showing through. One may easily walk the distance to lake Lackawaxen from Bloods Lake by staying south of the ridgecrest and by following the hollow down for a while. This completes our destination. Recall that the main roadway here was already passed over about 1/2 mile n. of Bloods Lake; this thoroughfare has its beginning at about 0.4 miles below (or North) of the Brighton Loop, where the road to city of Midway leaves the main Big Cottonwood Highway going n. and runs e., on the average, going past Midway Reservoir

  3. Structure and diversity of ground mesofauna inUlmus and Populus consortia in the industrial areas of mining and smelting complex of krivyi rig basin

    Directory of Open Access Journals (Sweden)

    V. V. Kachinskaya

    2010-05-01

    Full Text Available The structure and biological diversity of ground mesofauna on a consortium level of organisation of ecosystems are considered. Indicators of structural organisation and biodiversity of ground mesofauna were analised in Ulmus and Populus consortia in the conditions of industrial territories of mining and smelting complex of Krivyi Rig Basin. It is established that taxonomical structure of ground mesofauna is characterised by insignificant number and quantity of taxonomical groups. Prevalence of hortobionts and herpetobionts in morpho-ecological structure of the community testifies to their attachment to consortium’s determinants and influence of steppe climate on its structure. Dominance of phytophages and polyphages in trophic structure is caused by a combination of consortium determinants specificity and «a zone source» of the fauna formations. The structural organisation of ground mesofauna in consortia of Ulmus and Populus in the conditions of industrial sites is characterised by simplified taxonomical structure with low biodiversity at all levels.

  4. THE FIBER MORPHOLOGY VARIATION OF TRIPLOID CLONE OF POPULUS TOMENTOSA CARR.AND ITS SUPPOSED HARVESTING AGE FOR THE PAPER INDUSTRY

    Institute of Scientific and Technical Information of China (English)

    Yongming Fan; Zhiyi Zhang; Yimin Xie; dakai Ren; yuanyuan Luo; yuying Wu; jing He

    2004-01-01

    The fiber morphology variation of triploid clone of Populus tomentosa Carr. and the supposed harvesting age for the paper industry were investigated in this paper. The results shows that in the first few years,2-4 years for example, the fiber length at breast high grows faster than it does in the later years. But the standard deviation of distribution in fiber length at breast high in mature wood is larger than in the young tree. The technologically harvestable age of triploid clone of Populus tomentosa Carr., BL304could be 4-7 year old to meet the requirement for paper industry. The distribution of fiber length become concentrated within an annual ring as the tree grows. The test results also show that the cloned poplar has a small Runkel ratio value (less than 0.4,generally about 0.3), and this ratio increases slightly with the tree grows.

  5. 雾灵山自然保护区的山杨林%ASPEN (Populus davidiana) FOREST IN WULING   MOUNTAIN NATURAL RESERVE

    Institute of Scientific and Technical Information of China (English)

    郭文增

    2001-01-01

    The researches on Populus davidiana forest were carried out in Wuling Mountain Natural Reserve. It expounded its distribution, habitat, physiognomy character (biological spectrum, leaf-size class, leaf-tepe, leaf-margin), structural feature(synusia, vertical stratification, quantitative character), and predicated on the succession dynamic status of Populus davidiana forest was put forward.%对雾灵山自然保护区的山杨林进行了研究。详细论述了其分布、生境、种类组成、外貌特征(生活型谱、叶级、叶形、叶缘)、结构特征(层次、层片、综合数量特征),并对其演替动态进行了分析。

  6. THE FIBER MORPHOLOGY VARIATION OF TRIPLOID CLONE OF POPULUS TOMENTOSA CARR.AND ITS SUPPOSED HARVESTING AGE FOR THE PAPER INDUSTRY

    Institute of Scientific and Technical Information of China (English)

    YongmingFan; ZhiyiZhang; YiminXie; dakaiRen; yuanyuanLuo; yuyingWu; jingHe

    2004-01-01

    The fiber morphology variation of triploid clone of Populus tomentosa Cart. and the supposed harvesting age for the paper industry were investigated in this paper. The results shows that in the first few years, 2-4 years for example, the fiber length at breast highg rows faster than it does in the later years. But the standard deviation of distribution in fiber length at breast high in mature wood is larger than in the young tree. The technologically harvestable age of triploid clone of Populus tomentosa Carr., BL304 could be 4-7 year old to meet the requirement for paper industry. The distribution of fiber length become concentrated within an annual ring as the tree grows. The test results also show that the cloned poplar has a small Runkel ratio value (less than 0.4, generally about 0.3), and this ratio increases slightly with the tree grows.

  7. Transcriptional profiling by cDNA-AFLP analysis showed differential transcript abundance in response to water stress in Populus hopeiensis

    OpenAIRE

    Song Yuepeng; Wang Zeliang; Bo Wenhao; Ren Yuanyuan; Zhang Zhiyi; Zhang Deqiang

    2012-01-01

    Abstract Background Drought is one of the main environmental factors limiting tree growth and productivity of plantation forests worldwide. Populus hopeiensis Hu et Chow is one of the most important commercial plantation tree species in China. However, the genes controlling drought tolerance in this species have not been identified or characterized. Here, we conducted differential expression analyses and identified a number of genes that were up- or downregulated in P. hopeiensis during water...

  8. Examination of correlation between histidine and nickel absorption by Morus L., Robinia pseudoacacia L. and Populus nigra L. using HPLC-MS and ICP-MS.

    Science.gov (United States)

    Ozen, Sukran Akkus; Yaman, Mehmet

    2016-08-02

    In this study, HPLC-MS and ICP-MS methods were used for the determination of histidine and nickel in Morus L., Robinia pseudoacacia L., and Populus nigra L. leaves taken from industrial areas including Gaziantep and Bursa cities. In the determination of histidine by HPLC-MS, all of the system parameters such as flow rate of mobile phase, fragmentor potential, injection volume and column temperature were optimized and found to be 0.2 mL min(-1), 70 V, 15 µL, and 20°C, respectively. Under the optimum conditions, histidine was extracted from plant sample by distilled water at 90°C for 30 min. Concentrations of histidine as mg kg(-1) were found to be between 2-9 for Morus L., 6-13 for Robinia pseudoacacia L., and 2-10 for Populus nigra L. Concentrations of nickel were in the ranges of 5-10 mg kg(-1) for Morus L., 3-10 mg kg(-1) for Robinia pseudoacacia L., and 0.6-4 mg kg(-1) for Populus nigra L. A significant linear correlation (r = 0.78) between histidine and Ni was observed for Populus nigra L., whereas insignificant linear correlation for Robinia pseudoacacia L. (r = 0.22) were seen. Limits of detection (LOD) and quantitation (LOQ) were found to be 0.025 mg Ni L(-1) and 0.075 mg Ni L(-1), respectively.

  9. Down-Regulation of KORRIGAN-Like Endo-β-1,4-Glucanase Genes Impacts Carbon Partitioning, Mycorrhizal Colonization and Biomass Production in Populus

    OpenAIRE

    2016-01-01

    A greater understanding of the genetic regulation of plant cell wall remodeling and the impact of modified cell walls on plant performance is important for the development of sustainable biofuel crops. Here, we studied the impact of down-regulating KORRIGAN-like cell wall biosynthesis genes, belonging to the endo-β-1,4-glucanase gene family, on Populus growth, metabolism and the ability to interact with symbiotic microbes. The reductions in cellulose content and lignin syringyl-to-guaiacyl un...

  10. Down-regulation of KORRIGAN-like endo-β-1,4-glucanase genes impacts carbon partitioning, mycorrhizal colonization and biomass production in Populus

    OpenAIRE

    2016-01-01

    A greater understanding of the genetic regulation of plant cell wall remodeling and the impact of modified cell walls on plant performance is important for the development of sustainable biofuel crops. Here, we studied the impact of down-regulating KORRIGAN-like cell wall biosynthesis genes, belonging to the endo-β-1,4-glucanase gene family, on Populus growth, metabolism and the ability to interact with symbiotic microbes. The reductions in cellulose content and lignin syringyl-to-guaiacyl un...

  11. Transpirational water loss in invaded and restored semiarid riparian forests

    Science.gov (United States)

    Georgianne W. Moore; M. Keith Owens

    2011-01-01

    The invasive tree, Tamarix sp., was introduced to the United States in the 1800s to stabilize stream banks. The riparian ecosystem adjacent to the middle Rio Grande River in central NewMexico consists of mature cottonwood (Populus fremontii ) gallery forests with a dense Tamarix understory. We hypothesized that Populus would compensate for reduced competition by...

  12. Allelic variation in PtGA20Ox associates with growth and wood properties in Populus spp.

    Directory of Open Access Journals (Sweden)

    Jiaxing Tian

    Full Text Available Populus tomentosa is an economically important tree crop that produces wood for lumber, pulp, paper, and biofuels. Wood quality traits are likely to be strongly affected by the plant hormone gibberellic acid (GA, which regulates growth. GA20Ox encodes one of the major regulatory enzymes of GA biosynthesis and may therefore play a large role in growth and wood quality. Here, linkage disequilibrium (LD studies were used to identify significant associations between single nucleotide polymorphisms (SNPs within PtGA20Ox and growth and wood-quality traits of P. tomentosa. We isolated a full-length GA20Ox cDNA from Populus tomentosa by reverse transcription (RT-PCR; this 1401 bp cDNA clone had an open reading frame of 1158 bp and encoded a protein of 385 amino acids. PtGA20Ox transcripts were maximally expressed in the mature xylem of vascular tissues, suggesting that PtGA20Ox is highly expressed and specifically associated with secondary xylem formation. Resequencing the PtGA20Ox locus of 36 individuals identified 55 SNPs, and the frequency of SNPs was 1/31 bp. The 29 most common SNPs (frequency>0.1 were genotyped in an association population (426 individuals that was also phenotyped for key growth and wood quality traits. LD did not extend over the entire gene (r(2<0.1, within 500 bp, demonstrating that a candidate-gene-based LD approach may the best way to understand the molecular basis underlying quantitative variation in this species. SNP- and haplotype-based association analyses indicated that four SNPs (false discovery rate Q<0.05 and 14 haplotypes (P<0.05 were significantly associated with growth and wood properties. The phenotypic variance explained by each SNP ranged from 3.44% to 14.47%. The SNP markers identified in this study can be applied to breeding programs for the improvement of growth and wood-property traits by marker-assisted selection.

  13. Ecuación de volumen total para Populus deltoides de plantaciones del bajo delta del Paraná

    Directory of Open Access Journals (Sweden)

    FERNÁNDEZ TSCHIEDER, E.

    2011-08-01

    Full Text Available Las ecuaciones de volumen son una herramienta eficaz para la estimación del volumen del árbol individual, información que es esencial para la planificación y la gestión de rodales forestales. Las ecuaciones de volumen para Populus spp. (álamo en el Delta del Paraná son escasas y no existen para clones ampliamente difundidosen la actualidad. El objetivo de este trabajo fue ajustar una ecuación estándar de volumen total, con y sin corteza, para los clones ‘Australiano 129/60’ y ‘Australiano 106/60’ de Populus deltoides. Se trabajó con árboles de plantaciones localizadas en campos protegidos contra las inundaciones por diques perimetrales de la región Islas del Río Carabelas. Se evaluó la capacidad de predicción de ecuaciones de volumen publicadas para la especie y se ajustaron seis ecuaciones de volumen, mediante técnicas de regresión lineal y no lineal ponderada, que fueron analizadas estadística y gráficamente. La estimación del volumen de los clones “australianos”a partir de modelos publicados resultó poco precisa. Todas las ecuaciones ajustadas presentaron muy buenos estadísticos de ajuste. Se seleccionó el modelo de Schumacher y Hall para la estimación del volumen total con y sin corteza. El rango de aplicación de los modelos va desde 11,1 cm hasta 55,1 cm de diámetro a 1,3 m de altura y desde 11,9 m hasta 37,5 m de altura total. El error medio obtenido en la autovalidación resultó -1,2% (0,001 m3 para el volumen total con corteza y -1,3% (0,000 m3 para el volumen total sin corteza, mientras que el error absoluto promedio fue 6,8% (0,041 m3 y 6,6% (0,034 m3 para el volumen total con y sin corteza, respectivamente.

