WorldWideScience

Sample records for cores magnetic

  1. Core Processes: Earth's eccentric magnetic field

    DEFF Research Database (Denmark)

    Finlay, Chris

    2012-01-01

    Earth’s magnetic field is characterized by a puzzling hemispheric asymmetry. Calculations of core dynamo processes suggest that lopsided growth of the planet’s inner core may be part of the cause.......Earth’s magnetic field is characterized by a puzzling hemispheric asymmetry. Calculations of core dynamo processes suggest that lopsided growth of the planet’s inner core may be part of the cause....

  2. Ferrofluid-based Stretchable Magnetic Core Inductors

    Science.gov (United States)

    Lazarus, N.; Meyer, C. D.

    2015-12-01

    Magnetic materials are commonly used in inductor and transformer cores to increase inductance density. The emerging field of stretchable electronics poses a new challenge since typical magnetic cores are bulky, rigid and often brittle. This paper presents, for the first time, stretchable inductors incorporating ferrofluid as a liquid magnetic core. Ferrofluids, suspensions of nanoscale magnetic particles in a carrier liquid, provide enhanced magnetic permeability without changing the mechanical properties of the surrounding elastomer. The inductor tested in this work consisted of a liquid metal solenoid wrapped around a ferrofluid core in separate channels. The low frequency inductance was found to increase from 255 nH before fill to 390 nH after fill with ferrofluid, an increase of 52%. The inductor was also shown to survive uniaxial strains of up to 100%.

  3. Stretchable inductor with liquid magnetic core

    Science.gov (United States)

    Lazarus, N.; Meyer, C. D.

    2016-03-01

    Adding magnetic materials is a well-established method for improving performance of inductors. However, traditional magnetic cores are rigid and poorly suited for the emerging field of stretchable electronics, where highly deformable inductors are used to wirelessly couple power and data signals. In this work, stretchable inductors are demonstrated based on the use of ferrofluids, magnetic liquids based on distributed magnetic particles, to create a compliant magnetic core. Using a silicone molding technique to create multi-layer fluidic channels, a liquid metal solenoid is fabricated around a ferrofluid channel. An analytical model is developed for the effects of mechanical strain, followed by experimental verification using two different ferrofluids with different permeabilities. Adding ferrofluid was found to increase the unstrained inductance by up to 280% relative to a similar inductor with a non-magnetic silicone core, while retaining the ability to survive uniaxial strains up to 100%.

  4. Magnetic core-shell silica particles

    NARCIS (Netherlands)

    Claesson, E.M.

    2007-01-01

    This thesis deals with magnetic silica core-shell colloids and related functionalized silica structures. Synthesis routes have been developed and optimized. The physical properties of these colloids have been investigated, such as the magnetic dipole moment, dipolar structure formation and

  5. Remanent magnetization stratigraphy of lunar cores

    Science.gov (United States)

    Banerjee, S. K.; Gingrich, D.; Marvin, J. A.

    1977-01-01

    Depth dependent fluctuations have been observed in the natural remanent magnetizations (NRM) of drive cores and drill strings from Apollo 16 and 17 missions. Partial demagnetization of unstable secondary magnetizations and identification of characteristic error signals from a core which is known to have been recently disturbed allow us to identify and isolate the stable NRM stratigraphy in double drive core 60010/60009 and drill strings 60002-60004. The observed magnetization fluctuations persist after normalization to take into account depth dependent variations in the carriers of stable NRM. We tentatively ascribe the stable NRM stratigraphy to instantaneous records of past magnetic fields at the lunar surface and suggest that the stable NRM stratigraphy technique could develop as a new relative time-stratigraphic tool, to be used with other physical measurements such as relative intensity of ferromagnetic resonance and charged particle track density to study the evolution of the lunar regolith.

  6. Magnetic nuclear core restraint and control

    International Nuclear Information System (INIS)

    Cooper, M.H.

    1979-01-01

    A lateral restraint and control system for a nuclear reactor core adaptable to provide an inherent decrease of core reactivity in response to abnormally high reactor coolant fluid temperatures. An electromagnet is associated with structure for radially compressing the core during normal reactor conditions. A portion of the structures forming a magnetic circuit are composed of ferromagnetic material having a curie temperature corresponding to a selected coolant fluid temperature. Upon a selected signal, or inherently upon a preselected rise in coolant temperature, the magnetic force is decreased a given amount sufficient to relieve the compression force so as to allow core radial expansion. The expanded core configuration provides a decreased reactivity, tending to shut down the nuclear reaction

  7. Magnetic nuclear core restraint and control

    International Nuclear Information System (INIS)

    Cooper, M.H.

    1979-01-01

    A lateral restraint and control systemm for a nuclear reactor core provides an inherent decrease of core reactivity in response to abnormally high reactor coolant fluid temperatures. An electromagnet is associated with structure for radially compressing the core during normal reactor conditions. A portion of the structures forming a magnetic circuit is composed of ferromagnetic material having a curie temperature corresponding to a selected coolant fluid temperature. Upon a selected signal, or inherently upon a preselected rise in coolant temperature, the magnetic force is decreased by an amount sufficient to relieve the compression force so as to allow core radial expansion. The expanded core configuration provides a decreased reactivity, tending to shut down the nuclear reaction

  8. Magnetic nuclear core restraint and control

    International Nuclear Information System (INIS)

    Cooper, M.H.

    1978-01-01

    Disclosed is a lateral restraint and control system for a nuclear reactor core adaptable to provide an inherent decrease of core reactivity in response to abnormally high reactor coolant fluid temperatures. An electromagnet is associated with structure for radially compressing the core during normal reactor conditions. A portion of the structures forming a magnetic circuit are composed of ferromagnetic material having a curie temperature corresponding to a selected coolant fluid temperature. Upon a selected signal, or inherently upon a preselected rise in coolant temperature, the magnetic force is decreased a given amount sufficient to relieve the compression force so as to allow core radial expansion. The expanded core configuration provides a decreased reactivity, tending to shut down the nuclear reaction

  9. Dismantling OPAL's cylindrical magnet core

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    Lifting a handling device for dismounting the pressure bells, which are inside the cylindrical magnet coil on the central section of OPAL, on the right part of the photo. OPAL was a detector on the LEP accelerator, which ran from 1989 to 2000.

  10. Electrically Small Magnetic Dipole Antennas with Magnetic Core

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Breinbjerg, Olav

    2010-01-01

    This work extends the theory of a spherical magnetic dipole antenna with magnetic core by numerical results for practical antenna configurations that excite higher-order modes besides the main TE10 spherical mode. The multiarm spherical helix (MSH) and the spherical split ring (SSR) antennas...

  11. Magnetic Fields in the Massive Dense Cores of the DR21 Filament: Weakly Magnetized Cores in a Strongly Magnetized Filament

    Energy Technology Data Exchange (ETDEWEB)

    Ching, Tao-Chung; Lai, Shih-Ping [Institute of Astronomy and Department of Physics, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Zhang, Qizhou; Girart, Josep M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge MA 02138 (United States); Qiu, Keping [School of Astronomy and Space Science, Nanjing University, 163 Xianlin Avenue, Nanjing 210023 (China); Liu, Hauyu B., E-mail: chingtaochung@gmail.com [European Southern Observatory (ESO), Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany)

    2017-04-01

    We present Submillimeter Array 880 μ m dust polarization observations of six massive dense cores in the DR21 filament. The dust polarization shows complex magnetic field structures in the massive dense cores with sizes of 0.1 pc, in contrast to the ordered magnetic fields of the parsec-scale filament. The major axes of the massive dense cores appear to be aligned either parallel or perpendicular to the magnetic fields of the filament, indicating that the parsec-scale magnetic fields play an important role in the formation of the massive dense cores. However, the correlation between the major axes of the cores and the magnetic fields of the cores is less significant, suggesting that during the core formation, the magnetic fields below 0.1 pc scales become less important than the magnetic fields above 0.1 pc scales in supporting a core against gravity. Our analysis of the angular dispersion functions of the observed polarization segments yields a plane-of-sky magnetic field strength of 0.4–1.7 mG for the massive dense cores. We estimate the kinematic, magnetic, and gravitational virial parameters of the filament and the cores. The virial parameters show that the gravitational energy in the filament dominates magnetic and kinematic energies, while the kinematic energy dominates in the cores. Our work suggests that although magnetic fields may play an important role in a collapsing filament, the kinematics arising from gravitational collapse must become more important than magnetic fields during the evolution from filaments to massive dense cores.

  12. Effective particle magnetic moment of multi-core particles

    NARCIS (Netherlands)

    Ahrentorp, F.; Astalan, A.; Blomgren, J.; Jonasson, C.; Wetterskog, E.; Svedlindh, P.; Lak, A.; Ludwig, F.; Van IJzendoorn, L.J.; Westphal, F.; Grüttner, C.; Gehrke, N.; Gustafsson, S.; Olsson, E.; Johansson, C.

    2015-01-01

    In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron

  13. Pulsed air-core deflector-magnet design parameters

    International Nuclear Information System (INIS)

    Jason, A.J.; Cooper, R.K.; Liebman, A.D.; Blind, B.; Koelle, A.R.

    1983-01-01

    The response of air-core magnets to pulsed excitation is dependent on the pulse frequency spectrum because of fields produced by induced currents in the magnet structure. We discuss this phenomenon quantitatively in terms of magnet performance optimization

  14. Monte Carlo simulation of magnetic multi-core nanoparticles

    International Nuclear Information System (INIS)

    Schaller, Vincent; Wahnstroem, Goeran; Sanz-Velasco, Anke; Enoksson, Peter; Johansson, Christer

    2009-01-01

    In this paper, a Monte Carlo simulation is carried out to evaluate the equilibrium magnetization of magnetic multi-core nanoparticles in a liquid and subjected to a static magnetic field. The particles contain a magnetic multi-core consisting of a cluster of magnetic single-domains of magnetite. We show that the magnetization of multi-core nanoparticles cannot be fully described by a Langevin model. Inter-domain dipolar interactions and domain magnetic anisotropy contribute to decrease the magnetization of the particles, whereas the single-domain size distribution yields an increase in magnetization. Also, we show that the interactions affect the effective magnetic moment of the multi-core nanoparticles.

  15. Hysteresis effects in the cores of particle accelerator magnets

    CERN Document Server

    AUTHOR|(CDS)2086181; Schoerling, Daniel

    A study of the hysteresis effects in the cores of particle accelerator magnets has been performed in the framework of the work presented in this thesis. This study has been focused on normal conducting particle accelerator magnets whose cores are manufactured using ferromagnetic materials. The magnetic circuits have been modelled using the developed models: one model for the magnetic circuit and one for the magnetization of the material in the core. The parameters of the magnetic circuit model have been identified with the help of simulations which rely on the finite element method (Opera 3D), while the parameters of the magnetic hysteresis model have been identified through experimental measurements performed using a method developed in the framework of this work. The modelling results have been validated by means of experimental measurements performed on two magnets: one small size magnet which has been specifically designed and manufactured, and one magnet which is currently used in a particle accelerator ...

  16. Effective particle magnetic moment of multi-core particles

    International Nuclear Information System (INIS)

    Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian; Wetterskog, Erik; Svedlindh, Peter; Lak, Aidin; Ludwig, Frank; IJzendoorn, Leo J. van; Westphal, Fritz; Grüttner, Cordula; Gehrke, Nicole; Gustafsson, Stefan; Olsson, Eva; Johansson, Christer

    2015-01-01

    In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems – BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm – and one single-core particle system – SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm

  17. Effective particle magnetic moment of multi-core particles

    Science.gov (United States)

    Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian; Wetterskog, Erik; Svedlindh, Peter; Lak, Aidin; Ludwig, Frank; van IJzendoorn, Leo J.; Westphal, Fritz; Grüttner, Cordula; Gehrke, Nicole; Gustafsson, Stefan; Olsson, Eva; Johansson, Christer

    2015-04-01

    In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems - BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm - and one single-core particle system - SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm.

  18. Effective particle magnetic moment of multi-core particles

    Energy Technology Data Exchange (ETDEWEB)

    Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian [Acreo Swedish ICT AB, Arvid Hedvalls backe 4, SE-411 33 Göteborg (Sweden); Wetterskog, Erik; Svedlindh, Peter [Department of Engineering Sciences, Uppsala University, Box 534, SE-751 21 Uppsala (Sweden); Lak, Aidin; Ludwig, Frank [Institute of Electrical Measurement and Fundamental Electrical Engineering, TU Braunschweig, D‐38106 Braunschweig Germany (Germany); IJzendoorn, Leo J. van [Department of Applied Physics, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Westphal, Fritz; Grüttner, Cordula [Micromod Partikeltechnologie GmbH, D ‐18119 Rostock (Germany); Gehrke, Nicole [nanoPET Pharma GmbH, D ‐10115 Berlin Germany (Germany); Gustafsson, Stefan; Olsson, Eva [Department of Applied Physics, Chalmers University of Technology, SE-412 96 Göteborg (Sweden); Johansson, Christer, E-mail: christer.johansson@acreo.se [Acreo Swedish ICT AB, Arvid Hedvalls backe 4, SE-411 33 Göteborg (Sweden)

    2015-04-15

    In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems – BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm – and one single-core particle system – SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm.

  19. A beam position monitor using an amorphous magnetic core

    International Nuclear Information System (INIS)

    Kobayashi, Toshiaki; Ueda, Toru; Yoshida, Yoichi; Kozawa, Takahiro; Uesaka, Mitsuru; Miya, Kenzo; Tagawa, Seiichi; Kobayashi, Hitoshi.

    1994-01-01

    A beam position monitor for an electron accelerator has been developed by using an amorphous magnetic core. The position is detected by the difference of leakage inductances of four pickup coils wound on the amorphous magnetic core. The accuracy of the beam position monitor is less than 1 mm for the various electron pulses from nanosecond to microsecond. (author)

  20. Size analysis of single-core magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ludwig, Frank, E-mail: f.ludwig@tu-bs.de [Institut für Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany); Balceris, Christoph; Viereck, Thilo [Institut für Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany); Posth, Oliver; Steinhoff, Uwe [Physikalisch-Technische Bundesanstalt, Berlin (Germany); Gavilan, Helena; Costo, Rocio [Instituto de Ciencia de Materiales de Madrid, ICMM/CSIC, Madrid (Spain); Zeng, Lunjie; Olsson, Eva [Department of Applied Physics, Chalmers University of Technology, Göteborg (Sweden); Jonasson, Christian; Johansson, Christer [ACREO Swedish ICT AB, Göteborg (Sweden)

    2017-04-01

    Single-core iron-oxide nanoparticles with nominal core diameters of 14 nm and 19 nm were analyzed with a variety of non-magnetic and magnetic analysis techniques, including transmission electron microscopy (TEM), dynamic light scattering (DLS), static magnetization vs. magnetic field (M-H) measurements, ac susceptibility (ACS) and magnetorelaxometry (MRX). From the experimental data, distributions of core and hydrodynamic sizes are derived. Except for TEM where a number-weighted distribution is directly obtained, models have to be applied in order to determine size distributions from the measurand. It was found that the mean core diameters determined from TEM, M-H, ACS and MRX measurements agree well although they are based on different models (Langevin function, Brownian and Néel relaxation times). Especially for the sample with large cores, particle interaction effects come into play, causing agglomerates which were detected in DLS, ACS and MRX measurements. We observed that the number and size of agglomerates can be minimized by sufficiently strong diluting the suspension. - Highlights: • Investigation of size parameters of single-core magnetic nanoparticles with nominal core diameters of 14 nm and 19 nm utilizing different magnetic and non-magnetic methods • Hydrodynamic size determined from ac susceptibility measurements is consistent with the DLS findings • Core size agrees determined from static magnetization curves, MRX and ACS data agrees with results from TEM although the estimation is based on different models (Langevin function, Brownian and Néel relaxation times).

  1. Loss characteristics of FLTD magnetic cores under fast pulsed voltage

    International Nuclear Information System (INIS)

    Wang Zhiguo; Sun Fengju; Qiu Aici; Jiang Xiaofeng; Liang Tianxue; Yin Jiahui; Liu Peng; Wei Hao; Zhang Pengfei; Zhang Zhong

    2012-01-01

    The test platform has been developed to generate exciting pulsed voltages with the rise time less than 30 ns. The loss characteristics of cores of 25 μm 2605TCA Metglas and 50 μm DG6 electrical steel were then studied. A characteristic parameter, the gradient of the voltage pulse applied per unit core area, is proposed to describe the exciting condition applied on magnetic cores. The loss of the DG6 core is about 4 times that of the 2605TCA core. Most loss of the DG6 core, about 75%, is due to eddy current. For the 2605TCA core, the percentage is about 28%. (authors)

  2. Core/Shell Structured Magnetic Nanoparticles for Biological Applications

    International Nuclear Information System (INIS)

    Park, Jeong Chan; Jung, Myung Hwan

    2013-01-01

    Magnetic nanoparticles have been widely used for biomedical applications, such as magnetic resonance imaging (MRI), hyperthermia, drug delivery and cell signaling. The surface modification of the nanomaterials is required for biomedical use to give physiogical stability, surface reactivity and targeting properties. Among many approaches for the surface modification with materials, such as polymers, organic ligands and metals, one of the most attractive ways is using metals. The fabrication of metal-based, monolayer-coated magnetic nanoparticles has been intensively studied. However, the synthesis of metal-capped magnetic nanoparticles with monodispersities and controllable sizes is still challenged. Recently, gold-capped magnetic nanoparticles have been reported to increase stability and to provide biocompatibility. Magnetic nanoparticle with gold coating is an attractive system, which can be stabilized in biological conditions and readily functionalized in biological conditions and readily functionalized through well-established surface modification (Au-S) chemistry. The Au coating offers plasmonic properties to magnetic nanoparticles. This makes the magnetic/Au core/shell combinations interesting for magnetic and optical applications. Herein, the synthesis and characterization of gold capped-magnetic core structured nanomaterials with different gold sources, such as gold acetate and chloroauric acid have been reported. The core/shell nanoparticles were transferred from organic to aqueous solutions for biomedical applications. Magnetic core/shell structured nanoparticles have been prepared and transferred from organic phase to aqueous solutions. The resulting Au-coated magnetic core nanoparticles might be an attractive system for biomedical applications, which are needed both magnetic resonance imaging and optical imaging

  3. Electrochemical synthesis of CORE-shell magnetic nanowires

    KAUST Repository

    Ovejero, Jesú s G.; Bran, Cristina; Vidal, Enrique Vilanova; Kosel, Jü rgen; Morales, Marí a P.; Vazquez, Manuel

    2015-01-01

    (Fe, Ni, CoFe) @ Au core-shell magnetic nanowires have been synthesized by optimized two-step potentiostatic electrodeposition inside self-assembled nanopores of anodic aluminium templates. The optimal electrochemical parameters (e.g., potential

  4. New design on air-core resistive NMR imaging magnet

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yan; Mingwu, Fan; Yixin, Miao

    1984-08-01

    A new type of NMR imaging air-core resistive magnet is designed. Based on the BIM Magnetostatic calculation the resultant four equiradial coils structure with optimized shapes of cross section possesses a larger spherical working volume obviously, comparing with the common four-coils imaging magnet. The manufacturing tolerance is also calculated.

  5. SYNTHETIC OBSERVATIONS OF MAGNETIC FIELDS IN PROTOSTELLAR CORES

    International Nuclear Information System (INIS)

    Lee, Joyce W. Y.; Hull, Charles L. H.; Offner, Stella S. R.

    2017-01-01

    The role of magnetic fields in the early stages of star formation is not well constrained. In order to discriminate between different star formation models, we analyze 3D magnetohydrodynamic simulations of low-mass cores and explore the correlation between magnetic field orientation and outflow orientation over time. We produce synthetic observations of dust polarization at resolutions comparable to millimeter-wave dust polarization maps observed by the Combined Array for Research in Millimeter-wave Astronomy and compare these with 2D visualizations of projected magnetic field and column density. Cumulative distribution functions of the projected angle between the magnetic field and outflow show different degrees of alignment in simulations with differing mass-to-flux ratios. The distribution function for the less magnetized core agrees with observations finding random alignment between outflow and field orientations, while the more magnetized core exhibits stronger alignment. We find that fractional polarization increases when the system is viewed such that the magnetic field is close to the plane of the sky, and the values of fractional polarization are consistent with observational measurements. The simulation outflow, which reflects the underlying angular momentum of the accreted gas, changes direction significantly over over the first ∼0.1 Myr of evolution. This movement could lead to the observed random alignment between outflows and the magnetic fields in protostellar cores.

  6. Core losses of a permanent magnet synchronous motor with an amorphous stator core under inverter and sinusoidal excitations

    Science.gov (United States)

    Yao, Atsushi; Sugimoto, Takaya; Odawara, Shunya; Fujisaki, Keisuke

    2018-05-01

    We report core loss properties of permanent magnet synchronous motors (PMSM) with amorphous magnetic materials (AMM) core under inverter and sinusoidal excitations. To discuss the core loss properties of AMM core, a comparison with non-oriented (NO) core is also performed. In addition, based on both experiments and numerical simulations, we estimate higher (time and space) harmonic components of the core losses under inverter and sinusoidal excitations. The core losses of PMSM are reduced by about 59% using AMM stator core instead of NO core under sinusoidal excitation. We show that the average decrease obtained by using AMM instead of NO in the stator core is about 94% in time harmonic components.

  7. Electrochemical synthesis of CORE-shell magnetic nanowires

    KAUST Repository

    Ovejero, Jesús G.

    2015-04-16

    (Fe, Ni, CoFe) @ Au core-shell magnetic nanowires have been synthesized by optimized two-step potentiostatic electrodeposition inside self-assembled nanopores of anodic aluminium templates. The optimal electrochemical parameters (e.g., potential) have been firstly determined for the growth of continuous Au nanotubes at the inner wall of pores. Then, a magnetic core was synthesized inside the Au shells under suitable electrochemical conditions for a wide spectrum of single elements and alloy compositions (e.g., Fe, Ni and CoFe alloys). Novel opportunities offered by such nanowires are discussed particularly the magnetic behavior of (Fe, Ni, CoFe) @ Au core-shell nanowires was tested and compared with that of bare TM nanowires. These core-shell nanowires can be released from the template so, opening novel opportunities for biofunctionalization of individual nanowires.

  8. Modelling of magnetostriction of transformer magnetic core for vibration analysis

    Science.gov (United States)

    Marks, Janis; Vitolina, Sandra

    2017-12-01

    Magnetostriction is a phenomenon occurring in transformer core in normal operation mode. Yet in time, it can cause the delamination of magnetic core resulting in higher level of vibrations that are measured on the surface of transformer tank during diagnostic tests. The aim of this paper is to create a model for evaluating elastic deformations in magnetic core that can be used for power transformers with intensive vibrations in order to eliminate magnetostriction as a their cause. Description of the developed model in Matlab and COMSOL software is provided including restrictions concerning geometry and properties of materials, and the results of performed research on magnetic core anisotropy are provided. As a case study modelling of magnetostriction for 5-legged 200 MVA power transformer with the rated voltage of 13.8/137kV is conducted, based on which comparative analysis of vibration levels and elastic deformations is performed.

  9. Modelling of magnetostriction of transformer magnetic core for vibration analysis

    Directory of Open Access Journals (Sweden)

    Marks Janis

    2017-12-01

    Full Text Available Magnetostriction is a phenomenon occurring in transformer core in normal operation mode. Yet in time, it can cause the delamination of magnetic core resulting in higher level of vibrations that are measured on the surface of transformer tank during diagnostic tests. The aim of this paper is to create a model for evaluating elastic deformations in magnetic core that can be used for power transformers with intensive vibrations in order to eliminate magnetostriction as a their cause. Description of the developed model in Matlab and COMSOL software is provided including restrictions concerning geometry and properties of materials, and the results of performed research on magnetic core anisotropy are provided. As a case study modelling of magnetostriction for 5-legged 200 MVA power transformer with the rated voltage of 13.8/137kV is conducted, based on which comparative analysis of vibration levels and elastic deformations is performed.

  10. Soft magnetic characteristics of laminated magnetic block cores assembled with a high Bs nanocrystalline alloy

    Directory of Open Access Journals (Sweden)

    Atsushi Yao

    2018-05-01

    Full Text Available This paper focuses on an evaluation of core losses in laminated magnetic block cores assembled with a high Bs nanocrystalline alloy in high magnetic flux density region. To discuss the soft magnetic properties of the high Bs block cores, the comparison with amorphous (SA1 block cores is also performed. In the high Bs block core, both low core losses and high saturation flux densities Bs are satisfied in the low frequency region. Furthermore, in the laminated block core made of the high Bs alloy, the rate of increase of iron losses as a function of the magnetic flux density remains small up to around 1.6 T, which cannot be realized in conventional laminated block cores based on amorphous alloy. The block core made of the high Bs alloy exhibits comparable core loss with that of amorphous alloy core in the high-frequency region. Thus, it is expected that this laminated high Bs block core can achieve low core losses and high saturation flux densities in the high-frequency region.

  11. YOUNG STARLESS CORES EMBEDDED IN THE MAGNETICALLY DOMINATED PIPE NEBULA

    International Nuclear Information System (INIS)

    Frau, P.; Girart, J. M.; Alves, F. O.; Beltran, M. T.; Morata, O.; Masque, J. M.; Busquet, G.; Sanchez-Monge, A.; Estalella, R.; Franco, G. A. P.

    2010-01-01

    The Pipe Nebula is a massive, nearby dark molecular cloud with a low star formation efficiency which makes it a good laboratory in which to study the very early stages of the star formation process. The Pipe Nebula is largely filamentary and appears to be threaded by a uniform magnetic field at scales of a few parsecs, perpendicular to its main axis. The field is only locally perturbed in a few regions, such as the only active cluster-forming core B59. The aim of this study is to investigate primordial conditions in low-mass pre-stellar cores and how they relate to the local magnetic field in the cloud. We used the IRAM 30 m telescope to carry out a continuum and molecular survey at 3 and 1 mm of early- and late-time molecules toward four selected starless cores inside the Pipe Nebula. We found that the dust continuum emission maps trace the densest regions better than previous Two Micron All Sky Survey (2MASS) extinction maps, while 2MASS extinction maps trace the diffuse gas better. The properties of the cores derived from dust emission show average radii of ∼0.09 pc, densities of ∼1.3x10 5 cm -3 , and core masses of ∼2.5 M sun . Our results confirm that the Pipe Nebula starless cores studied are in a very early evolutionary stage and present a very young chemistry with different properties that allow us to propose an evolutionary sequence. All of the cores present early-time molecular emission with CS detections in the whole sample. Two of them, cores 40 and 109, present strong late-time molecular emission. There seems to be a correlation between the chemical evolutionary stage of the cores and the local magnetic properties that suggests that the evolution of the cores is ruled by a local competition between the magnetic energy and other mechanisms, such as turbulence.

  12. Hydromagnetic instabilities and magnetic field amplification in core collapse supernovae

    Energy Technology Data Exchange (ETDEWEB)

    Cerda-Duran, P; Obergaulinger, M; Mueller, E [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-st. 1, 85748 Garching (Germany); Aloy, M A; Font, J A, E-mail: cerda@mpa-garching.mpg.de [Departamento de Astronomia y Astrofisica, Universidad de Valencia, 46100 Burjassot, Valencia (Spain)

    2011-09-22

    Some of the most violent events in the universe, the gamma ray burst, could be related to the gravitational collapse of massive stellar cores. The recent association of long GRBs to some class of type Ic supernova seems to support this view. In such scenario fast rotation, strong magnetic fields and general relativistic effects are key ingredients. It is thus important to understand the mechanism that amplifies the magnetic field under that conditions. I present global simulations of the magneto-rotational collapse of stellar cores in general relativity and semi-global simulations of hydromagnetic instabilities under core collapse conditions. I discuss effect of the magneto-rotational instability and the magnetic field amplification during the collapse, the uncertainties in this process and the dynamical effects in the supernova explosion.

  13. Modelling the core magnetic field of the earth

    Science.gov (United States)

    Harrison, C. G. A.; Carle, H. M.

    1982-01-01

    It is suggested that radial off-center dipoles located within the core of the earth be used instead of spherical harmonics of the magnetic potential in modeling the core magnetic field. The off-center dipoles, in addition to more realistically modeling the physical current systems within the core, are if located deep within the core more effective at removing long wavelength signals of either potential or field. Their disadvantage is that their positions and strengths are more difficult to compute, and such effects as upward and downward continuation are more difficult to manipulate. It is nevertheless agreed with Cox (1975) and Alldredge and Hurwitz (1964) that physical realism in models is more important than mathematical convenience. A radial dipole model is presented which agrees with observations of secular variation and excursions.

  14. Error Analysis of High Frequency Core Loss Measurement for Low-Permeability Low-Loss Magnetic Cores

    DEFF Research Database (Denmark)

    Niroumand, Farideh Javidi; Nymand, Morten

    2016-01-01

    in magnetic cores is B-H loop measurement where two windings are placed on the core under test. However, this method is highly vulnerable to phase shift error, especially for low-permeability, low-loss cores. Due to soft saturation and very low core loss, low-permeability low-loss magnetic cores are favorable...... in many of the high-efficiency high power-density power converters. Magnetic powder cores, among the low-permeability low-loss cores, are very attractive since they possess lower magnetic losses in compared to gapped ferrites. This paper presents an analytical study of the phase shift error in the core...... loss measuring of low-permeability, low-loss magnetic cores. Furthermore, the susceptibility of this measurement approach has been analytically investigated under different excitations. It has been shown that this method, under square-wave excitation, is more accurate compared to sinusoidal excitation...

  15. Comparison of Magnetic Characteristics of Powder Magnetic Core and Evaluation of Motor Characteristics

    Science.gov (United States)

    Enomoto, Yuji; Ito, Motoya; Masaki, Ryozo; Yamazaki, Katsuyuki; Asaka, Kazuo; Ishihara, Chio; Ohiwa, Syoji

    A magnetic characteristic measurement, a motor characteristic forecast, and an experimental evaluation of various powder magnetic cores were performed aiming at a fixed quantity grasp when the powder magnetic core was applied to the motor core as the magnetic material. The manufacturing conditions were changed, and magnetic characteristic compares a direct current magnetization characteristic and an iron disadvantageous characteristic with the silicon steel board for a different powder magnetic core. Therefore, though some permeabilities are low, characteristics almost equal to those of a silicon steel board were obtained in the maximum saturation magnetic induction, which confirms that the powder magnetic core in disadvantageous iron in a certain frequency domain, and to confirm disadvantageous iron lowers. Moreover, it has been shown to obtain characteristics almost equal to the silicon steel board when compared in terms of motor efficiency, though some disadvantageous iron increases since the effect when applying to the motor is verified the silicon steel board and the comparison evaluation for the surface type permanent magnet motor.