  14. Global transcriptome analysis of Clostridium thermocellum ATCC 27405 during growth on dilute acid pretreated Populus and switchgrass

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Charlotte M [ORNL; Rodriguez Jr, Miguel [ORNL; Johnson, Courtney M [ORNL; Martin, S L. [North Carolina State University; Chu, Tzu Ming [SAS Institute; Wolfinger, Russ [SAS Institute; Hauser, Loren John [ORNL; Land, Miriam L [ORNL; Klingeman, Dawn Marie [ORNL; Tschaplinski, Timothy J [ORNL; Mielenz, Jonathan R [ORNL; Brown, Steven D [ORNL

    2013-01-01

    Background The thermophilic anaerobe Clostridium thermocellum is a candidate consolidated bioprocessing (CBP) biocatalyst for cellulosic ethanol production. The aim of this study was to investigate C. thermocellum genes required to ferment biomass substrates and to conduct a robust comparison of DNA microarray and RNA sequencing (RNA-seq) analytical platforms. Results C. thermocellum ATCC 27405 fermentations were conducted with a 5 g/L solid substrate loading of either pretreated switchgrass or Populus. Quantitative saccharification and inductively coupled plasma emission spectroscopy (ICP-ES) for elemental analysis revealed composition differences between biomass substrates, which may have influenced growth and transcriptomic profiles. High quality RNA was prepared for C. thermocellum grown on solid substrates and transcriptome profiles were obtained for two time points during active growth (12 hours and 37 hours postinoculation). A comparison of two transcriptomic analytical techniques, microarray and RNA-seq, was performed and the data analyzed for statistical significance. Large expression differences for cellulosomal genes were not observed. We updated gene predictions for the strain and a small novel gene, Cthe_3383, with a putative AgrD peptide quorum sensing function was among the most highly expressed genes. RNAseq data also supported different small regulatory RNA predictions over others. The DNA microarray gave a greater number (2,351) of significant genes relative to RNA-seq (280 genes when normalized by the kernel density mean of M component (KDMM) method) in an analysis of variance (ANOVA) testing method with a 5 % false discovery rate (FDR). When a 2-fold difference in expression threshold was applied, 73 genes were significantly differentially expressed in common between the two techniques. Sulfate and phosphate uptake/utilization genes, along with genes for a putative efflux pump system were some of the most differentially regulated transcripts

  15. Genetic structure of Populus hybrid zone along the Irtysh River provides insight into plastid-nuclear incompatibility.

    Science.gov (United States)

    Zeng, Yan-Fei; Zhang, Jian-Guo; Duan, Ai-Guo; Abuduhamiti, Bawerjan

    2016-06-16

    In plants, the maintenance of species integrity despite hybridization has often been explained by the co-adaption of nuclear gene complexes. However, the interaction between plastid and nuclear sub-genomes has been underestimated. Here, we analyzed the genetic structure of a Populus alba and P. tremula hybrid zone along the Irtysh River system in the Altai region, northwest China, using both nuclear microsatellites and plastid DNA sequences. We found high interspecific differentiation, although the hybrid P. × canescens was prevalent. Bayesian inference classified most hybrids into F1, followed by a few back-crosses to P. alba, and fewer F2 hybrids and back-crosses to P. tremula, indicating a few introgressions but preference toward P. alba. When plastid haplotypes in parental species were distinct, P. × canescens carried the haplotypes of both parents, but showed significant linkage between intraspecific haplotype and nuclear genotypes at several microsatellite loci. Selection, rather than migration and assortative mating, might have contributed to such plastid-nuclear disequilibria. By removing later-generated hybrids carrying interspecific combinations of haplotype and nuclear genotypes, plastid-nuclear incompatibility has greatly limited the gene exchange between P. alba and P. tremula via backcrossing with hybrids, demonstrating a significant association between plastid haplotype and the proportion of nuclear admixture.

  16. Comparative field performance of some agricultural crops under a ca-nopy of Populus deltoides and Ulmus wallichiana

    Institute of Scientific and Technical Information of China (English)

    Tariq Hussian Masoodi; Nasir Ahmad Masoodi; Sajad Ahmad Gangoo; Shah Murtaza Mushtaq; Hillal Ahmad

    2013-01-01

    The performance of maize, beans and sunflower was evalu-ated under a canopy of Populus deltoides and Ulmus wallichiana at Fac-ulty of Agriculture, Wadura. The germination, growth and yield of the three test crops were suppressed under both tree species. The reduction, however, decreased when the cultivation of test crops was continued for three years. The inhibition potential generally is in the order of P. del-toides U. wallichiana for beans. Available soil N, P and K increased under the canopy of the selected tree species. The soils under U. wallichiana were more fertile than those under P. deltoides. Chromatographic investigation of extracts showed that the soils under P. deltoides and U. wallichiana differed in their composition of phenolic acids and phenolic glycocides. Except for caffic acid, all other allelochemicals disappeared and were no longer recovered in soil samples obtained after the second or third year of cultivation. Tree-crop compatibility can be explored in greater detail for improved management of traditional agro-ecosystems in Kashmir to increase the overall productivity of the land.

  17. Identification of microRNAs Involved in Regeneration of the Secondary Vascular System in Populus tomentosa Carr

    Science.gov (United States)

    Tang, Fang; Wei, Hairong; Zhao, Shutang; Wang, Lijuan; Zheng, Huanquan; Lu, Mengzhu

    2016-01-01

    Wood formation is a complex developmental process primarily controlled by a regulatory transcription network. MicroRNAs (miRNAs) can modulate the expression of target genes involved in plant growth and development by inducing mRNA degradation and translational repression. In this study, we used a model of secondary vascular system regeneration established in Populus tomentosa to harvest differentiating xylem tissues over time for high-throughput sequencing of small RNAs. Analysis of the sequencing data identified 209 known and 187 novel miRNAs during this regeneration process. Degradome sequencing analysis was then performed, revealing 157 and 75 genes targeted by 21 known and 30 novel miRNA families, respectively. Gene ontology enrichment of these target genes revealed that the targets of 15 miRNAs were enriched in the auxin signaling pathway, cell differentiation, meristem development, and pattern specification process. The major biological events during regeneration of the secondary vascular system included the sequential stages of vascular cambium initiation, formation, and differentiation stages in sequence. This study provides the basis for further analysis of these miRNAs to gain greater insight into their regulatory roles in wood development in trees. PMID:27303419

  18. Prokaryotic expression analysis of an NBS-type PtDRGO1 gene isolated from Populus tomentosa Carr.

    Institute of Scientific and Technical Information of China (English)

    Yan LI; Qian ZHANG; Xing RAO; Haixia LI; Tingting LIU; Xinmin AN; Zhiyi ZHANG

    2009-01-01

    In order to investigate the protein features of an NBS gene (PtDRGOl, EF157840) isolated from Populus tomentosa Carr., the full-length open reading frame was fused into a prokaryotic expression vector pGEX-KG. PCR analysis and double endonuclease digestion showed that the recombinant vector was successfully constructed and transferred into an expression host E. coli strain XA90. It was indicated by SDS-PAGE analysis that IPTG treatment successfully induced the expression of a fusion protein of about 79 kD, which was consistent with the predicted value. In addition, the prokaryotic expression system was also optimized. The result suggests that lmmol/L IPTG treatment for 4h at 37 C was most effective, and the product was predominately soluble and not extra-cellular secreting. Moreover, the fusion protein was purified with an affinity chromatography column using Glutathione Sepharose 4B. This work will lay a foundation for further studies on biological functions of the PtDRGOl gene.

  19. The Populus Class III HD ZIP transcription factor POPCORONA affects cell differentiation during secondary growth of woody stems.

    Science.gov (United States)

    Du, Juan; Miura, Eriko; Robischon, Marcel; Martinez, Ciera; Groover, Andrew

    2011-02-28

    The developmental mechanisms regulating cell differentiation and patterning during the secondary growth of woody tissues are poorly understood. Class III HD ZIP transcription factors are evolutionarily ancient and play fundamental roles in various aspects of plant development. Here we investigate the role of a Class III HD ZIP transcription factor, POPCORONA, during secondary growth of woody stems. Transgenic Populus (poplar) trees expressing either a miRNA-resistant POPCORONA or a synthetic miRNA targeting POPCORONA were used to infer function of POPCORONA during secondary growth. Whole plant, histological, and gene expression changes were compared for transgenic and wild-type control plants. Synthetic miRNA knock down of POPCORONA results in abnormal lignification in cells of the pith, while overexpression of a miRNA-resistant POPCORONA results in delayed lignification of xylem and phloem fibers during secondary growth. POPCORONA misexpression also results in coordinated changes in expression of genes within a previously described transcriptional network regulating cell differentiation and cell wall biosynthesis, and hormone-related genes associated with fiber differentiation. POPCORONA illustrates another function of Class III HD ZIPs: regulating cell differentiation during secondary growth.

  20. Foliar Carbon Isotope Composition (δ13C) and Water Use Efficiency of Different Populus deltoids Clones Under Water Stress

    Institute of Scientific and Technical Information of China (English)

    Zhao Fengjun; Gao Rongfu; Shen Yingbai; Su Xiaohua; Zhang Bingyu

    2006-01-01

    Foliar carbon isotope composition (δ13C),total dry biomass,and long-term water use efficiency (WUEL)of 12 Populus deltoids clones were studied under water stress in a greenhouse.Total dry biomass of clones decreased greatly,while δ13C increased.Single-element variance analysis in the same water treatment indicated that WUEL difference among clones was significant.Clones J2,J6,J7,J8,and J9 were excellent with high WUEL.Extremely significant δ13C differences among water treatments and clones were revealed by two-element variance analysis.Water proved to be the primary factor affecting δ13C under water stress.It showed that there was a good positive correlation between δ13C and WUEL in the same water treatment,and that a high WUEL always coincided with a high δ13C.δ13C might be a reliable indirect index to estimate WUEL among P.deltoids clones.

  1. Litter Quality of Populus Species as Affected by Free-Air CO2 Enrichment and N-Fertilization

    Directory of Open Access Journals (Sweden)

    Esther Vermue

    2009-01-01

    Full Text Available The effect of elevated CO2 and nitrogen fertilization on the molecular chemistry of litter of three Populus species and associated soil organic matter (SOM was investigated by pyrolysis-gas chromatography/mass spectrometry. The results are based on 147 quantified organic compounds in 24 litter samples. Litter of P. euramerica was clearly different from that of P. nigra and P. alba. The latter two had higher contents of proteins, polysaccharides, and cutin/cutan, while the former had higher contents of phenols and benzofurans/pyrans. The difference between replications was at least as large as the effect of treatments, so that no systematic chemical changes were attributable to CO2 effect or N-fertilization effect. The chemistry of SOM under the various species and treatments did not show significant changes either. The low number of available replicates that is two was clearly insufficient to overcome the effect of spatial variation on litter chemistry and detect small differences in molecular litter chemistry.

  2. Importance of crown architecture for leaf area index of different Populus genotypes in a high-density plantation.

    Science.gov (United States)

    Broeckx, L S; Verlinden, M S; Vangronsveld, J; Ceulemans, R

    2012-10-01

    Crown architecture is an important determinant of biomass production and yield of any bio-energy plantation since it determines leaf area display and hence light interception. Four Populus genotypes-of different species and hybrids and with contrasting productivity and leaf area-were examined in terms of their branch characteristics in relation to crown architecture during the first and second growing seasons after plantation establishment. The trees were planted at high density (8000 ha(-1)) on two different former land use types, cropland and pasture. We documented significant differences in branch architecture among the genotypes and for the first year among the former land use types. Land use effects only affected factors not related to canopy closure and wood production, and decreased after the first growing season. This suggested that both former land use types were equally suited for the establishment success of a poplar bio-energy plantation. Tree height and branch dimensions-branch diameter and branch length-were the most important determinants of wood production and maximum leaf area index. Despite the secondary importance of the number of sylleptic branches, these branches contributed significantly to the total leaf area in three out of the four studied genotypes. This indicated that enhanced syllepsis accelerates leaf area development and hence carbon assimilation, especially in the early stages of a high-density plantation with poplar.

  3. Comparative Physiological and Proteomic Analysis Reveals the Leaf Response to Cadmium-Induced Stress in Poplar (Populus yunnanensis.

    Directory of Open Access Journals (Sweden)

    Yunqiang Yang

    Full Text Available Excess amounts of heavy metals are important environmental pollutants with significant ecological and nutritional effects. Cdmium (Cd is of particular concern because of its widespread occurrence and high toxicity. We conducted physiological and proteomic analyses to improve our understanding of the responses of Populus yunnanensis to Cd stress. The plantlets experienced two apparent stages in their response to Cd stress. During the first stage, transiently induced defense-response molecules, photosynthesis- and energy-associated proteins, antioxidant enzymes and heat shock proteins (HSPs accumulated to enhance protein stability and establish a new cellular homeostasis. This activity explains why plant photosynthetic capability during this period barely changed. During the second stage, a decline of ribulose-1, 5-bisphosphate carboxylase (RuBisCO and HSP levels led to imbalance of the plant photosynthetic system. Additionally, the expression of Mitogen-activated protein kinase 3 (MPK3, Mitogen-activated protein kinase 6 (MPK6 and a homeobox-leucine zipper protein was higher in the second stage. Higher expression of caffeoyl-CoA O-methyltransferase (CCoAOMT may regulate plant cell wall synthesis for greater Cd storage. These genes may be candidates for further research and use in genetic manipulation of poplar tolerance to Cd stress.