  16. Misalignment of Magnetic Fields and Outflows in Protostellar Cores

    OpenAIRE

    Hull, Charles L. H.; Plambeck, Richard L.; Bolatto, Alberto D.; Bower, Geoffrey C.; Carpenter, John M.; Crutcher, Richard M.; Fiege, Jason D.; Franzmann, Erika; Hakobian, Nicholas S.; Heiles, Carl; Houde, Martin; Hughes, A. Meredith; Jameson, Katherine; Kwon, Woojin; Lamb, James W.

    2013-01-01

    We present results of λ1.3 mm dust-polarization observations toward 16 nearby, low-mass protostars, mapped with ~2."5 resolution at CARMA. The results show that magnetic fields in protostellar cores on scales of ~1000 AU are not tightly aligned with outflows from the protostars. Rather, the data are consistent with scenarios where outflows and magnetic fields are preferentially misaligned (perpendicular), or where they are randomly aligned. If one assumes that outflows emerge along the rotati...

  17. Ultrathin Interface Regime of Core-Shell Magnetic Nanoparticles for Effective Magnetism Tailoring.

    Science.gov (United States)

    Moon, Seung Ho; Noh, Seung-Hyun; Lee, Jae-Hyun; Shin, Tae-Hyun; Lim, Yongjun; Cheon, Jinwoo

    2017-02-08

    The magnetic exchange coupling interaction between hard and soft magnetic phases has been important for tailoring nanoscale magnetism, but spin interactions at the core-shell interface have not been well studied. Here, we systematically investigated a new interface phenomenon termed enhanced spin canting (ESC), which is operative when the shell thickness becomes ultrathin, a few atomic layers, and exhibits a large enhancement of magnetic coercivity (H C ). We found that ESC arises not from the typical hard-soft exchange coupling but rather from the large magnetic surface anisotropy (K S ) of the ultrathin interface. Due to this large increase in magnetism, ultrathin core-shell nanoparticles overreach the theoretical limit of magnetic energy product ((BH) max ) and exhibit one of the largest values of specific loss power (SLP), which testifies to their potential capability as an effective mediator of magnetic energy conversion.

  18. Core Problem: Does the CV Parent Body Magnetization require differentiation?

    Science.gov (United States)

    O'Brien, T.; Tarduno, J. A.; Smirnov, A. V.

    2016-12-01

    Evidence for the presence of past dynamos from magnetic studies of meteorites can provide key information on the nature and evolution of parent bodies. However, the suggestion of a past core dynamo for the CV parent body based on the study of the Allende meteorite has led to a paradox: a core dynamo requires differentiation, evidence for which is missing in the meteorite record. The key parameter used to distinguish core dynamo versus external field mechanisms is absolute field paleointensity, with high values (>>1 μT) favoring the former. Here we explore the fundamental requirements for absolute field intensity measurement in the Allende meteorite: single domain grains that are non-interacting. Magnetic hysteresis and directional data define strong magnetic interactions, negating a standard interpretation of paleointensity measurements in terms of absolute paleofield values. The Allende low field magnetic susceptibility is dominated by magnetite and FeNi grains, whereas the magnetic remanence is carried by an iron sulfide whose remanence-carrying capacity increases with laboratory cycling at constant field values, indicating reordering. The iron sulfide and FeNi grains are in close proximity, providing mineralogical context for interactions. We interpret the magnetization of Allende to record the intense early solar wind with metal-sulfide interactions amplifying the field, giving the false impression of a higher field value in some prior studies. An undifferentiated CV parent body is thus compatible with Allende's magnetization. Early solar wind magnetization should be the null hypothesis for evaluating the source of magnetization for chondrites and other meteorites.

  19. Misalignment of magnetic fields and outflows in protostellar cores

    NARCIS (Netherlands)

    Hull, Charles L. H.; Plambeck, Richard L.; Bolatto, Alberto D.; Bower, Geoffrey C.; Carpenter, John M.; Crutcher, Richard M.; Fiege, Jason D.; Franzmann, Erica; Hakobian, Nicholas S.; Heiles, Carl; Houde, Martin; Hughes, A. Meredith; Jameson, Katherine; Kwon, Woojin; Lamb, James W.; Looney, Leslie W.; Matthews, Brenda C.; Mundy, Lee; Pillai, Thushara; Pound, Marc W.; Stephens, Ian W.; Tobin, John J.; Vaillancourt, John E.; Volgenau, N. H.; Wright, Melvyn C. H.

    2013-01-01

    We present results of lambda 1.3 mm dust-polarization observations toward 16 nearby, low-mass protostars, mapped with similar to 2 ''.5 resolution at CARMA. The results show that magnetic fields in protostellar cores on scales of similar to 1000 AU are not tightly aligned with outflows from the

  20. Decreasing the radiation quality factor of magnetic dipole antennas by a magnetic-coated metal core

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Breinbjerg, Olav

    2010-01-01

    To achieve the Chu lower bound for the radiation Q, an electrically small magnetic dipole antenna should not store any magnetic energy internally to the minimum sphere enclosing the antenna. As shown in our previous works, the internal stored magnetic energy can be reduced, although not entirely...... eliminated, by introducing a solid magnetic core inside the antenna. In this paper, using analytical results obtained though the vector spherical wave theory, we show that the internal stored magnetic energy can be further reduced, and the Chu lower bound reached, for a spherical magnetic dipole antenna...

  1. Modeling analysis of pulsed magnetization process of magnetic core based on inverse Jiles-Atherton model

    Science.gov (United States)

    Liu, Yi; Zhang, He; Liu, Siwei; Lin, Fuchang

    2018-05-01

    The J-A (Jiles-Atherton) model is widely used to describe the magnetization characteristics of magnetic cores in a low-frequency alternating field. However, this model is deficient in the quantitative analysis of the eddy current loss and residual loss in a high-frequency magnetic field. Based on the decomposition of magnetization intensity, an inverse J-A model is established which uses magnetic flux density B as an input variable. Static and dynamic core losses under high frequency excitation are separated based on the inverse J-A model. Optimized parameters of the inverse J-A model are obtained based on particle swarm optimization. The platform for the pulsed magnetization characteristic test is designed and constructed. The hysteresis curves of ferrite and Fe-based nanocrystalline cores at high magnetization rates are measured. The simulated and measured hysteresis curves are presented and compared. It is found that the inverse J-A model can be used to describe the magnetization characteristics at high magnetization rates and to separate the static loss and dynamic loss accurately.

  2. Core-shell magnetic nanowires fabrication and characterization

    Energy Technology Data Exchange (ETDEWEB)

    Kalska-Szostko, B., E-mail: kalska@uwb.edu.pl [Institute of Chemistry, University of Bialystok, Ciolkowskiego 1K, 15-245 Bialystok (Poland); Faculty of Physics, University of Bialystok, Ciolkowskiego 1L, 15-245 Bialystok, Poland (Poland); Klekotka, U.; Satuła, D. [Institute of Chemistry, University of Bialystok, Ciolkowskiego 1K, 15-245 Bialystok (Poland); Faculty of Physics, University of Bialystok, Ciolkowskiego 1L, 15-245 Bialystok, Poland (Poland)

    2017-02-28

    Highlights: • New approach for nanowires modification are presented. • Physical and chemical characterization of the nanowires are shown. • Properties modulations as an effect of the surface layer composition are discussed. - Abstract: In this paper, a new way of the preparation of core-shell magnetic nanowires has been proposed. For the modification Fe nanowires were prepared by electrodeposition in anodic aluminium oxide matrixes, in first step. In second, by wetting chemical deposition, shell layers of Ag, Au or Cu were obtained. Resultant core-shell nanowires structure was characterized by X-ray diffraction, infrared spectroscopy, transmission electron microscopy, and energy dispersive x-ray. Whereas magnetic properties by Mössbauer spectroscopy.

  3. Magnetic loss analysis in Mn-Zn ferrite cores

    International Nuclear Information System (INIS)

    Beatrice, C.; Bottauscio, O.; Chiampi, M.; Fiorillo, F.; Manzin, A.

    2006-01-01

    Magnetic losses have been measured and analyzed upon a wide range of frequencies in Mn-Zn ferrite ring cores. Exploiting the concept of loss separation and modeling the conductivity process in the heterogeneous material as a function of frequency, the role of the different energy dissipation mechanisms has been elucidated. It is shown, in particular, that eddy current effects can be appreciated, in standard materials and cores, only on approaching and overcoming the MHz range. The basic mechanism for hysteresis and low-frequency losses is therefore identified with the domain wall relaxation engendered by spin damping processes. Resonant absorption of energy associated with magnetization rotation is in turn deemed to chiefly contribute to the loss upon the practical range of frequencies going from a few 10 4 Hz to a few MHz

  4. Transformer core modeling for magnetizing inrush current investigation

    Directory of Open Access Journals (Sweden)

    A.Yahiou

    2014-03-01

    Full Text Available The inrush currents generated during an energization of power transformer can reach very high values and may cause many problems in power system. This magnetizing inrush current which occurs at the time of energization of a transformer is due to temporary overfluxing in the transformer core. Its magnitude mainly depends on switching parameters such as the resistance of the primary winding and the point-on-voltage wave (switching angle. This paper describes a system for measuring the inrush current which is composed principally of an acquisition card (EAGLE, and LabVIEW code. The system is also capable of presetting various combinations of switching parameters for the energization of a 2 kVA transformer via an electronic card. Moreover, an algorithm for calculating the saturation curve is presented taking the iron core reactive losses into account, thereby producing a nonlinear inductance. This curve is used to simulate the magnetizing inrush current using the ATP-EMTP software.

  5. Core losses of a permanent magnet synchronous motor with an amorphous stator core under inverter and sinusoidal excitations

    Directory of Open Access Journals (Sweden)

    Atsushi Yao

    2018-05-01

    Full Text Available We report core loss properties of permanent magnet synchronous motors (PMSM with amorphous magnetic materials (AMM core under inverter and sinusoidal excitations. To discuss the core loss properties of AMM core, a comparison with non-oriented (NO core is also performed. In addition, based on both experiments and numerical simulations, we estimate higher (time and space harmonic components of the core losses under inverter and sinusoidal excitations. The core losses of PMSM are reduced by about 59% using AMM stator core instead of NO core under sinusoidal excitation. We show that the average decrease obtained by using AMM instead of NO in the stator core is about 94% in time harmonic components.

  6. Investigating the impact of uneven magnetic flux density distribution on core loss estimation

    DEFF Research Database (Denmark)

    Niroumand, Farideh Javidi; Nymand, Morten; Wang, Yiren

    2017-01-01

    is calculated according to an effective flux density value and the macroscopic dimensions of the cores. However, the flux distribution in the core can alter by core shapes and/or operating conditions due to nonlinear material properties. This paper studies the element-wise estimation of the loss in magnetic......There are several approaches for loss estimation in magnetic cores, and all these approaches highly rely on accurate information about flux density distribution in the cores. It is often assumed that the magnetic flux density evenly distributes throughout the core and the overall core loss...

  7. Investigation of magnetic active core sizes and hydrodynamic diameters of a magnetically fractionated ferrofluid

    International Nuclear Information System (INIS)

    Büttner, Markus; Weber, Peter; Schmidl, Frank; Seidel, Paul; Röder, Michael; Schnabelrauch, Matthias; Wagner, Kerstin; Görnert, Peter; Glöckl, Gunnar; Weitschies, Werner

    2011-01-01

    In this work we address the question which relates between the size of the magnetically active core of magnetic nanoparticles (MNPs) and the size of the overall particle in the solution (the so-called hydrodynamic diameter d hyd ) exists. For this purpose we use two methods of examination that can deliver conclusions about the properties of MNP which are not accessible with normal microscopy. On the one hand, we use temperature dependent magnetorelaxation (TMRX) method, which enables direct access to the energy barrier distribution and by using additional hysteresis loop measurements can provide details about the size of the magnetically active cores. On the other hand, to determine the size of the overall particle in the solution, we use the magnetooptical relaxation of ferrofluids (MORFF) method, where the stimulation is done magnetically while the reading of the relaxation signal, however, is done optically. As a basis for the examinations in this work we use a ferrofluid that was developed for medicinal purposes and which has been fractioned magnetically to obtain differently sized fractions of MNPs. The two values obtained through these methods for each fraction shows the success in fractioning the original solution. Therefore, one can conclude a direct correlation between the size of the magnetically active core and the size of the complete particle in the solution from the experimental results. To calculate the size of the magnetically active core we found a temperature dependent anisotropy constant which was taken into account for the calculations. Furthermore, we found relaxation signals at 18 K for all fractions in these TMRX measurements, which have their origin in other magnetic effects than the Néel relaxation.

  8. Core losses of an inverter-fed permanent magnet synchronous motor with an amorphous stator core under no-load

    Directory of Open Access Journals (Sweden)

    Nicolas Denis

    2016-05-01

    Full Text Available In this paper, an interior permanent magnet synchronous motor (IPMSM with a stator core made of amorphous magnetic material (AMM is presented. The IPMSM is driven by a voltage source three-phase inverter with classical pulse width modulation (PWM control. The core losses under no-load condition are measured by experiment and compared to an equivalent IPMSM with a stator core made of NO steel. Under these conditions, the core losses are influenced by the stator, rotor and magnet shapes but also by the PWM carrier signal that implies a high frequency harmonic in the magnetic flux density. It is demonstrated that the AMM can reduce the core losses by about 56 %.

  9. Analysis of ringing effects due to magnetic core materials in pulsed nuclear magnetic resonance circuits

    International Nuclear Information System (INIS)

    Prabhu Gaunkar, N.; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C.; Bulu, I.; Ganesan, K.; Song, Y. Q.

    2015-01-01

    This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors

  10. Analysis of ringing effects due to magnetic core materials in pulsed nuclear magnetic resonance circuits

    Energy Technology Data Exchange (ETDEWEB)

    Prabhu Gaunkar, N., E-mail: neelampg@iastate.edu; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C. [Department of Electrical and Computer Engineering, Iowa State University, Ames, Iowa 50011 (United States); Bulu, I.; Ganesan, K.; Song, Y. Q. [Schlumberger-Doll Research, Cambridge, Massachusetts 02139 (United States)

    2015-05-07

    This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors.

  11. Broadband magnetic losses of nanocrystalline ribbons and powder cores

    Energy Technology Data Exchange (ETDEWEB)

    Beatrice, Cinzia, E-mail: c.beatrice@inrim.it [Istituto Nazionale di Ricerca Metrologica, Nanoscience and Materials Division, Torino (Italy); Dobák, Samuel [Institute of Physics, Faculty of Science, P.J. Šafárik University, Košice (Slovakia); Ferrara, Enzo; Fiorillo, Fausto [Istituto Nazionale di Ricerca Metrologica, Nanoscience and Materials Division, Torino (Italy); Ragusa, Carlo [Politecnico di Torino, Energy Department, Torino (Italy); Füzer, Ján; Kollár, Peter [Institute of Physics, Faculty of Science, P.J. Šafárik University, Košice (Slovakia)

    2016-12-15

    Finemet type alloys have been investigated from DC to 1 GHz at different induction levels upon different treatments: as amorphous precursors, as ribbons nanocrystallized with and without an applied saturating field, as consolidated powders. The lowest energy losses at all frequencies and maximum Snoek's product are exhibited by the transversally field-annealed ribbons. This is understood in terms of rotation-dominated magnetization process in the low-anisotropy material. Intergrain eddy currents are responsible for the fast increase of the losses with frequency and for early permeability relaxation of the powder cores. Evidence for resonant phenomena at high frequencies and for the ensuing inadequate role of the static magnetic constitutive equation of the material in solving the magnetization dynamics via the Maxwell's diffusion equation of the electromagnetic field is provided. It is demonstrated that, by taking the Landau–Lifshitz–Gilbert equation as a constitutive relation, the excellent frequency response of the transverse anisotropy ribbons can be described by analytical method.