  4. Leaf Morphology Variation of Populus nigra L. in Natural Populations along the Rivers in Croatia and Bosnia and Herzegovina

    Directory of Open Access Journals (Sweden)

    Davorin Kajba

    2015-06-01

    Full Text Available Background and Purpose: The aim was to determine the morphological differences between the hairy type of European black poplar (Populus nigra subsp. caudina and the typical type from the riparian forests populations as well as between the river systems. Hairy black poplar spreads in a mosaic pattern across the Submediterranean climatic type along the River Neretva and the typical European black poplar is growing on alluvial soils along large rivers in the territory of Croatia and Bosnia and Herzegovina. Material and Methods: Samples for leaf morphometric analysis were collected in 17 natural populations of European black poplar along six rivers in Croatia and Bosnia and Herzegovina. Results: Discriminant analyses have determined that in the differentiation of population groups largely contribute some characters such as the distance between the leaf widest part and the leaf base (DBW and the petiole length (PL. The differences between populations and analysed groups, as well as the differences between populations belonging to a particular river system, were confirmed for all studied characteristics. Conclusions: Significant differences have been determined between the typical and the hairy type of European black poplar in the studied morphological traits and these dissimilarities are in accordance with the climatic differences in respective habitats of continental riparian forests and the Submediterranean type of climate. Populations sampled in the lower course of the River Neretva, which correspond to the hairy type of the European black poplar, have smaller leaves and a greater angle between the first lower lateral vein and the midrib.

  5. Cloning and RNAi Construction of a LEAFY Homologous Gene from Populus tomentosa and Preliminary Study in Tobacco

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    PtLFY, a LEAFY (LFY) gene, was cloned from Populus tomentosa (LM50) by PCR. Sequencing analysis indicated that PtLFY was 2 629 bp long, composed of three exons and two introns and encoded 378 amino acids. The splice donor sites and the splice acceptor sites were in identical positions to the LFY and its homologues. The amino acid sequence inferred was 68%-99% homologous to those of LFY and its homologues by blast analysis in GenBank. The Southern blot analysis indicated that there was a single copy of the PtLFY gene in genomic DNA of male and female P. tomentosa (LM50 and 5082). The pBI121-Ptalfy (reverse)-intron-Ptlfy-GUS-nos was constructed using RNA interference (RNAi) technique and verified by PCR and digestion identification and transformed into tobacco. Some transgenic tobacco plants were obtained by PCR and PCR-Southern identification. The growth was generally repressed in transgenic tobacco plants compared with wild-type ones and some phenotypic differences were observed.

  6. Determination ecotypes of Populus caspica Bornm. in plain communities of Caspian forests using morphological markers of leaf and peroxidase isoenzymes

    Directory of Open Access Journals (Sweden)

    Hassan Fallah

    2011-06-01

    Full Text Available In order to determine ecotypes of Persian poplar (Populus caspica in plain communities, 40 tree individuals were selected in provinces of Guilan (Roodbar, Astane Ashrafieh and Mazandaran (Noor, Amol. Samples of two-year branches were taken in similar height and direction of tree crown to assess the quality of peroxidase activity using polyacrilamide gel electrophoresis (PAGE. Also, in numerical taxonomy study of morphology, 13 leaf morphologal traits were measured. Peroxidase banding pattern showed 11 individual bands in two zones of polyacrilamide gel. First zone included 5 polymorphism bands and the second zone represented 6 bands. The results of isoenzyme bands classification and leaf morphological traits showed high isoenzymes and morphological differentiation among populations of these species showing three separated ecotypes including Roodbar, Astaneh Ashrafieh and Noor-Amol. Also, peroxidase band pattern and leaf morphology trait between male and female individuals showed no difference within the population. The results emphasize the used of effective methods of in situ and ex situ to maintain genetic diversity of this species as an endangered and valuable in Hyrcanian forests.

  7. Identification of novel and conserved Populus tomentosa microRNA as components of a response to water stress.

    Science.gov (United States)

    Ren, Yuanyuan; Chen, Lei; Zhang, Yiyun; Kang, Xiangyang; Zhang, Zhiyi; Wang, Yanwei

    2012-06-01

    MicroRNAs (miRNAs) are a class of small, non-coding RNAs that play important downregulation roles in plants growth, development, and stress responses. To better identify Populus tomentosa miRNAs and understand the functions of miRNAs in response to water stress (drought and flooding), 152 conserved miRNAs belonging to 36 miRNA families, 8 known but non-conserved miRNAs and 64 candidate novel miRNAs belonging to 54 miRNA families were identified and analyzed from three small RNA (sRNA) libraries (drought treatment, flooding treatment, and control) by high-throughput sequencing combined with qRT-PCR. Significant changes in the expression of 17 conserved miRNA families and nine novel miRNAs were observed in response to drought stress, and in seven conserved miRNA families and five novel miRNAs in response to flooding stress. Both miRNA and miRNA*s were involved in the regulation of plant stress responses. The annotation of the potential targets of miRNAs with differential expression indicate that many types of genes encoding transcription factors, enzymes, and signal transduction components are implicated in the abiotic stress response..

  8. Transgenic modification of gai or rg/1 causes dwarfing and alters gibberellins, root growth, and metabolite profiles in Populus

    Energy Technology Data Exchange (ETDEWEB)

    Tschaplinski, Timothy J [ORNL; Busov, V. [Michigan Technological University; Meilan, R [Purdue University; Pearce, D [University of Lethbridge; Rood, s [University of Lethbridge; Ma, C [Oregon State University; Strauss, S [Oregon State University

    2006-01-01

    In Arabidopsis and other plants, gibberellin (GA)-regulated responses are mediated by proteins including GAI, RGA and RGL1-3 that contain a functional DELLA domain. Through transgenic modification, we found that DELLA-less versions of GAI (gai) and RGL1 (rgl1) in a Populus tree have profound, dominant effects on phenotype, producing pleiotropic changes in morphology and metabolic profiles. Shoots were dwarfed, likely via constitutive repression of GA-induced elongation, whereas root growth was promoted two- to threefold in vitro. Applied GA{sub 3} inhibited adventitious root production in wild-type poplar, but gai/rgl1 poplars were unaffected by the inhibition. The concentrations of bioactive GA{sub 1} and GA{sub 4} in leaves of gai- and rgl1-expressing plants increased 12- to 64-fold, while the C{sub 19} precursors of GA{sub 1} (GA{sub 53}, GA{sub 44} and GA{sub 19}) decreased three- to ninefold, consistent with feedback regulation of GA 20-oxidase in the transgenic plants. The transgenic modifications elicited significant metabolic changes. In roots, metabolic profiling suggested increased respiration as a possible mechanism of the increased root growth. In leaves, we found metabolite changes suggesting reduced carbon flux through the lignin biosynthetic pathway and a shift towards allocation of secondary storage and defense metabolites, including various phenols, phenolic glucosides, and phenolic acid conjugates.

  9. Direct matrix-assisted laser desorption/ionization mass spectrometric imaging of cellulose and hemicellulose in Populus tissue.

    Science.gov (United States)

    Lunsford, Kyle Ann; Peter, Gary F; Yost, Richard A

    2011-09-01

    Imaging applied toward lignocellulosic materials requires high molecular specificity to map specific compounds within intact tissue. Although secondary ionization mass spectrometry (SIMS) and matrix-assisted laser desorption/ionization-mass spectrometry (MALDI-MS) with a single stage of MS have been used to image lignocellulosic biomass, the complexity of the plant tissue requires tandem MS, which limits the interpretation of simple MS. MALDI linear ion trap (LIT) tandem MS offers the high molecular specificity needed for lignocellulosic analyses. MALDI-LIT MS analyses of cellulose and xylan (hemicellulose) standards were performed to determine mass-to-charge ratios and fragmentation pathways for identification of these compounds in intact tissue. The MALDI-LIT-MS images of young Populus wood stem showed even distribution of both cellulose and hemicellulose ions; in contrast, the tandem MS images of cellulose and hemicellulose generated by plotting characteristic fragment ions resulted in drastically different images. This demonstrates that isobaric ions are present during MALDI-LIT-MS analyses of wood tissue and tandem MS is necessary to distinguish between isobaric species for selective imaging of carbohydrates in biomass.

  10. Influence of Genotype, Environment, and Gypsy Moth Herbivory on Local and Systemic Chemical Defenses in Trembling Aspen (Populus tremuloides).

    Science.gov (United States)

    Rubert-Nason, Kennedy F; Couture, John J; Major, Ian T; Constabel, C Peter; Lindroth, Richard L

    2015-07-01

    Numerous studies have explored the impacts of intraspecific genetic variation and environment on the induction of plant chemical defenses by herbivory. Relatively few, however, have considered how those factors affect within-plant distribution of induced defenses. This work examined the impacts of plant genotype and soil nutrients on the local and systemic phytochemical responses of trembling aspen (Populus tremuloides) to defoliation by gypsy moth (Lymantria dispar). We deployed larvae onto foliage on individual tree branches for 15 days and then measured chemistry in leaves from: 1) branches receiving damage, 2) undamaged branches of insect-damaged trees, and 3) branches of undamaged control trees. The relationship between post-herbivory phytochemical variation and insect performance also was examined. Plant genotype, soil nutrients, and damage all influenced phytochemistry, with genotype and soil nutrients being stronger determinants than damage. Generally, insect damage decreased foliar nitrogen, increased levels of salicinoids and condensed tannins, but had little effect on levels of a Kunitz trypsin inhibitor, TI3. The largest damage-mediated tannin increases occurred in leaves on branches receiving damage, whereas the largest salicinoid increases occurred in leaves of adjacent, undamaged branches. Foliar nitrogen and the salicinoid tremulacin had the strongest positive and negative relationships, respectively, with insect growth. Overall, plant genetics and environment concomitantly influenced both local and systemic phytochemical responses to herbivory. These findings suggest that herbivory can contribute to phytochemical heterogeneity in aspen foliage, which may in turn influence future patterns of herbivory and nutrient cycling over larger spatial scales.

  11. Disentangling herbivore impacts on Populus tremuloides: a comparison of native ungulates and cattle in Canada's Aspen Parkland.

    Science.gov (United States)

    Bork, Edward W; Carlyle, Cameron N; Cahill, James F; Haddow, Rae E; Hudson, Robert J

    2013-11-01

    Ungulates impact woody species' growth and abundance but little is understood about the comparative impacts of different ungulate species on forest expansion in savanna environments. Replacement of native herbivore guilds with livestock [i.e., beef cattle (Bos taurus)] has been hypothesized as a factor facilitating trembling aspen (Populus tremuloides Michx.) encroachment into grasslands of the Northern Great Plains. We used a controlled herbivory study in the Parklands of western Canada to compare the impact of native ungulates and cattle on aspen saplings. Native ungulate treatments included a mixed species guild and sequences of herbivory by different ungulates [bison (Bison bison subsp. bison), elk (Cervus elaphus) then deer (Odocoileus hemionus); or deer, elk, then bison]. Herbivory treatments were replicated in three pastures, within which sets of 40 marked aspen saplings (aspen stand. Stems were assessed for mortality and incremental damage (herbivory, leader breakage, stem abrasion and trampling). Final mortality was greater with exposure to any type of herbivore, but remained similar between ungulate treatments. However, among all treatments, the growth of aspen was highest with exposure only to cattle. Herbivory of aspen was attributed primarily to elk within the native ungulate treatments, with other forms of physical damage, and ultimately sapling mortality, associated with exposure to bison. Overall, these results indicate that native ungulates, specifically elk and bison, have more negative impacts on aspen saplings and provide evidence that native and domestic ungulates can have different functional effects on woody plant dynamics in savanna ecosystems.

  12. Hydraulic conductivity and aquaporin transcription in roots of trembling aspen (Populus tremuloides) seedlings colonized by Laccaria bicolor.

    Science.gov (United States)

    Xu, Hao; Cooke, Janice E K; Kemppainen, Minna; Pardo, Alejandro G; Zwiazek, Janusz J

    2016-07-01

    Ectomycorrhizal fungi have been reported to increase root hydraulic conductivity (L pr) by altering apoplastic and plasma membrane intrinsic protein (PIP)-mediated cell-to-cell water transport pathways in associated roots, or to have little effect on root water transport, depending on the interacting species and imposed stresses. In this study, we investigated the water transport properties and PIP transcription in roots of aspen (Populus tremuloides) seedlings colonized by the wild-type strain of Laccaria bicolor and by strains overexpressing a major fungal water-transporting aquaporin JQ585595. Inoculation of aspen seedlings with L. bicolor resulted in about 30 % colonization rate of root tips, which developed dense mantle and the Hartig net that was restricted in the modified root epidermis. Transcript abundance of the aspen aquaporins PIP1;2, PIP2;1, and PIP2;2 decreased in colonized root tips. Root colonization by JQ585595-overexpressing strains had no significant impact on seedling shoot water potentials, gas exchange, or dry mass; however, it led to further decrease in transcript abundance of PIP1;2 and PIP2;3 and the significantly lower L pr than in non-inoculated roots. These results, taken together with our previous study that showed enhanced root water hydraulics of L. bicolor-colonized white spruce (Picea glauca), suggest that the impact of L. bicolor on root hydraulics varies by the ectomycorrhiza-associated tree species.

  13. Scientific Basis for Sustainable Management of Eucalyptus and Populus as Short-Rotation Woody Crops in the U.S.

    Directory of Open Access Journals (Sweden)

    Eric D. Vance

    2014-05-01

    Full Text Available Short rotation woody crops (SRWC, fast growing tree species that are harvested on short, repeated intervals, can augment traditional fiber sources. These crops have economic and environmental benefits stemming from their capability of supplying fiber on a reduced land base in close proximity to users and when sensitive sites cannot be accessed. Eucalyptus and Populus appear to be genera with the greatest potential to provide supplemental fiber in the U.S. Optimal productivity can be achieved through practices that overcome site limitations and by choosing the most appropriate sites, species, and clones. Some Eucalyptus species are potentially invasive, yet field studies across multiple continents suggest they are slower to disperse than predicted by risk assessments. Some studies have found lower plant and animal diversity in SRWC systems compared to mature, native forests, but greater than some alterative land uses and strongly influenced by stand management, land use history, and landscape context. Eucalyptus established in place of grasslands, arable lands, and, in some cases, native forests can reduce streamflow and lower water tables due to higher interception and transpiration rates but results vary widely, are scale dependent, and are most evident in drier regions.

  14. Rooting of hybrid clones of Populus tremula L. x P. tremuloides Michx. by stem cuttings derived from micropropagated plants

    Energy Technology Data Exchange (ETDEWEB)

    Qibin Yu [Univ. of Helsinki (Finland). Dept. of Plant Biology; Maentylae, N. [Univ. of Turku (Finland). Dept. of Biology, Plant Physiology and Molecular Biology; Salonen, M. [Finnish Forest Research Inst., Laeyliaeinen (Finland). Haapastensyrjae Breeding Station

    2001-07-01

    Propagation costs could be cut by replacing part of the micropropagation process with steps involving more traditional techniques. This study explored possibilities for improving existing vegetative propagation techniques for aspen using stem cuttings obtained from micropropagated plants. Vegetative propagation through stem cuttings was studied in 10 micropropagated hybrid aspen clones (Populus tremula L. x P. tremuloides Michx). Cuttings containing one axillary bud were harvested from the same donor plants twice during the growing season: the first harvest in May and the second harvest in July. Rooting percentage was correlated positively with root length, number of roots and height of cutting plant but negatively with length of rooting. The average rooting percentage was 53% in the first harvest and 27% in second harvest. Indole-3-butyric acid treatments (1.2 mM) significantly improved rooting in the second harvest, but not in the first harvest, suggesting different endogenous auxin levels in the cuttings. A significant variation for most traits related to rooting ability was found among the clones, indicating that clonal effects play an important role in the propagation of aspen. Thus, clones with a good response in shoot growth and rooting could be exploited in large-scale propagation using stem cuttings.

  15. Genome-wide association study reveals putative regulators of bioenergy traits in Populus deltoides

    Energy Technology Data Exchange (ETDEWEB)

    Fahrenkrog, Annette M. [School of Forest Resources and Conservation, University of Florida, PO Box 110410 Gainesville FL 32611 USA; Plant Molecular and Cellular Biology Graduate Program, University of Florida, PO Box 110690 Gainesville FL 32610 USA; Neves, Leandro G. [School of Forest Resources and Conservation, University of Florida, PO Box 110410 Gainesville FL 32611 USA; Plant Molecular and Cellular Biology Graduate Program, University of Florida, PO Box 110690 Gainesville FL 32610 USA; Resende, Márcio F. R. [School of Forest Resources and Conservation, University of Florida, PO Box 110410 Gainesville FL 32611 USA; Genetics and Genomics Graduate Program, University of Florida, PO Box 103610 Gainesville FL 32610 USA; Vazquez, Ana I. [Department of Epidemiology and Biostatistics, Michigan State University, 909 Fee Road East Lansing MI 48824 USA; de los Campos, Gustavo [Department of Epidemiology and Biostatistics, Michigan State University, 909 Fee Road East Lansing MI 48824 USA; Statistics Department, Michigan State University, 619 Red Cedar Road MI 48824 USA; Dervinis, Christopher [School of Forest Resources and Conservation, University of Florida, PO Box 110410 Gainesville FL 32611 USA; Sykes, Robert [National Renewable Energy Laboratory, 15013 Denver West Parkway Golden CO 80401 USA; Davis, Mark [National Renewable Energy Laboratory, 15013 Denver West Parkway Golden CO 80401 USA; Davenport, Ruth [Biology Department, University of Florida, PO Box 118525 Gainesville FL 32611 USA; Barbazuk, William B. [Plant Molecular and Cellular Biology Graduate Program, University of Florida, PO Box 110690 Gainesville FL 32610 USA; Biology Department, University of Florida, PO Box 118525 Gainesville FL 32611 USA; University of Florida Genetics Institute, University of Florida, PO Box 103610 Gainesville FL 32611 USA; Kirst, Matias [School of Forest Resources and Conservation, University of Florida, PO Box 110410 Gainesville FL 32611 USA; Plant Molecular and Cellular Biology Graduate Program, University of Florida, PO Box 110690 Gainesville FL 32610 USA; University of Florida Genetics Institute, University of Florida, PO Box 103610 Gainesville FL 32611 USA

    2016-09-06

    Genome-wide association studies (GWAS) have been used extensively to dissect the genetic regulation of complex traits in plants. These studies have focused largely on the analysis of common genetic variants despite the abundance of rare polymorphisms in several species, and their potential role in trait variation. Here, we conducted the first GWAS in Populus deltoides, a genetically diverse keystone forest species in North America and an important short rotation woody crop for the bioenergy industry. We searched for associations between eight growth and wood composition traits, and common and low-frequency single-nucleotide polymorphisms detected by targeted resequencing of 18 153 genes in a population of 391 unrelated individuals. To increase power to detect associations with low-frequency variants, multiple-marker association tests were used in combination with single-marker association tests. Significant associations were discovered for all phenotypes and are indicative that low-frequency polymorphisms contribute to phenotypic variance of several bioenergy traits. Our results suggest that both common and low-frequency variants need to be considered for a comprehensive understanding of the genetic regulation of complex traits, particularly in species that carry large numbers of rare polymorphisms. These polymorphisms may be critical for the development of specialized plant feedstocks for bioenergy.

  16. Determination of As in tree-rings of poplar (Populus alba L.) by U-shaped DC arc.

    Science.gov (United States)

    Marković, D M; Novović, I; Vilotić, D; Ignjatović, Lj

    2009-04-01

    An argon-stabilized U-shaped DC arc with a system for aerosol introduction was used for determination of As in poplar (Populus alba L.) tree-rings. After optimization of the operating parameters and selection of the most appropriate signal integration time (30 s), the limit of detection for As was reduced to 15.0 ng/mL. This detection limit obtained with the optimal integration time was compared with those for other methods: inductively coupled plasma-atomic emission spectrometry (ICP-AES), direct coupled plasma-atomic emission spectrometry (DCP-AES), microwave induced plasma-atomic emission spectrometry (MIP-AES) and improved thermospray flame furnace atomic absorption spectrometry (TS-FF-AAS). Arsenic is toxic trace element which can adversely affect plant, animal and human health. As an indicator of environment pollution we collected poplar tree-rings from two locations. The first area was close to the "Nikola Tesla" (TENT-A) power plant, Obrenovac, while the other was in the urban area of Novi Sad. In all cases elevated average concentrations of As were registered in poplar tree-rings from the Obrenovac location.

  17. Identification of microRNAs Involved in Regeneration of the Secondary Vascular System in Populus tomentosa Carr.

    Directory of Open Access Journals (Sweden)

    Fang eTang

    2016-05-01

    Full Text Available Wood formation is a complex developmental process primarily controlled by a regulatory transcription network. MicroRNAs (miRNAs can modulate the expression of target genes involved in plant growth and development by inducing mRNA degradation and translational repression. In this study, we used a model of secondary vascular system regeneration established in Populus tomentosa to harvest differentiating xylem tissues over time for high-throughput sequencing of small RNAs. Analysis of the sequencing data identified 209 known and 187 novel miRNAs during this regeneration process. Degradome sequencing analysis was then performed, revealing 157 and 75 genes targeted by 21 known and 30 novel miRNA families, respectively. Gene ontology enrichment of these target genes revealed that the targets of 15 miRNAs were enriched in the auxin signaling pathway, cell differentiation, meristem development and pattern specification process. The major biological events during regeneration of the secondary vascular system included the sequential stages of vascular cambium initiation, formation, and differentiation stages in sequence. This study provides the basis for further analysis of these miRNAs to gain greater insight into their regulatory roles in wood development in trees.

  18. Effect of nitrate and ammonium fertilization on Zn, Pb, and Cd phytostabilization by Populus euramericana Dorskamp in contaminated technosol.

    Science.gov (United States)

    Qasim, Bashar; Motelica-Heino, Mikael; Bourgerie, Sylvain; Gauthier, Arnaud; Morabito, Domenico

    2015-12-01

    This study aimed at assessing the effect of nitrogen addition under two forms, nitrate and ammonium, on the stabilization of Zn, Pb, and Cd by Populus euramericana Dorskamp grown in contaminated soils for 35 days under controlled conditions. Temporal changes in the soil pore water (SPW) were monitored for pH, dissolved organic carbon (DOC), and total dissolved concentrations of metals in the soils rhizosphere. Rhizospheric SPW pH decreased gradually with NH4(+) addition and increased with NO3(-) addition up to one unit, while it slightly decreased initially then increased for the untreated control soil DOC increased with time up to six times, the highest increase occurring with NH4(+) fertilization. An increase in the metal concentrations in the rhizospheric SPW was observed for NH4(+) addition associated with the lowest rhizospheric SPW pH, whereas the opposite was observed for the control soil and NO3(-) fertilization. Fertilization did not affect plant shoots or roots biomass development compared to the untreated control (without N addition). Metals were mostly accumulated in the rhizosphere and N fertilization increased the accumulation for Zn and Pb while Cd accumulation was enhanced for NH4(+) addition. Collectively, our results suggest metal stabilization by P. euramericana Dorskamp rhizosphere with nitrogen fertilization and are potential for phytostabilization of contaminated technosol.

  19. Analysis on water potential of Populus euphratica oliv and its meaning in the lower reaches of Tarim River, Xinjiang

    Institute of Scientific and Technical Information of China (English)

    FU Aihong; CHEN Yaning; LI Weihong

    2006-01-01

    s Combined with materials measured on leaves water potential of Populus euphratica oliv in the process of ecological water delivery in the lower reaches of Tarim River, the influence of ground-water depths and soil salinity on leaves water potential of P.euphratica was analyzed. We found that there was evident negative correlation between the leaves water potential of P. euphratica and ground-water depths. The deeper the ground-water depths were,the lower the leaves water potential of P. euphratica was, the more serious drought stress P. euphratica suffered from. Besides, there was evident negative correlation between the soil salinity and the leaves water potential of P. euphratica. The bigger the soil salinity was, the lower the leaves water potential of P.euphratica was, the more serious drought stress was indicated from which P. euphratica suffered. For sections rather distant for Daxihaizi Reservoir as well as for those places of wells rather distant from the river course, ground-water depths and the soil salinity were high; the leaves water potential of P. euphratica was low. The leaves water potential of P. euphratica can reflect the degree at which P. euphratica suffers from drought and salt stress, and has an important reference meaning in analyzing proper ground-water depths for the survival and growth of P. euphratic in the lower reaches of Tarim River.