  12. Magnetic motion capture system using LC resonant magnetic marker composed of Ni-Zn ferrite core

    International Nuclear Information System (INIS)

    Hashi, S.; Toyoda, M.; Ohya, M.; Okazaki, Y.; Yabukami, S.; Ishiyama, K.; Arai, K. I.

    2006-01-01

    We have proposed a magnetic motion capture system using an LC resonant magnetic marker. The proposed system is composed of an exciting coil, an LC marker, and a 5x5-matrix search coil array (25 search coils). The LC marker is small and has a minimal circuit with no battery and can be driven wirelessly by the action of electromagnetic induction. It consists of a Ni-Zn ferrite core (3 mmφx10 mm) with a wound coil and a chip capacitor, forming an LC series circuit with a resonant frequency of 186 kHz. The relative position accuracy of the system is less than 1 mm within the area of 100 mm 3 up to 150 mm from the search coil array. Compared with dc magnetic systems, the proposed system is applicable for precision motion capture in optically isolated spaces without magnetic shielding because the system is not greatly influenced by earth field noise

  13. Research on Power Output Characteristics of Magnetic Core in Energy Harvesting Devices

    Directory of Open Access Journals (Sweden)

    Rong-Ping GUO

    2014-07-01

    Full Text Available Magnetic core is the dominant factor in the performance of current transformer energy harvesting devices. The power output model of the magnetic core is established and verified through experiments. According to the actual application requirements, the concept of power density is proposed. The relationships of power density to air gap, material and dimension of the magnetic core are analyzed and verified through experiments.

  14. Phase locking of vortex cores in two coupled magnetic nanopillars

    Directory of Open Access Journals (Sweden)

    Qiyuan Zhu

    2014-11-01

    Full Text Available Phase locking dynamics of the coupled vortex cores in two identical magnetic spin valves induced by spin-polarized current are studied by means of micromagnetic simulations. Our results show that the available current range of phase locking can be expanded significantly by the use of constrained polarizer, and the vortices undergo large orbit motions outside the polarization areas. The effects of polarization areas and dipolar interaction on the phase locking dynamics are studied systematically. Phase locking parameters extracted from simulations are discussed by theoreticians. The dynamics of vortices influenced by spin valve geometry and vortex chirality are discussed at last. This work provides deeper insights into the dynamics of phase locking and the results are important for the design of spin-torque nano-oscillators.

  15. Criterion of magnetic saturation and simulation of nonlinear magnetization for a linear multi-core pulse transformer

    International Nuclear Information System (INIS)

    Zeng Zhengzhong; Kuai Bin; Sun Fengju; Cong Peitian; Qiu Aici

    2002-01-01

    The linear multi-core pulse transformer is an important primary driving source used in pulsed power apparatus for the production of dense plasm owing to its compact, relatively low-cost and easy-to-handle characteristics. The evaluation of the magnetic saturation of the transformer cores is essential to the transformer design, because the energy transfer efficiency of the transformer will degrade significantly after magnetic saturation. This work proposes analytical formulas of the criterion of magnetic saturation for the cores when the transformer drives practical loads. Furthermore, an electric circuit model based on a dependent source treatment for simulating the electric behavior of the cores related to their nonlinear magnetization is developed using the initial magnetization curve of the cores. The numerical simulation with the model is used to evaluate the validity of the criterion. Both the criterion and the model are found to be in agreement with the experimental data

  16. Magnetic field reversals, polar wander, and core-mantle coupling.

    Science.gov (United States)

    Courtillot, V; Besse, J

    1987-09-04

    True polar wander, the shifting of the entire mantle relative to the earth's spin axis, has been reanalyzed. Over the last 200 million years, true polar wander has been fast (approximately 5 centimeters per year) most of the time, except for a remarkable standstill from 170 to 110 million years ago. This standstill correlates with a decrease in the reversal frequency of the geomagnetic field and episodes of continental breakup. Conversely, true polar wander is high when reversal frequency increases. It is proposed that intermittent convection modulates the thickness of a thermal boundary layer at the base of the mantle and consequently the core-to-mantle heat flux. Emission of hot thermals from the boundary layer leads to increases in mantle convection and true polar wander. In conjunction, cold thermals released from a boundary layer at the top of the liquid core eventually lead to reversals. Changes in the locations of subduction zones may also affect true polar wander. Exceptional volcanism and mass extinctions at the Cretaceous-Tertiary and Permo-Triassic boundaries may be related to thermals released after two unusually long periods with no magnetic reversals. These environmental catastrophes may therefore be a consequence of thermal and chemical couplings in the earth's multilayer heat engine rather than have an extraterrestrial cause.

  17. Homogeneous protein analysis by magnetic core-shell nanorod probes

    KAUST Repository

    Schrittwieser, Stefan

    2016-03-29

    Studying protein interactions is of vital importance both to fundamental biology research and to medical applications. Here, we report on the experimental proof of a universally applicable label-free homogeneous platform for rapid protein analysis. It is based on optically detecting changes in the rotational dynamics of magnetically agitated core-shell nanorods upon their specific interaction with proteins. By adjusting the excitation frequency, we are able to optimize the measurement signal for each analyte protein size. In addition, due to the locking of the optical signal to the magnetic excitation frequency, background signals are suppressed, thus allowing exclusive studies of processes at the nanoprobe surface only. We study target proteins (soluble domain of the human epidermal growth factor receptor 2 - sHER2) specifically binding to antibodies (trastuzumab) immobilized on the surface of our nanoprobes and demonstrate direct deduction of their respective sizes. Additionally, we examine the dependence of our measurement signal on the concentration of the analyte protein, and deduce a minimally detectable sHER2 concentration of 440 pM. For our homogeneous measurement platform, good dispersion stability of the applied nanoprobes under physiological conditions is of vital importance. To that end, we support our measurement data by theoretical modeling of the total particle-particle interaction energies. The successful implementation of our platform offers scope for applications in biomarker-based diagnostics as well as for answering basic biology questions.

  18. Magnetic properties of Ni/Au core/shell studied by Monte Carlo simulations

    Energy Technology Data Exchange (ETDEWEB)

    Masrour, R., E-mail: rachidmasrour@hotmail.com [Laboratory of Materials, Processes, Environment and Quality, Cady Ayyed University, National School of Applied Sciences, Sidi Bouzid, Safi, 63 4600 (Morocco); LMPHE (URAC 12), Faculté des Sciences, Université Mohammed V-Agdal, Av. Ibn Batouta, B.P. 1014, Rabat (Morocco); Bahmad, L. [LMPHE (URAC 12), Faculté des Sciences, Université Mohammed V-Agdal, Av. Ibn Batouta, B.P. 1014, Rabat (Morocco); Hamedoun, M. [Institute of Nanomaterials and Nanotechnologies, MAScIR, Rabat (Morocco); Benyoussef, A. [LMPHE (URAC 12), Faculté des Sciences, Université Mohammed V-Agdal, Av. Ibn Batouta, B.P. 1014, Rabat (Morocco); Institute of Nanomaterials and Nanotechnologies, MAScIR, Rabat (Morocco); Hassan II Academy of Science and Technology, Rabat (Morocco); Hlil, E.K. [Institut Néel, CNRS et Université Joseph Fourier, BP 166, F-38042 Grenoble cedex 9 (France)

    2014-01-10

    The magnetic properties of ferromagnetic Ni/Au core/shell have been studied using Monte Carlo simulations within the Ising model framework. The considered Hamiltonian includes the exchange interactions between Ni–Ni, Au–Au and Ni–Au and the external magnetic field. The thermal total magnetizations and total magnetic susceptibilities of core/shell Ni/Au are computed. The critical temperature is deduced. The exchange interaction between Ni and Au atoms is obtained. In addition, the total magnetizations versus the external magnetic field and crystal filed for different temperature are also established.

  19. Quality factor of an electrically small magnetic dipole antenna with magneto-dielectric core

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Breinbjerg, Olav

    2010-01-01

    In this work, we investigate the radiation Q of electrically small magnetic dipole antennas with magneto-dielectric core versus the antenna electrical size, permittivity and permeability of the core. The investigation is based on the exact theory for a spherical magnetic dipole antenna...

  20. Observation of magnetic diffusion in the Earth's outer core from Magsat, Orsted, and CHAMP data

    DEFF Research Database (Denmark)

    Chulliat, A.; Olsen, Nils

    2010-01-01

    The frozen flux assumption consists in neglecting magnetic diffusion in the core. It has been widely used to compute core flows from geomagnetic observations. Here we investigate the validity of this assumption over the time interval 1980-2005, using high-precision magnetic data from the Magsat......, Orsted, and CHAMP satellites. A detectable change of magnetic fluxes through patches delimited by curves of zero radial magnetic field at the core-mantle boundary is associated with a failure of the frozen flux assumption. For each epoch (1980 and 2005), we calculate spatially regularized models...... of the core field which we use to investigate the change of reversed magnetic flux at the core surface. The largest and most robust change of reversed flux is observed for two patches: one located under St. Helena Island (near 20 degrees S, 15 degrees E); the other, much larger, is located under the South...

  1. Engineered magnetic core shell nanoprobes: Synthesis and applications to cancer imaging and therapeutics.

    Science.gov (United States)

    Mandal, Samir; Chaudhuri, Keya

    2016-02-26

    Magnetic core shell nanoparticles are composed of a highly magnetic core material surrounded by a thin shell of desired drug, polymer or metal oxide. These magnetic core shell nanoparticles have a wide range of applications in biomedical research, more specifically in tissue imaging, drug delivery and therapeutics. The present review discusses the up-to-date knowledge on the various procedures for synthesis of magnetic core shell nanoparticles along with their applications in cancer imaging, drug delivery and hyperthermia or cancer therapeutics. Literature in this area shows that magnetic core shell nanoparticle-based imaging, drug targeting and therapy through hyperthermia can potentially be a powerful tool for the advanced diagnosis and treatment of various cancers.

  2. Development of a beam current monitor by using an amorphous magnetic core

    International Nuclear Information System (INIS)

    Kobayashi, T.; Ueda, T.; Yoshida, Y.; Miya, K.; Tagawa, S.; Kobayashi, H.

    1993-01-01

    The high performance amorphous magnetic core monitor (ACM) for the measurement of electron beam currents has been developed. This monitor is composed of an amorphous magnetic core, radiation shields, a winding, magnetic absorbers, a ceramic vacuum duct and a SMA connecter. The ACM showed the very fast rise and fall times (< 1 ns), the high sensitivity (5 V/A at 50 Ω load), the good linearity, and good S/N ratio due to the high permeability of the amorphous magnetic core. The monitor works as a primary transformer. The time-response was simulated by an electric circuit analysis code. (orig.)

  3. Synthesis of magnetic CoPt/SiO{sub 2} core-shell nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Seto, Takafumi [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Koga, Kenji [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Takano, Fumiyoshi [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Akinaga, Hiroyuki [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Orii, Takaaki [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Hirasawa, Makoto [Research Consortium for Synthetic Nano-Function Materials Project (SYNAF), National Institute of Advanced Industrial Science and Technology (AIST), Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Murayama, Mitsuhiro [National Institute for Material Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan)

    2007-04-15

    Core-shell nanoparticles composed of ferromagnetic cobalt platinum cores covered by non-magnetic silica shells were synthesized by laser ablating a composite target in a helium background gas. The average diameter of the CoPt core was controlled by adjusting the CoPt/SiO{sub 2} ratio of the ablation target. The particles were also classified in the gas phase using an electrical mobility classifier. The present method successfully synthesized nearly monodispersed nanoparticles with an average core diameter of 2.5nm. This article describes the synthesis of the core-shell nanoparticles and investigates their magnetic properties.

  4. Giant magnetoimpedance in composite wires with insulator layer between non-magnetic core and soft magnetic shell

    International Nuclear Information System (INIS)

    Buznikov, N.A.; Antonov, A.S.; Granovsky, A.B.; Kim, C.G.; Kim, C.O.; Li, X.P.; Yoon, S.S.

    2006-01-01

    A method for calculation of the magnetoimpedance in composite wires having an insulator layer between non-magnetic core and soft magnetic shell is described. It is assumed that the magnetic shell has a helical anisotropy and the driving current flows through the core only. The distribution of eddy currents and expressions for the impedance are found by means of a solution of Maxwell equations taking into account the magnetization dynamics within the shell governed by the Landau-Lifshitz equation. The effect of the insulator layer on the magnetoimpedance is analyzed

  5. Giant magnetoimpedance in composite wires with insulator layer between non-magnetic core and soft magnetic shell

    Energy Technology Data Exchange (ETDEWEB)

    Buznikov, N.A. [Research Center for Advanced Magnetic Materials, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Antonov, A.S. [Institute for Theoretical and Applied Electrodynamics, Russian Academy of Sciences, Moscow 125412 (Russian Federation); Granovsky, A.B. [Faculty of Physics, M.V. Lomonosov Moscow State University, Moscow 119992 (Russian Federation); Kim, C.G. [Research Center for Advanced Magnetic Materials, Chungnam National University, Daejeon 305-764 (Korea, Republic of)]. E-mail: cgkim@cnu.ac.kr; Kim, C.O. [Research Center for Advanced Magnetic Materials, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Li, X.P. [Department of Mechanical Engineering and Division of Bioengineering, National University of Singapore, Singapore 119260 (Singapore); Yoon, S.S. [Department of Physics, Andong National University, Andong 760-749 (Korea, Republic of)

    2006-05-15

    A method for calculation of the magnetoimpedance in composite wires having an insulator layer between non-magnetic core and soft magnetic shell is described. It is assumed that the magnetic shell has a helical anisotropy and the driving current flows through the core only. The distribution of eddy currents and expressions for the impedance are found by means of a solution of Maxwell equations taking into account the magnetization dynamics within the shell governed by the Landau-Lifshitz equation. The effect of the insulator layer on the magnetoimpedance is analyzed.

  6. Insulator coated magnetic nanoparticulate composites with reduced core loss and method of manufacture thereof

    Science.gov (United States)

    Zhang, Yide (Inventor); Wang, Shihe (Inventor); Xiao, Danny (Inventor)

    2004-01-01

    A series of bulk-size magnetic/insulating nanostructured composite soft magnetic materials with significantly reduced core loss and its manufacturing technology. This insulator coated magnetic nanostructured composite is comprises a magnetic constituent, which contains one or more magnetic components, and an insulating constituent. The magnetic constituent is nanometer scale particles (1-100 nm) coated by a thin-layered insulating phase (continuous phase). While the intergrain interaction between the immediate neighboring magnetic nanoparticles separated by the insulating phase (or coupled nanoparticles) provide the desired soft magnetic properties, the insulating material provides the much demanded high resistivity which significantly reduces the eddy current loss. The resulting material is a high performance magnetic nanostructured composite with reduced core loss.

  7. Sensitive magnetic biodetection using magnetic multi-core nanoparticles and RCA coils

    Energy Technology Data Exchange (ETDEWEB)

    Ahrentorp, Fredrik; Blomgren, Jakob; Jonasson, Christian; Sarwe, Anna [Acreo Swedish ICT AB, Arvid Hedvalls Backe 4, Göteborg (Sweden); Sepehri, Sobhan; Eriksson, Emil; Kalaboukhov, Alexei; Jesorka, Aldo; Winkler, Dag [Department of Microtechnology and Nanoscience – MC2, Chalmers University of Technology, Göteborg (Sweden); Schneiderman, Justin F. [Institute of Neuroscience and Physiology, University of Gothenburg and MedTech West, Göteborg (Sweden); Nilsson, Mats [Science for Life Laboratory, Department of Biochemistry and Biophysics, Stockholm University, Stockholm (Sweden); Albert, Jan [Department of Microbiology, Tumor and Cell Biology, Karolinska Institutet, Stockholm (Sweden); Department of Clinical Microbiology, Karolinska University Hospital, Stockholm (Sweden); Zardán Gómez de la Torre, Teresa; Strømme, Maria [Uppsala University, Uppsala (Sweden); Johansson, Christer, E-mail: christer.johansson@acreo.se [Acreo Swedish ICT AB, Arvid Hedvalls Backe 4, Göteborg (Sweden)

    2017-04-01

    We use functionalized iron oxide magnetic multi-core particles of 100 nm in size (hydrodynamic particle diameter) and AC susceptometry (ACS) methods to measure the binding reactions between the magnetic nanoparticles (MNPs) and bio-analyte products produced from DNA segments using the rolling circle amplification (RCA) method. We use sensitive induction detection techniques in order to measure the ACS response. The DNA is amplified via RCA to generate RCA coils with a specific size that is dependent on the amplification time. After about 75 min of amplification we obtain an average RCA coil diameter of about 1 µm. We determine a theoretical limit of detection (LOD) in the range of 11 attomole (corresponding to an analyte concentration of 55 fM for a sample volume of 200 µL) from the ACS dynamic response after the MNPs have bound to the RCA coils and the measured ACS readout noise. We also discuss further possible improvements of the LOD. - Highlights: • Biosensing using Brownian relaxation of functionalized magnetic nanoparticles. • Rolling circle amplification and magnetic nanoparticles enables biosensing. • Theoretical limit of detection estimated from the signal noise gives about 55 fM.

  8. Analysis and Design of Double-sided Air core Linear Servo Motor with Trapezoidal Permanent Magnets

    DEFF Research Database (Denmark)

    Zhang, Yuqiu; Yang, Zilong; Yu, Minghu

    2011-01-01

    In order to reduce the thrust ripple of linear servo system, a double-sided air core permanent magnet linear servo motor with trapezoidal shape permanent magnets (TDAPMLSM) is proposed in this paper. An analytical model of the motor for predicting the magnetic field in the air-gap at no...

  9. Magnetic core-shell nanoparticles for drug delivery by nebulization

    LENUS (Irish Health Repository)

    Verma, Navin Kumar

    2013-01-23

    AbstractBackgroundAerosolized therapeutics hold great potential for effective treatment of various diseases including lung cancer. In this context, there is an urgent need to develop novel nanocarriers suitable for drug delivery by nebulization. To address this need, we synthesized and characterized a biocompatible drug delivery vehicle following surface coating of Fe3O4 magnetic nanoparticles (MNPs) with a polymer poly(lactic-co-glycolic acid) (PLGA). The polymeric shell of these engineered nanoparticles was loaded with a potential anti-cancer drug quercetin and their suitability for targeting lung cancer cells via nebulization was evaluated.ResultsAverage particle size of the developed MNPs and PLGA-MNPs as measured by electron microscopy was 9.6 and 53.2 nm, whereas their hydrodynamic swelling as determined using dynamic light scattering was 54.3 nm and 293.4 nm respectively. Utilizing a series of standardized biological tests incorporating a cell-based automated image acquisition and analysis procedure in combination with real-time impedance sensing, we confirmed that the developed MNP-based nanocarrier system was biocompatible, as no cytotoxicity was observed when up to 100 mug\\/ml PLGA-MNP was applied to the cultured human lung epithelial cells. Moreover, the PLGA-MNP preparation was well-tolerated in vivo in mice when applied intranasally as measured by glutathione and IL-6 secretion assays after 1, 4, or 7 days post-treatment. To imitate aerosol formation for drug delivery to the lungs, we applied quercitin loaded PLGA-MNPs to the human lung carcinoma cell line A549 following a single round of nebulization. The drug-loaded PLGA-MNPs significantly reduced the number of viable A549 cells, which was comparable when applied either by nebulization or by direct pipetting.ConclusionWe have developed a magnetic core-shell nanoparticle-based nanocarrier system and evaluated the feasibility of its drug delivery capability via aerosol administration. This study has

  10. Core/coil assembly for use in superconducting magnets and method for assembling the same

    Science.gov (United States)

    Kassner, David A.

    1979-01-01

    A core/coil assembly for use in a superconducting magnet of the focusing or bending type used in syncronous particle accelerators comprising a coil assembly contained within an axial bore of the stacked, washer type, carbon steel laminations which comprise the magnet core assembly, and forming an interference fit with said laminations at the operating temperature of said magnet. Also a method for making such core/coil assemblies comprising the steps of cooling the coil assembly to cryogenic temperatures and drawing it rapidly upwards into the bore of said stacked laminations.

  11. Effect of superconducting solenoid model cores on spanwise iron magnet roll control

    Science.gov (United States)

    Britcher, C. P.

    1985-01-01

    Compared with conventional ferromagnetic fuselage cores, superconducting solenoid cores appear to offer significant reductions in the projected cost of a large wind tunnel magnetic suspension and balance system. The provision of sufficient magnetic roll torque capability has been a long-standing problem with all magnetic suspension and balance systems; and the spanwise iron magnet scheme appears to be the most powerful system available. This scheme utilizes iron cores which are installed in the wings of the model. It was anticipated that the magnetization of these cores, and hence the roll torque generated, would be affected by the powerful external magnetic field of the superconducting solenoid. A preliminary study has been made of the effect of the superconducting solenoid fuselage model core concept on the spanwise iron magnet roll torque generation schemes. Computed data for one representative configuration indicate that reductions in available roll torque occur over a range of applied magnetic field levels. These results indicate that a 30-percent increase in roll electromagnet capacity over that previously determined will be required for a representative 8-foot wind tunnel magnetic suspension and balance system design.

  12. Comparison of the fractional power motor with cores made of various magnetic materials

    Science.gov (United States)

    Gmyrek, Zbigniew; Lefik, Marcin; Cavagnino, Andrea; Ferraris, Luca

    2017-12-01

    The optimization of the motor cores, coupled with new core shapes as well as powering the motor at high frequency are the primary reasons for the use of new materials. The utilization of new materials, like SMC (soft magnetic composite), reduce the core loss and/or provide quasi-isotropic core's properties in any magnetization direction. Moreover, the use of SMC materials allows for avoiding degradation of the material portions, resulting from punching process, thereby preventing the deterioration of operating parameters of the motor. The authors examine the impact of technological parameters on the properties of a new type of SMC material and analyze the possibility of its use as the core of the fractional power motor. The result of the work is an indication of the shape of the rotor core made of a new SMC material to achieve operational parameters similar to those that have a motor with a core made of laminations.

  13. Method for introducing bias magnetization in ungaped cores

    DEFF Research Database (Denmark)

    Aguilar, Andres Revilla; Munk-Nielsen, Stig

    2014-01-01

    The use of permanent magnets for bias magnetization is a known technique to increase the energy storage capability in DC inductors, resulting in a size reduction or increased current rating. This paper presents a brief introduction on the different permanent magnet inductor’s configurations found...

  14. Complex permeability and core loss of soft magnetic Fe-based nanocrystalline powder cores

    Energy Technology Data Exchange (ETDEWEB)

    Füzerová, Jana, E-mail: jana.fuzerova@tuke.sk [Faculty of Mechanical Engineering, Technical University, Letná 1, 042 00 Košice (Slovakia); Füzer, Ján; Kollár, Peter [Institute of Physics, P.J. Šafárik University, Park Angelinum 9, 040 23 Košice (Slovakia); Bureš, Radovan; Fáberová, Mária [Institute of Materials Research, Slovak Academy of Sciences, Watsonova 47, 043 53 Košice (Slovakia)

    2013-11-15

    Rapidly quenched ribbons of Fe{sub 73}Cu{sub 1}Nb{sub 3}Si{sub 16}B{sub 7} were ball milled and cryomilled to get powder and warm consolidated to get bulk compacts. The data presented here are relative to different experimental procedures, one corresponding to milling at room temperature (sample R1) and the other corresponding to cryomilling at temperature of liquid nitrogen (sample L1). It was found that the properties of the initial powder influenced the density, the electrical resistivity and electromagnetic properties of the resulting bulk alloys. Permeability and core loss are structure sensitive and depend on factors such as powder size and shape, porosity, purity, and internal stress. Permeability spectra of sample R1 decreases with increasing the frequency and its values are larger than that for sample L1 at low frequencies. On the other hand the permeability of sample L1 remains steady up to 1 kHz and at certain frequency is larger than that for sample R1. Also there are different frequency dependences of the imaginary parts of permeability and loss factor, respectively. The cryomilling of the amorphous ribbon positively influences on the AC magnetic properties at higher frequencies (above 100 Hz) of resulting bulk sample. - Highlights: • We prepared two different amorphous powder vitroperm samples. • We have examined changes in the properties of the bulk samples prepared by compaction. • It was found that properties of the initial powder influence the density, the electrical resistivity and electromagnetic properties of the resulting bulk alloys.

  15. Coercivity enhancement in Ce-Fe-B based magnets by core-shell grain structuring

    Directory of Open Access Journals (Sweden)

    M. Ito

    2016-05-01

    Full Text Available Ce-based R2Fe14B (R= rare-earth nano-structured permanent magnets consisting of (Ce,Nd2Fe14B core-shell grains separated by a non-magnetic grain boundary phase, in which the relative amount of Nd to Ce is higher in the shell of the magnetic grain than in its core, were fabricated by Nd-Cu infiltration into (Ce,Nd2Fe14B hot-deformed magnets. The coercivity values of infiltrated core-shell structured magnets are superior to those of as-hot-deformed magnets with the same overall Nd content. This is attributed to the higher value of magnetocrystalline anisotropy of the shell phase in the core-shell structured infiltrated magnets compared to the homogeneous R2Fe14B grains of the as-hot-deformed magnets, and to magnetic isolation of R2Fe14B grains by the infiltrated grain boundary phase. First order reversal curve (FORC diagrams suggest that the higher anisotropy shell suppresses initial magnetization reversal at the edges and corners of the R2Fe14B grains.

  16. Suitability of magnetic single- and multi-core nanoparticles to detect protein binding with dynamic magnetic measurement techniques

    International Nuclear Information System (INIS)

    Remmer, Hilke; Dieckhoff, Jan; Schilling, Meinhard; Ludwig, Frank

    2015-01-01

    We investigated the binding of biotinylated proteins to various streptavidin functionalized magnetic nanoparticles with different dynamic magnetic measurement techniques to examine their potential for homogeneous bioassays. As particle systems, single-core nanoparticles with a nominal core diameter of 30 nm as well as multi-core nanoparticles with hydrodynamic sizes varying between nominally 60 nm and 100 nm were chosen. As experimental techniques, fluxgate magnetorelaxometry (MRX), complex ac susceptibility (ACS) and measurements of the phase lag between rotating field and sample magnetization are applied. MRX measurements are only suited for the detection of small analytes if the multivalency of functionalized nanoparticles and analytes causes cross-linking, thus forming larger aggregates. ACS measurements showed for all nanoparticle systems a shift of the imaginary part's maximum towards small frequencies. In rotating field measurements only the single-core nanoparticle systems with dominating Brownian mechanism exhibit an increase of the phase lag upon binding in the investigated frequency range. The coexistence of Brownian and Néel relaxation processes can cause a more complex phase lag change behavior, as demonstrated for multi-core nanoparticle systems. - Highlights: • Cealization of homogeneous magnetic bioassays using different magnetic techniques. • Comparison of single- and multi-core nanoparticle systems. • ac Susceptibility favorable for detection of small analytes. • Magnetorelaxometry favorable for detection of large analytes or cross-linking assays

  17. Core-shell magnetic nanoparticles for on-chip RF inductors

    KAUST Repository

    Koh, Kisik

    2013-01-01

    FeNi3 based core-shell magnetic nanoparticles are demonstrated as the magnetic core material for on-chip, radio frequency (RF) inductors. FeNi3 nanoparticles with 50-150 nm in diameter with 15-20 nm-thick SiO2 coating are chemically synthesized and deposited on a planar inductor as the magnetic core to enhance both inductance (L) and quality factor (Q) of the inductor. Experimentally, the ferromagnetic resonant frequency of the on-chip inductors based on FeNi3 core-shell nanoparticles has been shown to be over several GHz. A post-CMOS process has been developed to integrate the magnetic nanoparticles to a planar inductor and inductance enhancements up to 50% of the original magnitude with slightly enhanced Q-factor up to 1 GHz have been achieved. © 2013 IEEE.

  18. Effects of magnetic core geometry on false detection in residual current sensor

    International Nuclear Information System (INIS)

    Colin, Bruno; Chillet, Christian; Kedous-Lebouc, Afef; Mas, Patrick

    2006-01-01

    Under high-supply current, residual circuit breakers are subject to abnormal tripping, caused by false residual currents. Geometric or magnetic anomalies in the circuit breaker ring core seem to be responsible for these abnormal currents. This paper studies a few anomalies (spiral shape effect, conductor eccentricity, lamination effect) and calculates different contributions using the finite element simulations. The results show that the ring core, made of thin wound magnetic tape, is particularly sensitive to primary conductor eccentricity

  19. Steady state toroidal magnetic field at earth's core-mantle boundary

    Science.gov (United States)

    Levy, Eugene H.; Pearce, Steven J.

    1991-01-01

    Measurements of the dc electrical potential near the top of earth's mantle have been extrapolated into the deep mantle in order to estimate the strength of the toroidal magnetic field component at the core-mantle interface. Recent measurements have been interpreted as indicating that at the core-mantle interface, the magnetic toroidal and poloidal field components are approximately equal in magnitude. A motivation for such measurements is to obtain an estimate of the strength of the toroidal magnetic field in the core, a quantity important to our understanding of the geomagnetic field's dynamo generation. Through the use of several simple and idealized calculation, this paper discusses the theoretical relationship between the amplitude of the toroidal magnetic field at the core-mantle boundary and the actual amplitude within the core. Even with a very low inferred value of the toroidal field amplitude at the core-mantle boundary, (a few gauss), the toroidal field amplitude within the core could be consistent with a magnetohydrodynamic dynamo dominated by nonuniform rotation and having a strong toroidal magnetic field.