  20. Altering carbon allocation in hybrid poplar (Populus alba × grandidentata) impacts cell wall growth and development.

    Science.gov (United States)

    Unda, Faride; Kim, Hoon; Hefer, Charles; Ralph, John; Mansfield, Shawn D

    2016-12-20

    Galactinol synthase is a pivotal enzyme involved in the synthesis of the raffinose family of oligosaccharides (RFOs) that function as transport carbohydrates in the phloem, as storage compounds in sink tissues and as soluble metabolites that combat both abiotic and biotic stress in several plant species. Hybrid poplar (Populus alba × grandidentata) overexpressing the Arabidopsis thaliana GolS3 (AtGolS3) gene showed clear effects on development; the extreme overexpressing lines were stunted and had cell wall traits characteristic of tension wood, whereas lines with only moderate up-regulation grew normally and had moderately altered secondary cell wall composition and ultrastructure. Stem cross-sections of the developing xylem revealed a significant increase in the number of vessels, as well as the clear presence of a G-layer in the fibres. Furthermore, AtGolS3-OE lines possessed higher cellulose and lower lignin contents, an increase in cellulose crystallinity, and significantly altered hemicellulose-derived carbohydrates, notably manifested by their mannose and xylose contents. In addition, the transgenic plants displayed elevated xylem starch content. Transcriptome interrogation of the transgenic plants showed a significant up-regulation of genes involved in the synthesis of myo-inositol, along with genes involved in sucrose degradation. The results suggest that the overexpression of GolS and its product galactinol may serve as a molecular signal that initiates metabolic changes, culminating in a change in cell wall development and potentially the formation of tension wood.

  1. [Hydraulic limitation on photosynthetic rate of old Populus simonii trees in sandy soil of north Shaanxi Province].

    Science.gov (United States)

    Zuo, Li-Xiang; Li, Yang-Yang; Chen, Jia-Cun

    2014-06-01

    'Old and dwarf trees' on the loess plateau region mainly occurred among mature trees rather than among small trees. To elucidate the mechanism of tree age on 'old and dwarf trees' formation, taking Populus simonii, a tree species that accounted for the largest portion of 'old and dwarf trees' on the loess plateau, as an example, the growth, photosynthesis and hydraulic traits of P. simonii trees with different ages (young: 13-15 years, mid-aged: 31-34 years, and old: 49-54 years) were measured. The results showed that the dieback length increased, and net photosynthetic rate, stomatal conductance, transpiration rate, and whole plant hydraulic conductance decreased significantly with the increasing tree age. Both net photosynthetic rate and stomatal conductance measured at different dates were significantly and positively related to the whole plant hydraulic conductance, suggesting that the decreasing photosynthetic rate of old trees was possibly caused by the declined hydraulic conductance. Although the resistance to cavitation in stems and leaves was stronger in old trees than in young and mid-aged trees, there were no differences in midday native stem embolization degree and leaf hydraulic conductance based on the vulnerability curve estimation, suggesting that the increased hydraulic resistance of the soil-root system is probably the most important reason for decreasing the whole plant hydraulic conductance of old trees.

  2. A comparative study of four approaches to assess phenology of Populus in a short-rotation coppice culture

    Directory of Open Access Journals (Sweden)

    Vanbeveren SPP

    2016-10-01

    Full Text Available We compared four approaches to assess phenology in a short-rotation coppice culture with 12 poplar (Populus genotypes. The four approaches quantified phenology at different spatial scales and with different temporal resolutions: (i visual observations of bud phenology; (ii measurements of leaf area index; (iii webcam images; and (iv satellite images. For validation purposes we applied the four approaches during two years: the year preceding a coppice event and the year following the coppice event. The delayed spring greenup and the faster canopy development in the year after coppicing (as compared to the year before coppicing were similarly quantified by the four approaches. The four approaches detected very similar seasonal changes in phenology, although they had different spatial scales and a different temporal resolution. The onset of autumn senescence after coppicing remained the same as in the year before coppicing according to the bud set observations, but it started earlier according to the webcam images, and later according to the MODIS images. In comparison to the year before coppicing, the growing season - in terms of leaf area duration - was shorter in the year after coppicing, while the leaf area index was higher.

  3. Quantitative Proteomic Analysis Reveals Populus cathayana Females Are More Sensitive and Respond More Sophisticatedly to Iron Deficiency than Males.

    Science.gov (United States)

    Zhang, Sheng; Zhang, Yunxiang; Cao, Yanchun; Lei, Yanbao; Jiang, Hao

    2016-03-04

    Previous studies have shown that there are significant sexual differences in the morphological and physiological responses of Populus cathayana Rehder to nitrogen and phosphorus deficiencies, but little is known about the sex-specific differences in responses to iron deficiency. In this study, the effects of iron deficiency on the morphology, physiology, and proteome of P. cathayana males and females were investigated. The results showed that iron deficiency (25 days) significantly decreased height growth, photosynthetic rate, chlorophyll content, and tissue iron concentration in both sexes. A comparison between the sexes indicated that iron-deficient males had less height inhibition and photosynthesis system II or chloroplast ultrastructural damage than iron-deficient females. iTRAQ-based quantitative proteomic analysis revealed that 144 and 68 proteins were decreased in abundance (e.g., proteins involved in photosynthesis, carbohydrate and energy metabolism, and gene expression regulation) and 78 and 39 proteins were increased in abundance (e.g., proteins involved in amino acid metabolism and stress response) according to the criterion of ratio ≥1.5 in females and males, respectively. A comparison between the sexes indicated that iron-deficient females exhibited a greater change in the proteins involved in photosynthesis, carbon and energy metabolism, the redox system, and stress responsive proteins. This study reveals females are more sensitive and have a more sophisticated response to iron deficiency compared with males and provides new insights into differential sexual responses to nutrient deficiency.

  4. Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf, Stem and Root Dark Respiration of Populus tremuloides

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston, Michigan, USA, to study the effects of soil fertility and CO2 on leaf, stem and root dark respiration (Rd) of Populus tremuloides. Overall, area-based daytime leaf Rd (Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil, but not in low-fertility soil. Mass-based leaf Rd (Rdm) was overall greater for high- than for low-fertility soil grown trees at elevated, but not at ambient CO2. Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2, nor was stem Rda, which ranged from 1.0 to 1.4 μmol m-2 s-1 in the spring and 3.5 to 4.5 μmol m-2 s-1 in the summer. Root Rda was significantly higher in high- than in low-fertility soil, but was unaffected by CO2. Since biomass production of P. tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged, we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2. Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

  5. Effects of Soil Fertility and Atmospheric CO2 Enrichment on Leaf,Stem and Root Dark Respiration of Populus tremuloides

    Institute of Scientific and Technical Information of China (English)

    X.Z.WANG; P.S.CURTIS; 等

    2001-01-01

    An open-top chamber experiment was conducted at the University of Michigan Biological Station near Pellston,Michigan,USA,to study the effects of soil fertility and CO2 on leaf,sdtem and root dark respiration (Rd) of Populus tremuloides.Overall,area-based daytime leaf Rd(Rda) was significantly greater at elevated than at ambient CO2 in high-fertility soil,but not in low-fertility soil.Mass-based leaf Rd(Rdm) was overall greater for high-than for low-fertility soil grown trees at elevated,but not at ambient CO2 .Nighttime leaf Rda and Rdm were unaffected by soil fertility or CO2,nor was stem Rda ,which ranged from 1.0 to 1.4μmol m-2s-1 in the spring and 3.5 to 4.5μmol m-2s-1 in the summer.Root Rda was significantly higher in high-than in low-fertiliy soil,but was unaffected by CO2.Since biomass production of P.tremuloides will be significantly greater at elevated CO2 while specific Rd will either increase or remain unchanged,we predict that carbon loss to the atmosphere through respiration from this ecologically important species would increase at higher CO2.Soil fertility would also interact with elevated CO2 in affecting the carbon flow in the plant-soil-air system.

  6. Energy sensitivity and variability analysis of Populus hybrid short-rotation plantations in northeastern United States. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Bowersox, T.W.; Blankenhorn, P.R.

    1979-10-24

    Production of biomass by corn-like plantations has been demonstrated by a number of researchers. These forest analogs of agronomic cropping systems have the potential to yield substantially more biomass per unit area than traditional forests. Care is needed in choosing the appropriate sites, species, spacing, and harvesting strategies. Opportunities for increased yields have been suggested for fertilization and irrigation. Utilization of the biomass from these dense plantations for energy was the focus of this study. Although the amount of energy potential of the biomass is important, the energy output must be greater than the energy input for biomass to have a positive benefit to society. Further, in order to completely evaluate the net energy of the system it is necessary to examine the energy out-to-in ratios on the basis of usable energy (for example, usable heat, process steam and electricity), as well as all of the energies expended in producing, harvesting, transporting and processing the biomass. The objective of this study is to establish and analyze the energy inputs for selected management strategies in order to evaluate the sensitivity and variability of the energy inputs in the net energy analysis, and based on the net energy analysis to recommend a management strategy that minimizes energy inputs while maximizing biomass yield for short-rotation systems of Populus spp. in the northeastern United States.

  7. Development of a threshold model to predict germination of Populus tomentosa seeds after harvest and storage under ambient condition.

    Science.gov (United States)

    Wang, Wei-Qing; Cheng, Hong-Yan; Song, Song-Quan

    2013-01-01

    Effects of temperature, storage time and their combination on germination of aspen (Populus tomentosa) seeds were investigated. Aspen seeds were germinated at 5 to 30°C at 5°C intervals after storage for a period of time under 28°C and 75% relative humidity. The effect of temperature on aspen seed germination could not be effectively described by the thermal time (TT) model, which underestimated the germination rate at 5°C and poorly predicted the time courses of germination at 10, 20, 25 and 30°C. A modified TT model (MTT) which assumed a two-phased linear relationship between germination rate and temperature was more accurate in predicting the germination rate and percentage and had a higher likelihood of being correct than the TT model. The maximum lifetime threshold (MLT) model accurately described the effect of storage time on seed germination across all the germination temperatures. An aging thermal time (ATT) model combining both the TT and MLT models was developed to describe the effect of both temperature and storage time on seed germination. When the ATT model was applied to germination data across all the temperatures and storage times, it produced a relatively poor fit. Adjusting the ATT model to separately fit germination data at low and high temperatures in the suboptimal range increased the models accuracy for predicting seed germination. Both the MLT and ATT models indicate that germination of aspen seeds have distinct physiological responses to temperature within a suboptimal range.

  8. Sexual epigenetics: gender-specific methylation of a gene in the sex determining region of Populus balsamifera

    Science.gov (United States)

    Bräutigam, Katharina; Soolanayakanahally, Raju; Champigny, Marc; Mansfield, Shawn; Douglas, Carl; Campbell, Malcolm M.; Cronk, Quentin

    2017-01-01

    Methylation has frequently been implicated in gender determination in plants. The recent discovery of the sex determining region (SDR) of balsam poplar, Populus balsamifera, pinpointed 13 genes with differentiated X and Y copies. We tested these genes for differential methylation using whole methylome sequencing of xylem tissue of multiple individuals grown under field conditions in two common gardens. The only SDR gene to show a marked pattern of gender-specific methylation is PbRR9, a member of the two component response regulator (type-A) gene family, involved in cytokinin signalling. It is an ortholog of Arabidopsis genes ARR16 and ARR17. The strongest patterns of differential methylation (mostly male-biased) are found in the putative promoter and the first intron. The 4th intron is strongly methylated in both sexes and the 5th intron is unmethylated in both sexes. Using a statistical learning algorithm we find that it is possible accurately to assign trees to gender using genome-wide methylation patterns alone. The strongest predictor is the region coincident with PbRR9, showing that this gene stands out against all genes in the genome in having the strongest sex-specific methylation pattern. We propose the hypothesis that PbRR9 has a direct, epigenetically mediated, role in poplar sex determination. PMID:28345647

  9. Cellulose and lignin biosynthesis is altered by ozone in wood of hybrid poplar (Populus tremula × alba).

    Science.gov (United States)

    Richet, Nicolas; Afif, Dany; Huber, Françoise; Pollet, Brigitte; Banvoy, Jacques; El Zein, Rana; Lapierre, Catherine; Dizengremel, Pierre; Perré, Patrick; Cabané, Mireille

    2011-06-01

    Wood formation in trees is a dynamic process that is strongly affected by environmental factors. However, the impact of ozone on wood is poorly documented. The objective of this study was to assess the effects of ozone on wood formation by focusing on the two major wood components, cellulose and lignin, and analysing any anatomical modifications. Young hybrid poplars (Populus tremula × alba) were cultivated under different ozone concentrations (50, 100, 200, and 300 l l(-1)). As upright poplars usually develop tension wood in a non-set pattern, the trees were bent in order to induce tension wood formation on the upper side of the stem and normal or opposite wood on the lower side. Biosynthesis of cellulose and lignin (enzymes and RNA levels), together with cambial growth, decreased in response to ozone exposure. The cellulose to lignin ratio was reduced, suggesting that cellulose biosynthesis was more affected than that of lignin. Tension wood was generally more altered than opposite wood, especially at the anatomical level. Tension wood may be more susceptible to reduced carbon allocation to the stems under ozone exposure. These results suggested a coordinated regulation of cellulose and lignin deposition to sustain mechanical strength under ozone. The modifications of the cellulose to lignin ratio and wood anatomy could allow the tree to maintain radial growth while minimizing carbon cost.

  10. Populus yunnanensis males adopt more efficient protective strategies than females to cope with excess zinc and acid rain.

    Science.gov (United States)

    Jiang, Hao; Korpelainen, Helena; Li, Chunyang

    2013-05-01

    Dioecious plants show sexually different responses to environmental stresses. However, little is known about the dimorphic morphological and physiological responses to soil pollution. To investigate sex-related adaptive responses of Populus yunnanensis seedlings when exposed to excess zinc (Zn), acid rain (AR) and their combination (Zn+AR), we analyzed growth parameters, Zn accumulation and allocation, photosynthetic capacity and biochemical responses under different treatments. Results revealed that both excess Zn and Zn+AR have a negative effect on plant growth. Males have a greater potential than females to enrich Zn. The photosynthesis limitation could be attributable to a lower stomatal conductance, photosynthetic nitrogen use efficiency and nitrate reductase activity induced by Zn accumulation. Overproduction of reactive oxygen species was detected, and females showed higher levels of H2O2 and O2- than did males under excess Zn and Zn+AR. In addition, indicators related to plant injury showed expected increases and exhibited sexual differences. Males synthesized more biochemical molecules, such as proline and non-protein thiol, showing a stronger defense capacity in responses to either excess Zn or Zn+AR. Taking into account the Zn accumulation and the resulting injuries in plants, we suggest that excess Zn causes sex-related adaptive responses and males possess a more effective self-protection mechanism, Zn-stressed individuals suffering from AR did not show notable aggravation or alleviation when compared to damages induced by excess Zn alone.

  11. Sap Flow of Populus euphratica in a Desert Riparian Forest in an Extreme Arid Region During the Growing Season

    Institute of Scientific and Technical Information of China (English)

    Jian-Hua Si; Qi Feng; Xiao-You Zhang; Zong-Qiang Chang; Yong-Hong Su; Hai-Yang Xi

    2007-01-01

    In the present study, the heat pulse technique was applied to investigate the stem sap flow of Populus euphratica in a desert riparian forest in an extreme arid region from April to October 2003 and from May to October 2004. The experimental sites were in Qidaoqiao (101 °10'E, 41°59'N) and Bayantaolai farm (101°14'E, 42°01'N) in Ejina county, in the Iow reaches of the Heihe River, China. The results indicated that the diurnal change in the velocity of sap flow showed minor fluctuations. At night, the rising of sap flow could be observed in the main tree species because of root pressure. During the growing season, the maximum average velocity was observed in July, followed by August, and the same velocity was observed in September and May; the minimum velocity was observed in October. The transpiration from June to August during the growing season accounted for approximately 70% of the annual total transpiration. The sap flow velocity of P. euphratica trees of different ages could be arranged in the order: 15 yr > 25 yr > 50 yr. Sap flow velocity was closely related to changes in micrometeorological factors, with average sap flow velocity showing a significant linear correlation with net radiation, air temperature and relative humidity.

  12. The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a.

    Directory of Open Access Journals (Sweden)

    Juan Jesús Molina-Rueda

    Full Text Available BACKGROUND: Glutamine synthetase (GS plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4 expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. RESULTS: In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs. The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs, with concomitant up-regulation of plastidic iron SODs (FSDs in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. CONCLUSIONS: Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this

  13. QTLs for Woolly Poplar Aphid (Phloeomyzus passerinii L. Resistance Detected in an Inter-Specific Populus deltoides x P. nigra Mapping Population.

    Directory of Open Access Journals (Sweden)

    Giorgia Carletti

    Full Text Available The genus Populus represents one of the most economically important groups of forest trees. It is composed by approximately 30 species used for wood and non-wood products, phytoremediation and biomass. Poplar is subjected to several biological and environmental threats although, compared to annual crops, we know far less about the genetic bases of biotic stress resistance. Woolly poplar aphid (Phloeomyzus passerinii is considered a main pest of cultivated poplars in European and American countries. In this work we present two high density linkage maps in poplar obtained by a genotyping by sequencing (GBS approach and the identification of QTLs involved in Ph. passerinii resistance. A total of 5,667 polymorphic markers (5,606 SNPs and 61 SSRs identified on expressed sequences have been used to genotype 131 plants of an F1 population P ×canadensis obtained by an interspecific mate between Populus deltoides (resistant to woolly poplar aphid and Populus nigra (susceptible to woolly poplar aphid. The two linkage maps, obtained following the two-way pseudo-testcross mapping strategy, have been used to investigate the genetic bases of woolly poplar aphid resistance. One major QTL and two QTLs with minor effects (mapped on LGV, LGXVI and LG XIX explaining the 65.8% of the genetic variance observed in the progeny in response to Ph. passerinii attack were found. The high density coverage of functional markers allowed the identification of three genes belonging to disease resistance pathway as putative candidates for P. deltoides resistance to woolly poplar aphid. This work is the first report on genetic of woolly poplar aphid genetic resistance and the resistant loci associated markers identified represent a valuable tool in resistance poplar breeding programs.

  14. A novel bHLH transcription factor PebHLH35 from Populus euphratica confers drought tolerance through regulating stomatal development, photosynthesis and growth in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Yan [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Liaoning Forestry Vocational-Technical College, Shenyang 110101 (China); Wang, Congpeng; Han, Xiao; Tang, Sha; Liu, Sha [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Xia, Xinli, E-mail: xiaxl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China); Yin, Weilun, E-mail: yinwl@bjfu.edu.cn [College of Biological Sciences and Technology, National Engineering Laboratory for Tree Breeding, Beijing Forestry University, Beijing 100083 (China)

    2014-07-18

    Highlights: • PebHLH35 is firstly cloned from Populus euphratica and characterized its functions. • PebHLH35 is important for earlier seedling establishment and vegetative growth. • PebHLH35 enhances tolerance to drought by regulating growth. • PebHLH35 enhances tolerance to drought by regulating stomatal development. • PebHLH35 enhances tolerance to drought by regulating photosynthesis and transpiration. - Abstract: Plant basic helix-loop-helix (bHLH) transcription factors (TFs) are involved in a variety of physiological processes including the regulation of plant responses to various abiotic stresses. However, few drought-responsive bHLH family members in Populus have been reported. In this study, a novel bHLH gene (PebHLH35) was cloned from Populus euphratica. Expression analysis in P. euphratica revealed that PebHLH35 was induced by drought and abscisic acid. Subcellular localization studies using a PebHLH35-GFP fusion showed that the protein was localized to the nucleus. Ectopic overexpression of PebHLH35 in Arabidopsis resulted in a longer primary root, more leaves, and a greater leaf area under well-watered conditions compared with vector control plants. Notably, PebHLH35 overexpression lines showed enhanced tolerance to water-deficit stress. This finding was supported by anatomical and physiological analyses, which revealed a reduced stomatal density, stomatal aperture, transpiration rate, and water loss, and a higher chlorophyll content and photosynthetic rate. Our results suggest that PebHLH35 functions as a positive regulator of drought stress responses by regulating stomatal density, stomatal aperture, photosynthesis and growth.

  15. Molecular Cloning and Functional Analysis of UV RESISTANCE LOCUS 8 (PeUVR8 from Populus euphratica.

    Directory of Open Access Journals (Sweden)

    Ke Mao

    Full Text Available Ultraviolet-B (UV-B; 280-315 nm light, which is an integral part of the solar radiation reaching the surface of the Earth, induces a broad range of physiological responses in plants. The UV RESISTANCE LOCUS 8 (UVR8 protein is the first and only light photoreceptor characterized to date that is specific for UV-B light and it regulates various aspects of plant growth and development in response to UV-B light. Despite its involvement in the control of important plant traits, most studies on UV-B photoreceptors have focused on Arabidopsis and no data on UVR8 function are available for forest trees. In this study, we isolated a homologue of the UV receptor UVR8 of Arabidopsis, PeUVR8, from Populus euphratica (Euphrates poplar and analyzed its structure and function in detail. The deduced PeUVR8 amino acid sequence contained nine well-conserved regulator of chromosome condensation 1 (RCC1 repeats and the region 27 amino acids from the C terminus (C27 that interact with COP1 (CONSTITUTIVELY PHOTOMORPHOGENIC1. Secondary and tertiary structure analysis showed that PeUVR8 shares high similarity with the AtUVR8 protein from Arabidopsis thaliana. Using heterologous expression in Arabidopsis, we showed that PeUVR8 overexpression rescued the uvr8 mutant phenotype. In addition, PeUVR8 overexpression in wild-type background seedlings grown under UV-B light inhibited hypocotyl elongation and enhanced anthocyanin accumulation. Furthermore, we examined the interaction between PeUVR8 and AtCOP1 using a bimolecular fluorescence complementation (BiFC assay. Our data provide evidence that PeUVR8 plays important roles in the control of photomorphogenesis in planta.

  16. Characterization of NAC domain transcription factors implicated in control of vascular cell differentiation in Arabidopsis and Populus.

    Science.gov (United States)

    Grant, Emily H; Fujino, Takeshi; Beers, Eric P; Brunner, Amy M

    2010-07-01

    Wood has a wide variety of uses and is arguably the most important renewable raw material. The composition of xylem cell types in wood determines the utility of different types of wood for distinct commercial applications. Using expression profiling and phylogenetic analysis, we identified many xylem-associated regulatory genes that may control the differentiation of cells involved in wood formation in Arabidopsis and poplar. Prominent among these are NAC domain transcription factors (NACs). We studied NACs with putative involvement as negative (XND1 from Arabidopsis and its poplar orthologs PopNAC118, PopNAC122, PopNAC128, PopNAC129), or positive (SND2 and SND3 from Arabidopsis and their poplar orthologs PopNAC105, PopNAC154, PopNAC156, PopNAC157) regulators of secondary cell wall synthesis. Using quantitative PCR and in situ hybridization, we evaluated expression of these Populus NACs in a developmental gradient and in association with reaction wood and found that representatives from both groups were associated with wood-forming tissue and phloem fibers. Additionally, XND1 orthologs were expressed in mesophyll cells of developing leaves. We prepared transgenic Arabidopsis and poplar plants for overexpression of selected NACs. XND1 overexpression in poplar resulted in severe stunting. Additionally, poplar XND1 overexpressors lacked phloem fibers and showed reductions in cell size and number, vessel number, and frequency of rays in the xylem. Overexpression of PopNAC122, an XND1 ortholog, yielded an analogous phenotype in Arabidopsis. Overexpression of PopNAC154 in poplar reduced height growth and increased the relative proportion of bark versus xylem.

  17. Transcriptional profiling by cDNA-AFLP analysis showed differential transcript abundance in response to water stress in Populus hopeiensis

    Directory of Open Access Journals (Sweden)

    Song Yuepeng

    2012-06-01

    Full Text Available Abstract Background Drought is one of the main environmental factors limiting tree growth and productivity of plantation forests worldwide. Populus hopeiensis Hu et Chow is one of the most important commercial plantation tree species in China. However, the genes controlling drought tolerance in this species have not been identified or characterized. Here, we conducted differential expression analyses and identified a number of genes that were up- or downregulated in P. hopeiensis during water stress. To the best of our knowledge, this is the first comprehensive study of differentially expressed genes in water-stressed P. hopeiensis. Results Using the cDNA-AFLP detection technique, we used 256 primer combinations to identify differentially expressed genes in P. hopeiensis during water stress. In total, 415 transcript derived-fragments (TDFs were obtained from 10× deep sequencing of 473 selected TDFs. Of the 415 TDFs, 412 were annotated by BLAST searches against various databases. The majority of these genes encoded products involved in ion transport and compartmentalization, cell division, metabolism, and protein synthesis. The TDFs were clustered into 12 groups on the basis of their expression patterns. Of the 415 reliable TDFs, the sequences of 35 were homologous to genes that play roles in short or long-term resistance to drought stress. Some genes were further selected for validation of cDNA-AFLP expression patterns using real-time PCR analyses. The results confirmed the expression patterns that were detected using the cDNA-AFLP technique. Conclusion The cDNA-AFLP technique is an effective and powerful tool for identifying candidate genes that are differentially expressed under water stress. We demonstrated that 415 TDFs were differentially expressed in water-stressed poplar. The products of these genes are involved in various biological processes in the drought response of poplar. The results of this study will aid in the identification of

  18. Effect of arbuscular mycorrhizal inoculation on water status and photosynthesis of Populus cathayana males and females under water stress.