  20. Comparison of the fractional power motor with cores made of various magnetic materials

    Directory of Open Access Journals (Sweden)

    Gmyrek Zbigniew

    2017-12-01

    Full Text Available The optimization of the motor cores, coupled with new core shapes as well as powering the motor at high frequency are the primary reasons for the use of new materials. The utilization of new materials, like SMC (soft magnetic composite, reduce the core loss and/or provide quasi-isotropic core’s properties in any magnetization direction. Moreover, the use of SMC materials allows for avoiding degradation of the material portions, resulting from punching process, thereby preventing the deterioration of operating parameters of the motor. The authors examine the impact of technological parameters on the properties of a new type of SMC material and analyze the possibility of its use as the core of the fractional power motor. The result of the work is an indication of the shape of the rotor core made of a new SMC material to achieve operational parameters similar to those that have a motor with a core made of laminations.

  1. Synthesis of highly monodisperse particles composed of a magnetic core and fluorescent shell.

    Science.gov (United States)

    Nagao, Daisuke; Yokoyama, Mikio; Yamauchi, Noriko; Matsumoto, Hideki; Kobayashi, Yoshio; Konno, Mikio

    2008-09-02

    Highly monodisperse particles composed of a magnetic silica core and fluorescent polymer shell were synthesized with a combined technique of heterocoagulation and soap-free emulsion polymerization. Prior to heterocoagulation, monodisperse, submicrometer-sized silica particles were prepared with the Stober method, and magnetic nanoparticles were prepared with a modified Massart method in which a cationic silane coupling agent of N-trimethoxysilylpropyl- N, N, N-trimethylammonium chloride was added just after coprecipitation of Fe (2+) and Fe (3+). The silica particles with negative surface potential were heterocoagulated with the magnetic nanoparticles with positive surface potential. The magnetic silica particles obtained with the heterocoagulation were treated with sodium silicate to modify their surfaces with silica. In the formation of a fluorescent polymer shell onto the silica-coated magnetic silica cores, an amphoteric initiator of 2,2'-azobis[ N-(2-carboxyethyl)-2-2-methylpropionamidine] (VA-057) was used to control the colloidal stability of the magnetic cores during the polymer coating. The polymerization of St in the presence of a hydrophobic fluorophore of pyrene could coat the cores with fluorescent polymer shells, resulting in monodisperse particles with a magnetic silica core and fluorescent polymer shell. Measurements of zeta potential for the composite particles in different pH values indicated that the composite particles had an amphoteric property originating from VA-057 initiator.

  2. Magnetic Polarity Stratigraphy and Rock Magnetic Data From the Continuous Cored Record of Triassic Continental Environmental Change, the Colorado Plateau Coring Project

    Science.gov (United States)

    Geissman, J. W.; McIntosh, J.; Buhedma, H. M. A.

    2017-12-01

    Despite the fact that the Triassic Period (ca. 251.9-201.3 Ma) is bound by two of Earth's largest mass extinctions, experienced giant bolide impacts and eruption of three large igneous provinces, and witnessed evolution of the main components of modern tetrapod communities, the time interval has sparse geochronologic calibration. The US NSF- and ICDP-funded coring of Phase 1 of the CPCP was completed in 2013, with the recovery of two major cores (6.35 cm diameter: 1A, 518m length and 2B, 253m; 31km apart) from the Petrified Forest National Park spanning the Chinle and Moenkopi fms. Core 1A has been fully sampled, with specimens obtained either by drilling or by extraction of core fragments and packing in ceramic boxes. Specimens are subjected to progressive thermal demagnetization or a combination of alternating field (AF) followed by thermal treatment. In several cases, specimens were extracted from each core segment to test for internal consistency. Chinle hematitic mudstones and siltstones have NRM intensities between 130 to 0.5 mA/m, with bulk susceptibilities from 2 x 10-2 to 5 x 10-5 SI units. More indurated hematitic siltstones/ medium sandstones of the Moenkopi Fm have NRM intensities and bulk susceptibilities that are far less variable (NRM: 9.0 to 1.2 mA/m, MS: 3.0 X 10-4 and 0.5 x 10-5 SI vol). Thermal demagnetization typically isolates magnetizations of N declination and shallow inclination (interpreted as normal polarity) and antipodes (reverse) (image), a polarity stratigraphy is being compiled for much of the section. Response is typically more interpretable for very hematitic Chinle mudstone sections and most Moenkopi rocks. Coarser grained, less hematitic Chinle strata rarely yield interpretable results, likely due to coarse-grained detrital magnetite, and it is likely that these intervals will not yield robust polarity information. Some core segments yield well-resolved magnetizations that are inconsistent with a Triassic field and we suspect

  3. Influence of Shell Thickness on the Colloidal Stability of Magnetic Core-Shell Particle Suspensions.

    Science.gov (United States)

    Neville, Frances; Moreno-Atanasio, Roberto

    2018-01-01

    We present a Discrete Element study of the behavior of magnetic core-shell particles in which the properties of the core and the shell are explicitly defined. Particle cores were considered to be made of pure iron and thus possessed ferromagnetic properties, while particle shells were considered to be made of silica. Core sizes ranged between 0.5 and 4.0 μm with the actual particle size of the core-shell particles in the range between 0.6 and 21 μm. The magnetic cores were considered to have a magnetization of one tenth of the saturation magnetization of iron. This study aimed to understand how the thickness of the shell hinders the formation of particle chains. Chain formation was studied with different shell thicknesses and particle sizes in the presence and absence of an electrical double layer force in order to investigate the effect of surface charge density on the magnetic core-shell particle interactions. For core sizes of 0.5 and 4.0 μm the relative shell thicknesses needed to hinder the aggregation process were approximately 0.4 and 0.6 respectively, indicating that larger core sizes are detrimental to be used in applications in which no flocculation is needed. In addition, the presence of an electrical double layer, for values of surface charge density of less than 20 mC/m 2 , could stop the contact between particles without hindering their vertical alignment. Only when the shell thickness was considerably larger, was the electrical double layer able to contribute to the full disruption of the magnetic flocculation process.

  4. Performance analysis of a new radial-axial flux machine with SMC cores and ferrite magnets

    Science.gov (United States)

    Liu, Chengcheng; Wang, Youhua; Lei, Gang; Guo, Youguang; Zhu, Jianguo

    2017-05-01

    Soft magnetic composite (SMC) is a popular material in designing of new 3D flux electrical machines nowadays for it has the merits of isotropic magnetic characteristic, low eddy current loss and high design flexibility over the electric steel. The axial flux machine (AFM) with the extended stator tooth tip both in the radial and circumferential direction is a good example, which has been investigated in the last years. Based on the 3D flux AFM and radial flux machine, this paper proposes a new radial-axial flux machine (RAFM) with SMC cores and ferrite magnets, which has very high torque density though the low cost low magnetic energy ferrite magnet is utilized. Moreover, the cost of RAFM is quite low since the manufacturing cost can be reduced by using the SMC cores and the material cost will be decreased due to the adoption of the ferrite magnets. The 3D finite element method (FEM) is used to calculate the magnetic flux density distribution and electromagnetic parameters. For the core loss calculation, the rotational core loss computation method is used based on the experiment results from previous 3D magnetic tester.

  5. Optimization design of toroidal core for magnetic energy harvesting near power line by considering saturation effect

    Science.gov (United States)

    Park, Bumjin; Kim, Dongwook; Park, Jaehyoung; Kim, Kibeom; Koo, Jay; Park, HyunHo; Ahn, Seungyoung

    2018-05-01

    Recently, magnetic energy harvesting technologies have been studied actively for self-sustainable operation of applications around power line. However, magnetic energy harvesting around power lines has the problem of magnetic saturation, which can cause power performance degradation of the harvester. In this paper, optimal design of a toroidal core for magnetic energy harvesters has been proposed with consideration of magnetic saturation near power lines. Using Permeability-H curve and Ampere's circuital law, the optimum dimensional parameters needed to generate induced voltage were analyzed via calculation and simulation. To reflect a real environment, we consider the nonlinear characteristic of the magnetic core material and supply current through a 3-phase distribution panel used in the industry. The effectiveness of the proposed design methodology is verified by experiments in a power distribution panel and takes 60.9 V from power line current of 60 A at 60 Hz.

  6. Exfoliated BN shell-based high-frequency magnetic core-shell materials.

    Science.gov (United States)

    Zhang, Wei; Patel, Ketan; Ren, Shenqiang

    2017-09-14

    The miniaturization of electric machines demands high frequency magnetic materials with large magnetic-flux density and low energy loss to achieve a decreased dimension of high rotational speed motors. Herein, we report a solution-processed high frequency magnetic composite (containing a nanometal FeCo core and a boron nitride (BN) shell) that simultaneously exhibits high electrical resistivity and magnetic permeability. The frequency dependent complex initial permeability and the mechanical robustness of nanocomposites are intensely dependent on the content of BN insulating phase. The results shown here suggest that insulating magnetic nanocomposites have potential for application in next-generation high-frequency electric machines with large electrical resistivity and permeability.

  7. Direct URCA-processes in neutron star quark core with strong magnetic field.

    Directory of Open Access Journals (Sweden)

    Belyaev Vasily

    2017-01-01

    In evaluations, the strength of magnetic field corresponds to the case, where the quarks of medium occupy a lot of Landau levels, while the electrons are in ground Landau level. The analytical dependence of neutrino emissivity on chemical potentials of quarks and electrons, temperature and magnetic field strength is obtained and briefly discussed. The result could be important in application to a massive strongly magnetized neutron star with quark core.

  8. Preparation of novel magnetic polyurethane foam nanocomposites by using core-shell nanoparticles

    OpenAIRE

    Nikje,Mir Mohammad Alavi; Moghaddam,Sahebeh Tamaddoni; Noruzian,Maede

    2016-01-01

    Abstract Iron oxide magnetic nanoparticles (NP's) converted to the core- shell structres by reacting with by n-(2-aminoethyl)-3-aminopropyl trimethoxysilane (AEAP) incorporated in polyurethane flexible (PUF) foam formulations. Fourier transform spectra, thermal gravimetric analysis, scanning electron images, thermo-mechanical analysis and magnetic properties of the prepared nanocomposites were studied. Obtained data shown that by the increasing of the amine modified magnetic iron oxide NP's u...

  9. Homogeneous protein analysis by magnetic core-shell nanorod probes

    KAUST Repository

    Schrittwieser, Stefan; Pelaz, Beatriz; Parak, Wolfgang J; Lentijo Mozo, Sergio; Soulantica, Katerina; Dieckhoff, Jan; Ludwig, Frank; Altantzis, Thomas; Bals, Sara; Schotter, Joerg

    2016-01-01

    analyte protein size. In addition, due to the locking of the optical signal to the magnetic excitation frequency, background signals are suppressed, thus allowing exclusive studies of processes at the nanoprobe surface only. We study target proteins

  10. Structural and magnetic properties of core-shell iron-iron oxide nanoparticles

    DEFF Research Database (Denmark)

    Kuhn, Luise Theil; Bojesen, A.; Timmermann, L.

    2002-01-01

    We present studies of the structural and magnetic properties of core-shell iron-iron oxide nanoparticles. alpha-Fe nanoparticles were fabricated by sputtering and subsequently covered with a protective nanocrystalline oxide shell consisting of either maghaemite (gamma-Fe2O3) or partially oxidized...... magnetite (Fe3O4). We observed that the nanoparticles were stable against further oxidation, and Mossbauer spectroscopy at high applied magnetic fields and low temperatures revealed a stable form of partly oxidized magnetite. The nanocrystalline structure of the oxide shell results in strong canting...... of the spin structure in the oxide shell, which thereby modifies the magnetic properties of the core-shell nanoparticles....

  11. MAGNETIZATION OF CLOUD CORES AND ENVELOPES AND OTHER OBSERVATIONAL CONSEQUENCES OF RECONNECTION DIFFUSION

    International Nuclear Information System (INIS)

    Lazarian, A.; Esquivel, A.; Crutcher, R.

    2012-01-01

    Recent observational results for magnetic fields in molecular clouds reviewed by Crutcher seem to be inconsistent with the predictions of the ambipolar diffusion theory of star formation. These include the measured decrease in mass to flux ratio between envelopes and cores, the failure to detect any self-gravitating magnetically subcritical clouds, the determination of the flat probability distribution function (PDF) of the total magnetic field strengths implying that there are many clouds with very weak magnetic fields, and the observed scaling B∝ρ 2/3 that implies gravitational contraction with weak magnetic fields. We consider the problem of magnetic field evolution in turbulent molecular clouds and discuss the process of magnetic field diffusion mediated by magnetic reconnection. For this process that we termed 'reconnection diffusion', we provide a simple physical model and explain that this process is inevitable in view of the present-day understanding of MHD turbulence. We address the issue of the expected magnetization of cores and envelopes in the process of star formation and show that reconnection diffusion provides an efficient removal of magnetic flux that depends only on the properties of MHD turbulence in the core and the envelope. We show that as the amplitude of turbulence as well as the scale of turbulent motions decrease from the envelope to the core of the cloud, the diffusion of the magnetic field is faster in the envelope. As a result, the magnetic flux trapped during the collapse in the envelope is being released faster than the flux trapped in the core, resulting in much weaker fields in envelopes than in cores, as observed. We provide simple semi-analytical model calculations which support this conclusion and qualitatively agree with the observational results. Magnetic reconnection is also consistent with the lack of subcritical self-gravitating clouds, with the observed flat PDF of field strengths, and with the scaling of field strength

  12. MAGNETIZATION OF CLOUD CORES AND ENVELOPES AND OTHER OBSERVATIONAL CONSEQUENCES OF RECONNECTION DIFFUSION

    Energy Technology Data Exchange (ETDEWEB)

    Lazarian, A. [Astronomy Department, University of Wisconsin, Madison, WI 53706 (United States); Esquivel, A. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-543, 04510 Mexico D.F. (Mexico); Crutcher, R. [Department of Astronomy, University of Illinois at Urbana-Champaign, 1002 W. Green Street, Urbana, IL 61801 (United States)

    2012-10-01

    Recent observational results for magnetic fields in molecular clouds reviewed by Crutcher seem to be inconsistent with the predictions of the ambipolar diffusion theory of star formation. These include the measured decrease in mass to flux ratio between envelopes and cores, the failure to detect any self-gravitating magnetically subcritical clouds, the determination of the flat probability distribution function (PDF) of the total magnetic field strengths implying that there are many clouds with very weak magnetic fields, and the observed scaling B{proportional_to}{rho}{sup 2/3} that implies gravitational contraction with weak magnetic fields. We consider the problem of magnetic field evolution in turbulent molecular clouds and discuss the process of magnetic field diffusion mediated by magnetic reconnection. For this process that we termed 'reconnection diffusion', we provide a simple physical model and explain that this process is inevitable in view of the present-day understanding of MHD turbulence. We address the issue of the expected magnetization of cores and envelopes in the process of star formation and show that reconnection diffusion provides an efficient removal of magnetic flux that depends only on the properties of MHD turbulence in the core and the envelope. We show that as the amplitude of turbulence as well as the scale of turbulent motions decrease from the envelope to the core of the cloud, the diffusion of the magnetic field is faster in the envelope. As a result, the magnetic flux trapped during the collapse in the envelope is being released faster than the flux trapped in the core, resulting in much weaker fields in envelopes than in cores, as observed. We provide simple semi-analytical model calculations which support this conclusion and qualitatively agree with the observational results. Magnetic reconnection is also consistent with the lack of subcritical self-gravitating clouds, with the observed flat PDF of field strengths, and

  13. Magnetite and magnetite/silver core/shell nanoparticles with diluted magnet-like behavior

    International Nuclear Information System (INIS)

    Garza-Navarro, Marco; Torres-Castro, Alejandro; Gonzalez, Virgilio; Ortiz, Ubaldo; De la Rosa, Elder

    2010-01-01

    In the present work is reported the use of the biopolymer chitosan as template for the preparation of magnetite and magnetite/silver core/shell nanoparticles systems, following a two step procedure of magnetite nanoparticles in situ precipitation and subsequent silver ions reduction. The crystalline and morphological characteristics of both magnetite and magnetite/silver core/shell nanoparticles systems were analyzed by high resolution transmission electron microscopy (HRTEM) and nanobeam diffraction patterns (NBD). The results of these studies corroborate the core/shell morphology and the crystalline structure of the magnetite core and the silver shell. Moreover, magnetization temperature dependent, M(T), measurements show an unusual diluted magnetic behavior attributed to the dilution of the magnetic ordering in the magnetite and magnetite/silver core/shell nanoparticles systems. - Graphical abstract: Biopolymer chitosan was used as stabilization media to synthesize both magnetite and magnetite/silver core/shell nanoparticles. Results of HRTEM and NBD patterns confirm core/shell morphology of the obtained nanoparticles. It was found that the composites show diluted magnet-like behavior.

  14. Determining the magnetically nonlinear characteristics of a three phase core-type power transformer

    International Nuclear Information System (INIS)

    Dolinar, Matjaz; Stumberger, Gorazd; Polajzer, Bostjan; Dolinar, Drago

    2006-01-01

    This paper presents nonlinear iron core model of a three-phase, three-limb power transformer which is given by the current-dependant characteristics of flux linkages. The magnetically nonlinear characteristics are determined by controlled magnetic excitation of all three limbs which allows to take into account the variable magnetic-cross couplings between different coils placed on limbs, caused by saturation. The corresponding partial derivatives of measured flux linkage characteristics are used in the transformer circuit model as a magnetically nonlinear iron core model in order to analyze the behaviour of a nonsymmetrically excited transformer. Numerical results using transformer model with the determined iron core model agree very well with the measured results

  15. Polymer Magnetic Composite Core Based Microcoils and Microtransformers for Very High Frequency Power Applications

    Directory of Open Access Journals (Sweden)

    Saravana Guru Mariappan

    2016-04-01

    Full Text Available We present a rapid prototyping and a cost effective fabrication process on batch fabricated wafer-level micro inductive components with polymer magnetic composite (PMC cores. The new PMC cores provide a possibility to bridge the gap between the non-magnetic and magnetic core inductive devices in terms of both the operating frequency and electrical performance. An optimized fabrication process of molding, casting, and demolding which uses teflon for the molding tool is presented. High permeability NiFeZn powder was mixed with Araldite epoxy to form high resistive PMC cores. Cylindrical PMC cores having a footprint of 0.79 mm 2 were fabricated with varying percentage of the magnetic powder on FR4 substrates. The core influence on the electrical performance of the inductive elements is discussed. Inductor chips having a solenoidal coil as well as transformer chips with primary and secondary coils wound around each other have been fabricated and evaluated. A core with 65% powder equipped with a solenoid made out of 25 µm thick insulated Au wire having 30 turns, yielded a constant inductance value of 2 µH up to the frequency of 50 MHz and a peak quality factor of 13. A 1:1 transformer with similar PMC core and solenoidal coils having 10 turns yielded a maximum efficiency of 84% and a coupling factor of 96%. In order to protect the solenoids and to increase the mechanical robustness and handling of the chips, a novel process was developed to encapsulate the components with an epoxy based magnetic composite. The effect on the electrical performance through the magnetic composite encapsulation is reported as well.

  16. Development of magnetic luminescent core/shell nanocomplex particles with fluorescence using Rhodamine 6G

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hee Uk; Song, Yoon Seok [Department of Chemical and Biological Engineering, Korea University, 5 Ga, Anam-Dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of); Park, Chulhwan [Department of Chemical Engineering, Kwangwoon University, 447-1 Wolgye-Dong, Nowon-Gu, Seoul 139-701 (Korea, Republic of); Kim, Seung Wook, E-mail: kimsw@korea.ac.kr [Department of Chemical and Biological Engineering, Korea University, 5 Ga, Anam-Dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of)

    2012-12-15

    Graphical abstract: Display Omitted Highlights: ► A simple method was developed to synthesize Co-B/SiO{sub 2}/dye/SiO{sub 2} composite particles. ► The magnetic particle shows that highly luminescent and core/shell particles are formed. ► Such core/shell particles can be easily suspended in water. ► The magnetic particles could detect fluorescence for the application of biosensor. -- Abstract: A simple and reproducible method was developed to synthesize a novel class of Co-B/SiO{sub 2}/dye/SiO{sub 2} composite core/shell particles. Using a single cobalt core, Rhodamine 6G of organic dye molecules was entrapped in a silica shell, resulting in core/shell particles of ∼200 nm diameter. Analyses using a variety of techniques such as transmission electron microscopy, X-ray photoelectron spectroscopy, vibration sample magnetometry, confocal laser scanning microscopy, and fluorescence intensity demonstrated that dye molecules were trapped inside the core/shell particles. A photoluminescence investigation showed that highly luminescent and photostable core/shell particles were formed. Such core/shell particles can be easily suspended in water. The synthesized magnetic particles could be used to detect fluorescence on glass substrate arrays for bioassay and biosensor applications.

  17. YOUNG STARLESS CORES EMBEDDED IN THE MAGNETICALLY DOMINATED PIPE NEBULA. II. EXTENDED DATA SET

    International Nuclear Information System (INIS)

    Frau, P.; Girart, J. M.; Padovani, M.; Beltrán, M. T.; Sánchez-Monge, Á.; Busquet, G.; Morata, O.; Masqué, J. M.; Estalella, R.; Alves, F. O.; Franco, G. A. P.

    2012-01-01

    The Pipe nebula is a massive, nearby, filamentary dark molecular cloud with a low star formation efficiency threaded by a uniform magnetic field perpendicular to its main axis. It harbors more than a hundred, mostly quiescent, very chemically young starless cores. The cloud is therefore a good laboratory to study the earliest stages of the star formation process. We aim to investigate the primordial conditions and the relation among physical, chemical, and magnetic properties in the evolution of low-mass starless cores. We used the IRAM 30 m telescope to map the 1.2 mm dust continuum emission of five new starless cores, which are in good agreement with previous visual extinction maps. For the sample of nine cores, which includes the four cores studied in a previous work, we derived an A V to N H 2 factor of (1.27 ± 0.12) × 10 –21 mag cm 2 and a background visual extinction of ∼6.7 mag possibly arising from the cloud material. We derived an average core diameter of ∼0.08 pc, density of ∼10 5 cm –3 , and mass of ∼1.7 M ☉ . Several trends seem to exist related to increasing core density: (1) the diameter seems to shrink, (2) the mass seems to increase, and (3) the chemistry tends to be richer. No correlation is found between the direction of the surrounding diffuse medium magnetic field and the projected orientation of the cores, suggesting that large-scale magnetic fields seem to play a secondary role in shaping the cores. We also used the IRAM 30 m telescope to extend the previous molecular survey at 1 and 3 mm of early- and late-time molecules toward the same five new Pipe nebula starless cores, and analyzed the normalized intensities of the detected molecular transitions. We confirmed the chemical differentiation toward the sample and increased the number of molecular transitions of the 'diffuse' (e.g., the 'ubiquitous' CO, C 2 H, and CS), 'oxo-sulfurated' (e.g., SO and CH 3 OH), and 'deuterated' (e.g., N 2 H + , CN, and HCN) starless core groups

  18. NON-EQUILIBRIUM CHEMISTRY OF DYNAMICALLY EVOLVING PRESTELLAR CORES. II. IONIZATION AND MAGNETIC FIELD

    International Nuclear Information System (INIS)

    Tassis, Konstantinos; Willacy, Karen; Yorke, Harold W.; Turner, Neal J.

    2012-01-01

    We study the effect that non-equilibrium chemistry in dynamical models of collapsing molecular cloud cores has on measurements of the magnetic field in these cores, the degree of ionization, and the mean molecular weight of ions. We find that OH and CN, usually used in Zeeman observations of the line-of-sight magnetic field, have an abundance that decreases toward the center of the core much faster than the density increases. As a result, Zeeman observations tend to sample the outer layers of the core and consistently underestimate the core magnetic field. The degree of ionization follows a complicated dependence on the number density at central densities up to 10 5 cm –3 for magnetic models and 10 6 cm –3 in non-magnetic models. At higher central densities, the scaling approaches a power law with a slope of –0.6 and a normalization which depends on the cosmic-ray ionization rate ζ and the temperature T as (ζT) 1/2 . The mean molecular weight of ions is systematically lower than the usually assumed value of 20-30, and, at high densities, approaches a value of 3 due to the asymptotic dominance of the H + 3 ion. This significantly lower value implies that ambipolar diffusion operates faster.

  19. Sedimentology and Rock Magnetism of Bailey River Peat Cores, Sudbury Area: Preliminary Results

    Science.gov (United States)

    Yurtseven, A.; Cioppa, M. T.; Dean, K.

    2009-05-01

    Magnetic measurements on peat can reveal atmospheric anthropogenic contamination. Two cores were collected from a marsh surrounding the Bailey River, 10 km north of Sudbury, Ontario, using a Russian peat borer. The BR1 core (1.4 m) was collected right at the river's edge, whereas the BR2 core (2.5 m) was collected about 50 m away from the river's edge, close to the edge of the marsh and near the forest. Significant sedimentological variation between the two cores was observed: core BR1 had several centimeter to decimeter scale fine to coarse grey sand layers at 0.14 m, 0.46 m and 0.87 m between thicker organic-rich (peat) zones, whereas core BR2 had only one 5 cm sand-rich layer at 0.94 m within the organic-rich material. The cores were subsampled at 2.5 cm intervals for laboratory magnetic analysis. Volume susceptibility was measured using a Bartington MS2B meter, and mass-specific susceptibility was then calculated. In core BR1, the sand layers had relatively higher susceptibility (13 x 10-8 m3/kg) , while the organic rich layers had very low susceptibility (0 - 2 x 10-8 m3/kg). In core BR2, which had little sand, the susceptibility variation was dominated by higher values near-surface (10 x 10-8 m3/kg), and very low susceptibility (0.3 x 10-8 m3/kg) below 0.3 m depth. Since the lithology in this core did not vary substantially, susceptibility variations may be controlled by anthropogenic deposition in the near-surface during the peak mining and smelting decades. These preliminary results suggest that any anthropogenic signal in core BR1 appears to be masked by the sedimentological variation. On pilot results from eight samples in core BR1, saturation isothermal remanence acquisition showed 95% saturation by 200 mT, and the S-ratios (0.3T/0.9T) were above 0.93, suggesting that magnetite is the major magnetization carrier. In core BR2, six out of eight samples showed similar results; however, two samples had slightly more higher coercivity minerals (90% saturation

  20. The percolation effect and optimization of soft magnetic properties of FeSiAl magnetic powder cores

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Ruru [College of Material Science and Engineering, Nanchang University, Nanchang 330031, Jiangxi (China); Zhu, Zhenghou, E-mail: z00708@sina.com [College of Material Science and Engineering, Nanchang University, Nanchang 330031, Jiangxi (China); Zhao, Hui, E-mail: candyzhaohui@126.com [College of Material Science and Engineering, Nanchang University, Nanchang 330031, Jiangxi (China); Institute of Space Science and Technology, Nanchang University, Nanchang 330031, Jiangxi (China); Mao, Shenghua [Jiangxi Aite magnetic materials Co. Ltd., Yichun 336000, Jiangxi (China); Zhong, Qi [College of Material Science and Engineering, Nanchang University, Nanchang 330031, Jiangxi (China)

    2017-07-01

    Highlights: • A new magnetic percolation phenomenon of ρ-μe in MPCs was discovered. • The soft magnetic properties of FeSiAl MPCs were studied. • The comprehensive magnetic properties of MPCs were optimized. • The formation mechanism of magnetic conductive path was explained. - Abstract: In this paper, a new magnetic percolation phenomenon between the green compact density ρ and effective permeability μe in FeSi{sub 9.6}Al{sub 6.5} magnetic powder cores, was discovered. The Magnetic Percolation Area of ρ is the range of 5.6 g/cm{sup 3} ∼ 5.78 g/cm{sup 3}, and the percolation threshold is 5.78 g/cm{sup 3}. As a result of the guidance of the percolation theory, the best comprehensive magnetic properties have been optimized through adjusting the distribution of powders. The special distribution of the magnetic powder cores with the best comprehensive magnetic properties was as follows: the content 60% with the particle size distribution of 100–200 mesh, the content 20% with the particle size distribution of 200–325 mesh and the content 20% with the particle size distribution of ≥400 mesh. When the green compact density ρ of cores was 5.79 g/cm{sup 3}, and the frequency was in the range of 1 kHz ∼ 100 kHz, the best comprehensive magnetic properties were as follows: μe = 91, ∆μ = 0.61%, μe(H80 Oe) = 43, μe(H100 Oe) = 33, μe(H120 Oe) = 26, Pc(50 mT/20 kHz) = 30.58 kW/m{sup 3}, Pc(50 mT/50 kHz) = 76.85 kW/m{sup 3}, Pc(50 mT/100 kHz) = 178 kW/m{sup 3}. Not only have those cores the excellent constant magnetic properties with frequency, the excellent DC superposition characteristic and the lower loss at high frequency, but also the effective permeability outstandingly goes up, which has important significance for the miniaturization of inductance components.

  1. Short-Range Correlated Magnetic Core-Shell CrO₂/Cr₂O₃ Nanorods: Experimental Observations and Theoretical Considerations.

    Science.gov (United States)

    Gandhi, Ashish C; Li, Tai-Yue; Chan, Ting Shan; Wu, Sheng Yun

    2018-05-09

    With the evolution of synthesis and the critical characterization of core-shell nanostructures, short-range magnetic correlation is of prime interest in employing their properties to develop novel devices and widespread applications. In this regard, a novel approach of the magnetic core-shell saturated magnetization (CSSM) cylinder model solely based on the contribution of saturated magnetization in one-dimensional CrO₂/Cr₂O₃ core-shell nanorods (NRs) has been developed and applied for the determination of core-diameter and shell-thickness. The nanosized effect leads to a short-range magnetic correlation of ferromagnetic core-CrO₂ extracted from CSSM, which can be explained using finite size scaling method. The outcome of this study is important in terms of utilizing magnetic properties for the critical characterization of core-shell nanomagnetic materials.

  2. Determining the size of nanoparticles in the example of magnetic iron oxide core-shell systems

    Science.gov (United States)

    Jarzębski, Maciej; Kościński, Mikołaj; Białopiotrowicz, Tomasz

    2017-08-01

    The size of nanoparticles is one of the most important factors for their possible applications. Various techniques for the nanoparticle size characterization are available. In this paper selected techniques will be considered base on the prepared core-shell magnetite nanoparticles. Magnetite is one of the most investigated and developed magnetic material. It shows interesting magnetic properties which can be used for biomedical applications, such as drug delivery, hypothermia and also as a contrast agent. To reduce the toxic effects of Fe3O4, magnetic core was covered by dextran and gelatin. Moreover, the shell was doped by fluorescent dye for confocal microscopy investigation. The main investigation focused on the methods for particles size determination of modified magnetite nanoparticles prepared with different techniques. The size distribution were obtained by nanoparticle tracking analysis, dynamic light scattering and transmission electron microscopy. Furthermore, fluorescent correlation spectroscopy (FCS) and confocal microscopy were used to compare the results for particle size determination of core-shell systems.