    Science.gov (United States)

    Li, Zhen; Wu, Na; Liu, Ting; Chen, Hui; Tang, Ming

    2015-02-27

    Drought is one of the most serious environmental limitations for poplar growth. Although the ways in which plants deal with water stress and the effects of arbuscular mycorrhizal (AM) formation have been well documented, little is known about how the male and female plants of Populus cathayana respond to drought and AM formation. We also aimed to investigate the potential role of AM fungi in maintaining gender balance. We tested the impact of drought and AM formation on water status and photosynthesis. The results suggested that both sexes showed similar responses to water stress: drought decreased the growth of stem length (GSL), growth of ground diameter (GGD), relative water content (RWC), increased the relative electrolyte leakage (REL), and limited the photosynthesis and chlorophyll fluorescence indexes. However, the responses of the two sexes to drought and AM formation differed to some extent. AM formation had positive effects on RWC, photosynthesis and the intrinsic water use efficiency (WUEi) but negative effects on the REL of males and females, especially under drought. AM formation enhanced the maximum quantum yield of photosystem II (PSII) (Fv/Fm), the actual quantum yield of PSII (ΦPSII), non-photochemical quenching (qN) and photochemical quenching (qP) under drought conditions, and had no significant effects under well-watered conditions except on the qP of males. Principal component analysis showed that males were significantly more drought tolerant than females, and AM formation enhanced drought tolerance, particularly among males, which suggested that AM fungi are beneficial for ecological stability and for P. cathayana survival under drought conditions.

  19. A multifactor analysis of fungal and bacterial community structure in the root microbiome of mature Populus deltoides trees.

    Science.gov (United States)

    Shakya, Migun; Gottel, Neil; Castro, Hector; Yang, Zamin K; Gunter, Lee; Labbé, Jessy; Muchero, Wellington; Bonito, Gregory; Vilgalys, Rytas; Tuskan, Gerald; Podar, Mircea; Schadt, Christopher W

    2013-01-01

    Bacterial and fungal communities associated with plant roots are central to the host health, survival and growth. However, a robust understanding of the root-microbiome and the factors that drive host associated microbial community structure have remained elusive, especially in mature perennial plants from natural settings. Here, we investigated relationships of bacterial and fungal communities in the rhizosphere and root endosphere of the riparian tree species Populus deltoides, and the influence of soil parameters, environmental properties (host phenotype and aboveground environmental settings), host plant genotype (Simple Sequence Repeat (SSR) markers), season (Spring vs. Fall) and geographic setting (at scales from regional watersheds to local riparian zones) on microbial community structure. Each of the trees sampled displayed unique aspects to its associated community structure with high numbers of Operational Taxonomic Units (OTUs) specific to an individual trees (bacteria >90%, fungi >60%). Over the diverse conditions surveyed only a small number of OTUs were common to all samples within rhizosphere (35 bacterial and 4 fungal) and endosphere (1 bacterial and 1 fungal) microbiomes. As expected, Proteobacteria and Ascomycota were dominant in root communities (>50%) while other higher-level phylogenetic groups (Chytridiomycota, Acidobacteria) displayed greatly reduced abundance in endosphere compared to the rhizosphere. Variance partitioning partially explained differences in microbiome composition between all sampled roots on the basis of seasonal and soil properties (4% to 23%). While most variation remains unattributed, we observed significant differences in the microbiota between watersheds (Tennessee vs. North Carolina) and seasons (Spring vs. Fall). SSR markers clearly delineated two host populations associated with the samples taken in TN vs. NC, but overall host genotypic distances did not have a significant effect on corresponding communities that

  20. Aspen (Populus tremuloides Michx.) intake and preference by mammalian herbivores: the role of plant secondary compounds and nutritional context.

    Science.gov (United States)

    Villalba, Juan J; Burritt, Elizabeth A; St Clair, Samuel B

    2014-10-01

    Aspen (Populus tremuloides Michx.) has evolved a chemical defense system comprised of phenolic glycosides (PG), which effectively deter insect herbivory. However, much less is known about the role of PG and the nutritional quality of the associated plant community on aspen browse susceptibility to mammalian herbivores. In three successive periods during the growing season, we conducted experiments with sheep by offering leaves from two aspen stands with different concentrations of PG (LOW, HIGH) or aspen leaves vs. leaves from a forb (Utah pea, Lathyrus pauciflorus) or a grass (smooth brome, Bromus inermis Leyss.) growing in an aspen understory. Intake of aspen (19 to 35 % PG) was low in all periods (1 to 6 g/Kg(0.75) in 2 hr) supporting the notion that aspen's defense system may contribute to its ecological success. However, lambs ate larger amounts of LOW than of HIGH suggesting that sheep could discriminate between aspen stands with different concentrations of PG, even when both stands were relatively well defended. Concentration of nutrients and chemical defenses in aspen leaves remained fairly stable across the growing season, and preference for aspen increased over the growing season. In contrast, preference for the forb and the grass decreased across the growing season in concert with a decline in the nutritional quality of these plants. The data suggest that nutritional context of aspen and associated forage species drove preference more than contrasts in defense chemistry of aspen. There may be periods of "susceptibility" of aspen use by mammalian herbivores, despite high concentrations of chemical defenses, which can potentially be targeted by management to reduce aspen herbivory.

  1. Development of a threshold model to predict germination of Populus tomentosa seeds after harvest and storage under ambient condition.

    Directory of Open Access Journals (Sweden)

    Wei-Qing Wang

    Full Text Available Effects of temperature, storage time and their combination on germination of aspen (Populus tomentosa seeds were investigated. Aspen seeds were germinated at 5 to 30°C at 5°C intervals after storage for a period of time under 28°C and 75% relative humidity. The effect of temperature on aspen seed germination could not be effectively described by the thermal time (TT model, which underestimated the germination rate at 5°C and poorly predicted the time courses of germination at 10, 20, 25 and 30°C. A modified TT model (MTT which assumed a two-phased linear relationship between germination rate and temperature was more accurate in predicting the germination rate and percentage and had a higher likelihood of being correct than the TT model. The maximum lifetime threshold (MLT model accurately described the effect of storage time on seed germination across all the germination temperatures. An aging thermal time (ATT model combining both the TT and MLT models was developed to describe the effect of both temperature and storage time on seed germination. When the ATT model was applied to germination data across all the temperatures and storage times, it produced a relatively poor fit. Adjusting the ATT model to separately fit germination data at low and high temperatures in the suboptimal range increased the models accuracy for predicting seed germination. Both the MLT and ATT models indicate that germination of aspen seeds have distinct physiological responses to temperature within a suboptimal range.

  2. Comparison of Pyrolysis Mass Spectrometry and Near Infrared Spectroscopy for Genetic Analysis of Lignocellulose Chemical Composition in Populus

    Directory of Open Access Journals (Sweden)

    Jianxing Zhang

    2014-03-01

    Full Text Available Genetic analysis of wood chemical composition is often limited by the cost and throughput of direct analytical methods. The speed and low cost of Fourier transform near infrared (FT-NIR overcomes many of these limitations, but it is an indirect method relying on calibration models that are typically developed and validated with small sample sets. In this study, we used >1500 young greenhouse grown trees from a clonally propagated single Populus family, grown at low and high nitrogen, and compared FT-NIR calibration sample sizes of 150, 250, 500 and 750 on calibration and prediction model statistics, and heritability estimates developed with pyrolysis molecular beam mass spectrometry (pyMBMS wood chemical composition. As calibration sample size increased from 150 to 750, predictive model statistics improved slightly. Overall, stronger calibration and prediction statistics were obtained with lignin, S-lignin, S/G ratio, and m/z 144 (an ion from cellulose, than with C5 and C6 carbohydrates, and m/z 114 (an ion from xylan. Although small differences in model statistics were observed between the 250 and 500 sample calibration sets, when predicted values were used for calculating genetic control, the 500 sample set gave substantially more similar results to those obtained with the pyMBMS data. With the 500 sample calibration models, genetic correlations obtained with FT-NIR and pyMBMS methods were similar. Quantitative trait loci (QTL analysis with pyMBMS and FT-NIR predictions identified only three common loci for lignin traits. FT-NIR identified four QTLs that were not found with pyMBMS data, and these QTLs were for the less well predicted carbohydrate traits.

  3. Cuticle lipids on heteromorphic leaves of Populus euphratica Oliv. growing in riparian habitats differing in available soil moisture.

    Science.gov (United States)

    Xu, Xiaojing; Xiao, Lei; Feng, Jinchao; Chen, Ningmei; Chen, Yue; Song, Buerbatu; Xue, Kun; Shi, Sha; Zhou, Yijun; Jenks, Matthew A

    2016-11-01

    Populus euphratica is an important native tree found in arid regions from North Africa and South Europe to China, and is known to tolerate many forms of environmental stress, including drought. We describe cuticle waxes, cutin and cuticle permeability for the heteromorphic leaves of P. euphratica growing in two riparian habitats that differ in available soil moisture. Scanning electron microscopy revealed variation in epicuticular wax crystallization associated with leaf type and site. P. euphratica leaves are dominated by cuticular wax alkanes, primary-alcohols and fatty acids. The major cutin monomers were 10,16-diOH C16:0 acids. Broad-ovate leaves (associated with adult phase growth) produced 1.3- and 1.6-fold more waxes, and 2.1- and 0.9-fold more cutin monomers, than lanceolate leaves (associated with juvenile phase growth) at the wetter site and drier site, respectively. The alkane-synthesis-associated ECERIFERUM1 (CER1), as well as ABC transporter- and elongase-associated genes, were expressed at much higher levels at the drier than wetter sites, indicating their potential function in elevating leaf cuticle lipids in the dry site conditions. Higher cuticle lipid amounts were closely associated with lower cuticle permeability (both chlorophyll efflux and water loss). Our results implicate cuticle lipids as among the xeromorphic traits associated with P. euphratica adult-phase broad-ovate leaves. Results here provide useful information for protecting natural populations of P. euphratica and their associated ecosystems, and shed new light on the functional interaction of cuticle and leaf heterophylly in adaptation to more arid, limited-moisture environments.

  4. Populus euphratica XTH overexpression enhances salinity tolerance by the development of leaf succulence in transgenic tobacco plants.

    Science.gov (United States)

    Han, Yansha; Wang, Wei; Sun, Jian; Ding, Mingquan; Zhao, Rui; Deng, Shurong; Wang, Feifei; Hu, Yue; Wang, Yang; Lu, Yanjun; Du, Liping; Hu, Zanmin; Diekmann, Heike; Shen, Xin; Polle, Andrea; Chen, Shaoliang

    2013-11-01

    Populus euphratica is a salt-tolerant tree species that develops leaf succulence after a prolonged period of salinity stress. In the present study, a putative xyloglucan endotransglucosylase/hydrolase gene (PeXTH) from P. euphratica was isolated and transferred to tobacco plants. PeXTH localized exclusively to the endoplasmic reticulum and cell wall. Plants overexpressing PeXTH were more salt tolerant than wild-type tobacco with respect to root and leaf growth, and survival. The increased capacity for salt tolerance was due mainly to the anatomical and physiological alterations caused by PeXTH overexpression. Compared with the wild type, PeXTH-transgenic plants contained 36% higher water content per unit area and 39% higher ratio of fresh weight to dry weight, a hallmark of leaf succulence. However, the increased water storage in the leaves in PeXTH-transgenic plants was not accompanied by greater leaf thickness but was due to highly packed palisade parenchyma cells and fewer intercellular air spaces between mesophyll cells. In addition to the salt dilution effect in response to NaCl, these anatomical changes increased leaf water-retaining capacity, which lowered the increase of salt concentration in the succulent tissues and mesophyll cells. Moreover, the increased number of mesophyll cells reduced the intercellular air space, which improved carbon economy and resulted in a 47-78% greater net photosynthesis under control and salt treatments (100-150 mM NaCl). Taken together, the results indicate that PeXTH overexpression enhanced salt tolerance by the development of succulent leaves in tobacco plants without swelling.

  5. Variation in resistance to the rust fungus Melampsora larici-populina Kleb. in Populus nigra L. in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Štochlová P

    2016-02-01

    Full Text Available Differences in Populus nigra L. clone resistance to the rust fungus Melampsora larici-populina Kleb. (MLP were studied in field trials where infected trees were compared with fungicide-protected trees. MLP rust infections were assessed using a 6-point scale. Four parameters of poplar growth were also measured to gauge host response to infection: shoot thickness, shoot number at the end of the growing season, individual plant dry weight, and dry matter yield per unit area. Five of eight known pathogen virulence types were detected. Cumulative growth in shoot thickness in sprayed and unsprayed plots was similar in clones with high rust pathogen resistance, but significantly different in clones with low resistance. Clones with low resistance also exhibited delayed growth initiation in the year following infection, an effect attributed to lower food storage accumulated during the previous year, reflected in a reduction in stem diameter. Based on stem thickness measurements, it was confirmed growth ceased at the end of August. Average rust severity symptoms ranged from 2.75 to 4.22 on the 6-point scale. The percentage reduction for the various growth parameters resulting from rust infection ranged as follows: individual plant dry weight 5-64%; dry matter yield 21-66%; shoot number 17-46%; and stem diameter 1-35%. Exclusive of stem diameter, these reductions correlated with severity in MLP rust infection. The one exception was tolerance to rust infection displayed by one of the clones. Clones with the lowest growth reductions were 97/152 and 97/157. Growth and yield parameter variation as a result MLP resistance difference was observed among tested P. nigra clones. This variation can be viewed as confirmation that resistance observed in this study and P. nigra clones is a suite of quantitative traits. These findings have important implications for MLP resistance breeding programs.

  6. Spatial distribution pattern and dynamics of the primary population in a natural Populus euphratica forest in Tarim Basin, Xinjiang, China

    Institute of Scientific and Technical Information of China (English)

    Lu HAN; Haizhen WANG; Zhengli ZHOU; Zhijun LI

    2008-01-01

    One 50 m × 50 m standard plot was sampled in a natural forest of Populus euphratica in Awati County, situated at the edge of the Tarim Basin, Xinjiang Uygur Autonomous Region, China. The field investigation was conducted with a contiguous grid quadrate method. By means of a test of variance/mean value ratio, aggregation intensity index and theoretical distribution models, the spatial distribution pattern and the dynamics of primary populations in P. euphratica forest were studied. The results showed that the spatial distribution pattern of two dominant arbor populations conformed to clumped distribution. The aggregation intensity of the P. euphra-tica population was higher than that of P. pruinosa popu- lation. The spatial distribution pattern of two companion plant populations in the shrub layer also conformed to clump type, though the aggregation intensity of Tamarix chinensis was higher. In the herb layer, the distribution patterns of Glycyrrhiza uralensis and Asparagus persicus conformed respectively to a clumped pattern and a ran-dom pattern. The results of a Taylor power method test and Iwao's m2-x regression model also verified that both P. euphratica and P. pruinosa populations belong to a clumped pattern. Although the distribution pattern of P. pruinosa population at different development stages all belonged to a clumped distribution pattern, the aggrega-tion intensity dropped gradually along with age develop-ment. The distribution patterns of the P. euphratica population at different development stages changed from random type to clumped type, and further to random type. The differences in spatial distribution patterns of different populations at different development stages were related not only to ecological and biological characteris-tics of each species in the communities in the light of competitive exclusion principle among the populations, but were also closely related to the habitats in which the species lived in.

  7. Lead uptake increases drought tolerance of wild type and transgenic poplar (Populus tremula x P. alba) overexpressing gsh 1.

    Science.gov (United States)

    Samuilov, Sladjana; Lang, Friedericke; Djukic, Matilda; Djunisijevic-Bojovic, Danijela; Rennenberg, Heinz

    2016-09-01

    Growth and development of plants largely depends on their adaptation ability in a changing climate. This is particularly true on heavy metal contaminated soils, but the interaction of heavy metal stress and climate on plant performance has not been intensively investigated. The aim of the present study was to elucidate if transgenic poplars (Populus tremula x P. alba) with enhanced glutathione content possess an enhanced tolerance to drought and lead (Pb) exposure (single and in combination) and if they are good candidates for phytoremediation of Pb contaminated soil. Lead exposure reduced growth and biomass accumulation only in above-ground tissue of wild type poplar, although most of lead accumulated in the roots. Drought caused a decline of the water content rather than reduced biomass production, while Pb counteracted this decline in the combined exposure. Apparently, metals such as Pb possess a protective function against drought, because they interact with abscisic acid dependent stomatal closure. Lead exposure decreased while drought increased glutathione content in leaves of both plant types. Lead accumulation was higher in the roots of transgenic plants, presumably as a result of chelation by glutathione. Water deprivation enhanced Pb accumulation in the roots, but Pb was subject to leakage out of the roots after re-watering. Transgenic plants showed better adaptation under mild drought plus Pb exposure partially due to improved glutathione synthesis. However, the transgenic plants cannot be considered as a good candidate for phytoremediation of Pb, due to its small translocation to the shoots and its leakage out of the roots upon re-watering.

  8. A multifactor analysis of fungal and bacterial community structure in the root microbiome of mature Populus deltoides trees.

    Directory of Open Access Journals (Sweden)

    Migun Shakya

    Full Text Available Bacterial and fungal communities associated with plant roots are central to the host health, survival and growth. However, a robust understanding of the root-microbiome and the factors that drive host associated microbial community structure have remained elusive, especially in mature perennial plants from natural settings. Here, we investigated relationships of bacterial and fungal communities in the rhizosphere and root endosphere of the riparian tree species Populus deltoides, and the influence of soil parameters, environmental properties (host phenotype and aboveground environmental settings, host plant genotype (Simple Sequence Repeat (SSR markers, season (Spring vs. Fall and geographic setting (at scales from regional watersheds to local riparian zones on microbial community structure. Each of the trees sampled displayed unique aspects to its associated community structure with high numbers of Operational Taxonomic Units (OTUs specific to an individual trees (bacteria >90%, fungi >60%. Over the diverse conditions surveyed only a small number of OTUs were common to all samples within rhizosphere (35 bacterial and 4 fungal and endosphere (1 bacterial and 1 fungal microbiomes. As expected, Proteobacteria and Ascomycota were dominant in root communities (>50% while other higher-level phylogenetic groups (Chytridiomycota, Acidobacteria displayed greatly reduced abundance in endosphere compared to the rhizosphere. Variance partitioning partially explained differences in microbiome composition between all sampled roots on the basis of seasonal and soil properties (4% to 23%. While most variation remains unattributed, we observed significant differences in the microbiota between watersheds (Tennessee vs. North Carolina and seasons (Spring vs. Fall. SSR markers clearly delineated two host populations associated with the samples taken in TN vs. NC, but overall host genotypic distances did not have a significant effect on corresponding communities

  9. A multifactor analysis of fungal and bacterial community structure of the root microbiome of mature Populus deltoides trees

    Energy Technology Data Exchange (ETDEWEB)

    Shakya, Migun [ORNL; Gottel, Neil R [ORNL; Castro Gonzalez, Hector F [ORNL; Yang, Zamin [ORNL; Gunter, Lee E [ORNL; Labbe, Jessy L [ORNL; Muchero, Wellington [ORNL; Bonito, Gregory [Duke University; Vilgalys, Rytas [Duke University; Tuskan, Gerald A [ORNL; Podar, Mircea [ORNL; Schadt, Christopher Warren [ORNL

    2013-01-01

    Bacterial and fungal communities associated with plant roots are central to the host- health, survival and growth. However, a robust understanding of root-microbiome and the factors that drive host associated microbial community structure have remained elusive, especially in mature perennial plants from natural settings. Here, we investigated relationships of bacterial and fungal communities in the rhizosphere and root endosphere of the riparian tree species Populus deltoides, and the influence of soil parameters, environmental properties (host phenotype and aboveground environmental settings), host plant genotype (Simple Sequence Repeat (SSR) markers), season (Spring vs. Fall) and geographic setting (at scales from regional watersheds to local riparian zones) on microbial community structure. Each of the trees sampled displayed unique aspects to it s associated community structure with high numbers of Operational Taxonomic Units (OTUs) specific to an individual trees (bacteria >90%, fungi >60%). Over the diverse conditions surveyed only a small number of OTUs were common to all samples within rhizosphere (35 bacterial and 4 fungal) and endosphere (1 bacterial and 1 fungal) microbiomes. As expected, Proteobacteria and Ascomycota were dominant in root communities (>50%) while other higher-level phylogenetic groups (Chytridiomycota, Acidobacteria) displayed greatly reduced abundance in endosphere compared to the rhizosphere. Variance partitioning partially explained differences in microbiome composition between all sampled roots on the basis of seasonal and soil properties (4% to 23%). While most variation remains unattributed, we observed significant differences in the microbiota between watersheds (Tennessee vs. North Carolina) and seasons (Spring vs. Fall). SSR markers clearly delineated two host populations associated with the samples taken in TN vs. NC, but overall genotypic distances did not have a significant effect on corresponding communities that could be

  10. Genetic transformation and expression of transgenic lines of Populus x euramericana with insect-resistance and salt-tolerance genes.

    Science.gov (United States)

    Yang, R L; Wang, A X; Zhang, J; Dong, Y; Yang, M S; Wang, J M

    2016-04-29

    We characterized new transgenic varieties of poplar with multiple insect-resistant and salt stress tolerant genes. Two insect-resistant Bacillus thuringiensis (Bt) genes, Cry1Ac and Cry3A, and a salt-tolerant gene, Betaine aldehyde dehydrogenase (BADH) were inserted into a vector, p209-Cry1Ac-Cry3A-BADH. The clone of Populus x euramericana was transformed by the vector using the Agrobacterium-mediated method. Three transgenic lines were assessed using genetic detection and resistance expression analysis. PCR revealed that exogenous genes Cry1Ac, Cry3A, BADH and selective marker gene NPTII were present in three transgenic lines. Quantitative real-time PCR (qPCR) showed significant differences in the transcriptional abundance of three exogenous genes in different lines. Results of assays for Bt toxic proteins showed that the Cry1Ac and Cry3A toxic protein content of each line was 12.83-26.32 and 2108.91-2724.79 ng/g, respectively. The Cry1Ac toxic protein content of different lines was significantly different; the Cry3A toxic protein content was about 100 times higher than that of the Cry1Ac toxic protein. The insect-resistance test revealed the mortality rate of transgenic lines to Hyphantria cunea L1 larvae varied by 42.2-66.7%, which was significantly higher than non-transgenic lines. The mortality rate of L1 and L2 Plagiodera versicolora larvae was 100%. The insecticidal effect of transgenic lines to P. versicolora larvae was higher than that to H. cunea larvae. NaCl stress tolerance of three transgenic lines under 3-6% NaCl concentration was significantly higher than that of non-transgenic lines.

  11. Biochemical characterisation of isoprene synthase from poplar (Populus x canescens (Ait.) Sm.) and its expression in Arabidopsis thaliana L.; Biochemische Charakterisierung der Isoprensynthase aus der Graupappel (Populus x canescens (Ait.) Sm.) und ihre Expression in Arabidopsis thaliana L.

    Energy Technology Data Exchange (ETDEWEB)

    Bachl, A.

    2005-04-01

    It is known that a lot of plant species emit high amounts of isoprene, especially during high temperature periods. The physiological impact of isoprene biosynthesis and emission is currently still unknown. An enhanced heat tolerance as well as an antioxidant action of isoprene is mainly discussed. One of the main goals of this work was therefore to produce transgenic plants differing from the corresponding wildtype in their ability to synthesize and emit isoprene. Therefore, the isoprene synthase (ispS) gene from poplar (Populus x canescens), which was isolated by Miller et al. (2001) was used to transform Arabidopsis thaliana L., which is not a significant isoprene emitter. Prior to transformation the original DNA-sequence was extended by two different epitops, a nonapeptide HA epitope and six triplets for histidine resulting in a C-terminal His-tag, in order to get a labelled enzyme, which can be detected and cleaned up more easily afterwards. For proving the efficiency of the resulting proteins, the core enzymes without the transit peptide needed for the import of the protein, which is encoded in the nucleus, into the chloroplasts were expressed heterologous in E. coli. The HA epitope resulted in a complete loss of enzyme activity, while the His-tag led to a decreased enzyme activity of about 20%. For the Agrobacterium mediated transformation of A. thaliana the ispS with the C-terminal His-tag was used and cloned into the binary vector pBinAR under the control of a 35S promoter. 40 transgenic lines, which were selected by kanamycine resistance, have been achieved. The stable integration of ispS was confirmed on DNA- as well as on RNA level. The expression of ispS was proved in 38 of the 40 lines by PCR from cDNA. Furthermore the emission of the transgenic lines was studied by measuring whole plants for several hours. Five of the 40 lines showed significant higher isoprene emission rates being more than 2,5 fold higher than in the measured non emitting A

  12. Establishment of high frequency shoot regeneration system in Himalayan poplar (Populus ciliata Wall. ex Royle) from petiole explants using Thidiazuron cytokinin as plant growth regulator

    Institute of Scientific and Technical Information of China (English)

    G Aggarwal; A Gaur; D K Srivastava

    2015-01-01

    Populus species are important resources for industry and in scientific study on biological and agricul-tural systems. Our objective was to enhance the f