  3. Core surface magnetic field evolution 2000–2010

    DEFF Research Database (Denmark)

    Finlay, Chris; Jackson, A.; Gillet, N.

    2012-01-01

    harmonics up to degree and order 24 and a temporal parametrization of sixth‐order B‐splines with 0.25 yr knot spacing is employed. Models were constructed by minimizing an absolute deviation measure of misfit along with measures of spatial and temporal complexity at the core surface. We investigate...... is weaker. Rapid field evolution is observed under the eastern Indian Ocean associated with the growth and drift of an intense low latitude flux patch. We also find that the present axial dipole decay arises from a combination of subtle changes in the southern hemisphere field morphology....

  4. Synthesis and characterization of multifunctional silica core-shell nanocomposites with magnetic and fluorescent functionalities

    International Nuclear Information System (INIS)

    Ma Zhiya; Dosev, Dosi; Nichkova, Mikaela; Dumas, Randy K.; Gee, Shirley J.; Hammock, Bruce D.; Liu Kai; Kennedy, Ian M.

    2009-01-01

    Multifunctional core-shell nanocomposites with a magnetic core and a silica shell doped with lanthanide chelate have been prepared by a simple method. First, citric acid-modified magnetite nanoparticles were synthesized by a chemical coprecipitation method. Then the magnetite nanoparticles were coated with silica shells doped with terbium (Tb 3+ ) complex by a modified Stoeber method based on hydrolyzing and condensation of tetraethyl orthosilicate (TEOS) and a silane precursor. These multifunctional nanocomposites are potentially useful in a variety of biological areas such as bio-imaging, bio-labeling and bioassays because they can be simultaneously manipulated with an external magnetic field and exhibit unique phosphorescence properties.

  5. Electric Dipole Antennas With Magnetic-Coated PEC Cores: Reaching the Chu Lower Bound on Q

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.

    2012-01-01

    The radiation properties of spherical electric dipole antennas with electric current excitation and material-coated perfectly electrically conducting (PEC) cores are investigated analytically using vector spherical wave functions. Closed-form expressions for electric and magnetic stored energy...... as well as the radiation quality factor $Q$ are derived. Using these, it is shown that properly selected magnetic coating and radius of the PEC core vastly reduce the internal stored energy, and thus make the $Q$ of an electric dipole antenna approach the Chu lower bound....

  6. Core Polarization and Tensor Coupling Effects on Magnetic Moments of Hypernuclei

    International Nuclear Information System (INIS)

    Jiang-Ming, Yao; Jie, Meng; Hong-Feng, Lü; Greg, Hillhouse

    2008-01-01

    Effects of core polarization and tensor coupling on the magnetic moments in Λ 13 C, Λ 17 O, and Λ 41 Ca Λ-hypernuclei are studied by employing the Dirac equation with scalar, vector and tensor potentials. It is found that the effect of core polarization on the magnetic moments is suppressed by Λ tensor coupling. The Λ tensor potential reduces the spin-orbit splitting of p Λ states considerably. However, almost the same magnetic moments are obtained using the hyperon wavefunction obtained via the Dirac equation either with or without the A tensor potential in the electromagnetic current vertex. The deviations of magnetic moments for p Λ states from the Schmidt values are found to increase with nuclear mass number. (nuclear physics)

  7. A novel approach to preparing magnetic protein microspheres with core-shell structure

    International Nuclear Information System (INIS)

    Jiang Wei; Sun Zhendong; Li Fengsheng; Chen Kai; Liu Tianyu; Liu Jialing; Zhou Tianle; Guo Rui

    2011-01-01

    Magnetic protein microspheres with core-shell structure were prepared through a novel approach based on the sonochemical method and the emulsion solvent evaporation method. The microspheres are composed of the oleic acid and undecylenic acid modified Fe 3 O 4 cores and coated with globular bovine serum albumin (BSA). Under an optimized condition, up to 57.8 wt% of approximately 10 nm superparamagnetic Fe 3 O 4 nanoparticles could be uniformly encapsulated into the BSA microspheres with the diameter of approximately 160 nm and the high saturation magnetization of 38.5 emu/g, besides of the abundant functional groups. The possible formation mechanism of magnetic microspheres was discussed in detail. - Research Highlights: → Magnetic protein microspheres with core-shell structure were prepared through a novel approach based on the sonochemical method and the emulsion solvent evaporation method.→ The microspheres are composed of the oleic acid and undecylenic acid modified Fe 3 O 4 cores and coated with globular bovine serum albumin (BSA).→ 57.8 wt% of approximately 10 nm superparamagnetic Fe 3 O 4 nanoparticles could be uniformly encapsulated into the BSA microspheres with the diameter of approximately 160 nm and the high saturation magnetization of 38.5 emu/g, besides the abundant functional groups.

  8. Physical property control in core/shell inorganic nanostructures for fluorescence and magnetic targeting applications

    Science.gov (United States)

    Roberts, Stephen K.

    Nanomaterials show immense promise for the future in numerous areas of application. Properties that are unique from the bulk material and are tunable allow for innovation in material design. This thesis will focus on controlling the physical properties of core/shell nanostructures to enhance the utility of the materials. The first focus is on the impact of different solvent mixtures during the shell growth phase of SILAR based core/shell quantum dot synthesis is studied. Gaining insight into the mechanism for SILAR growth of core/shell nanoparticles allows improved synthetic yields and precursor binding, providing enhanced control to synthesis of core/shell nanoparticles. The second focus of this thesis is exploring the use of magnetic nanoparticles for magnetic drug targeting for cardiovascular conditions. Magnetic targeting for drug delivery enables increased local drug concentration, while minimizing non-specific interactions. In order to be effective for magnetic targeting, it must be shown that low magnetic strength is sufficient to capture flowing nanoparticles. By demonstrating the binding of a therapeutic agent to the surface at medicinal levels, the viability for use as a nanoparticle drug delivery system is improved.

  9. A novel approach to preparing magnetic protein microspheres with core-shell structure

    Energy Technology Data Exchange (ETDEWEB)

    Jiang Wei, E-mail: climentjw@126.co [National Special Superfine Powder Engineering Research Center, Nanjing University of Science and Technology, Nanjing 210094 (China); Sun Zhendong; Li Fengsheng [National Special Superfine Powder Engineering Research Center, Nanjing University of Science and Technology, Nanjing 210094 (China); Chen Kai; Liu Tianyu; Liu Jialing [Department of Physics, Nanjing University of Science and Technology, Nanjing 210094 (China); Zhou Tianle [Department of Materials Science and Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China); Guo Rui [Department of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China)

    2011-03-15

    Magnetic protein microspheres with core-shell structure were prepared through a novel approach based on the sonochemical method and the emulsion solvent evaporation method. The microspheres are composed of the oleic acid and undecylenic acid modified Fe{sub 3}O{sub 4} cores and coated with globular bovine serum albumin (BSA). Under an optimized condition, up to 57.8 wt% of approximately 10 nm superparamagnetic Fe{sub 3}O{sub 4} nanoparticles could be uniformly encapsulated into the BSA microspheres with the diameter of approximately 160 nm and the high saturation magnetization of 38.5 emu/g, besides of the abundant functional groups. The possible formation mechanism of magnetic microspheres was discussed in detail. - Research Highlights: Magnetic protein microspheres with core-shell structure were prepared through a novel approach based on the sonochemical method and the emulsion solvent evaporation method. The microspheres are composed of the oleic acid and undecylenic acid modified Fe{sub 3}O{sub 4} cores and coated with globular bovine serum albumin (BSA). 57.8 wt% of approximately 10 nm superparamagnetic Fe{sub 3}O{sub 4} nanoparticles could be uniformly encapsulated into the BSA microspheres with the diameter of approximately 160 nm and the high saturation magnetization of 38.5 emu/g, besides the abundant functional groups.

  10. THE FRAGMENTATION OF MAGNETIZED, MASSIVE STAR-FORMING CORES WITH RADIATIVE FEEDBACK

    Energy Technology Data Exchange (ETDEWEB)

    Myers, Andrew T.; McKee, Christopher F. [Department of Physics, University of California, Berkeley, Berkeley, CA 94720 (United States); Cunningham, Andrew J. [Lawrence Livermore National Laboratory, P.O. Box 808, L-23, Livermore, CA 94550 (United States); Klein, Richard I. [Department of Astronomy, University of California, Berkeley, Berkeley, CA 94720 (United States); Krumholz, Mark R., E-mail: atmyers@berkeley.edu [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States)

    2013-04-01

    We present a set of three-dimensional, radiation-magnetohydrodynamic calculations of the gravitational collapse of massive (300 M{sub Sun }), star-forming molecular cloud cores. We show that the combined effects of magnetic fields and radiative feedback strongly suppress core fragmentation, leading to the production of single-star systems rather than small clusters. We find that the two processes are efficient at suppressing fragmentation in different regimes, with the feedback most effective in the dense, central region and the magnetic field most effective in more diffuse, outer regions. Thus, the combination of the two is much more effective at suppressing fragmentation than either one considered in isolation. Our work suggests that typical massive cores, which have mass-to-flux ratios of about 2 relative to critical, likely form a single-star system, but that cores with weaker fields may form a small star cluster. This result helps us understand why the observed relationship between the core mass function and the stellar initial mass function holds even for {approx}100 M{sub Sun} cores with many thermal Jeans masses of material. We also demonstrate that a {approx}40 AU Keplerian disk is able to form in our simulations, despite the braking effect caused by the strong magnetic field.

  11. Toroidal HTS transformer with cold magnetic core - analysis with FEM software

    International Nuclear Information System (INIS)

    Grzesik, B; Stepien, M; Jez, R

    2010-01-01

    The aim of this paper is to present a thorough characterization of the toroidal HTS transformer by means of FEM analysis. The analysis was a 2D/3D harmonic electromagnetic and thermal analysis. The toroidal transformer operated in LN2 by being immersed together with the magnetic core in it, for which its power losses were acceptable. Two extreme variants of windings were analysed. The first one called parallel and the second called perpendicular. Three variants of the magnetic core were considered. In the first one the core was put outside of the windings, in the second the core was inside of the windings and in the third variant the core was outside as well as inside of the windings. The windings were made of HTS tape BiSCCO-2223/Ag while the magnetic core was made of the nanocrystalline material Finemet. The two windings, with a 1:1 turn-to-turn ratio, were uniformly distributed along the whole torus circumference. The output power, efficiency and power density are in the results of the analysis. The temperature distribution was also calculated. In summary, the performance of the transformer is better than those currently known.

  12. EXPERIMENTAL DETERMINATION OF LONGITUDINAL COMPONENT OF MAGNETIC FLUX IN FERROMAGNETIC WIRE OF SINGLE-CORE POWER CABLE ARMOUR

    Directory of Open Access Journals (Sweden)

    I.A. Kostiukov

    2014-12-01

    Full Text Available A problem of determination of effective longitudinal magnetic permeability of single core power cable armour is defined. A technique for experimental determination of longitudinal component of magnetic flux in armour spiral ferromagnetic wire is proposed.

  13. Magnetic susceptibility measurements of boring cores obtained from regional hydrological study project

    International Nuclear Information System (INIS)

    Hasegawa, Ken

    2010-02-01

    We measured the magnetic susceptibility of boring cores obtained from the Regional Hydrological Study Project to interpret the aeromagnetic survey data which was carried out in Tono area with about 40km square surrounding Tono Geoscience Center. The result of measurements indicates that the magnetic susceptibility of the Toki Granite is not distributed uniformly and the maximum value becomes two orders in magnitude larger than its minimum value. (author)

  14. Lower Bound for the Radiation $Q$ of Electrically Small Magnetic Dipole Antennas With Solid Magnetodielectric Core

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Breinbjerg, Olav

    2011-01-01

    A new lower bound for the radiation $Q$ of electrically small spherical magnetic dipole antennas with solid magnetodielectric core is derived in closed form using the exact theory. The new bound approaches the Chu lower bound from above as the antenna electrical size decreases. For $ka, the new...... bound is lower than the bounds for spherical magnetic as well as electric dipole antennas composed of impressed electric currents in free space....

  15. Single axis controlled hybrid magnetic bearing for left ventricular assist device: hybrid core and closed magnetic circuit.

    Science.gov (United States)

    da Silva, Isaias; Horikawa, Oswaldo; Cardoso, Jose R; Camargo, Fernando A; Andrade, Aron J P; Bock, Eduardo G P

    2011-05-01

    In previous studies, we presented main strategies for suspending the rotor of a mixed-flow type (centrifugal and axial) ventricular assist device (VAD), originally presented by the Institute Dante Pazzanese of Cardiology (IDPC), Brazil. Magnetic suspension is achieved by the use of a magnetic bearing architecture in which the active control is executed in only one degree of freedom, in the axial direction of the rotor. Remaining degrees of freedom, excepting the rotation, are restricted only by the attraction force between pairs of permanent magnets. This study is part of a joint project in development by IDPC and Escola Politecnica of São Paulo University, Brazil. This article shows advances in that project, presenting two promising solutions for magnetic bearings. One solution uses hybrid cores as electromagnetic actuators, that is, cores that combine iron and permanent magnets. The other solution uses actuators, also of hybrid type, but with the magnetic circuit closed by an iron core. After preliminary analysis, a pump prototype has been developed for each solution and has been tested. For each prototype, a brushless DC motor has been developed as the rotor driver. Each solution was evaluated by in vitro experiments and guidelines are extracted for future improvements. Tests have shown good results and demonstrated that one solution is not isolated from the other. One complements the other for the development of a single-axis-controlled, hybrid-type magnetic bearing for a mixed-flow type VAD. © 2011, Copyright the Authors. Artificial Organs © 2011, International Center for Artificial Organs and Transplantation and Wiley Periodicals, Inc.

  16. Structural, magnetic characterization (dependencies of coercivity and loss with the frequency) of magnetic cores based in Finemet

    Science.gov (United States)

    Osinalde, M.; Infante, P.; Domínguez, L.; Blanco, J. M.; del Val, J. J.; Chizhik, A.; González, J.

    2017-12-01

    We report changes of coercivity, induced magnetic anisotropy, magneto-optical domain structure and frequency dependencies of coercivity and energy loss (up to 10 MHz) associated with the structural modifications produced by thermal treatments under applied magnetic field (field annealing) in toroidal wound cores of Fe73.5Cu1Nb3Si15.5B7 amorphous alloy. The thermal treatment (535 °C, 1 h) leads to the typical nanocrystalline structure of α-Fe(Si) nanograins (60-65% relative volume, 10-20 nm average grain size embedded in a residual amorphous matrix, while the magnetic field with the possibility to be applied in two directions to the toroidal core axis, that is in transverse (which is equivalent to the transverse direction of the ribbon) or longitudinal (equivalent to the longitudinal direction of the ribbon), develops a macroscopic uniaxial magnetic anisotropy in the transverse (around 245 J/m3) or longitudinal (around 85 J/m3) direction of the ribbon, respectively. It is remarkable the quasi-unhysteretic character of the cores with these two kinds of field annealing as comparing with that of the as-quenched one. Magneto-optical study by Kerr-effect of the ribbons provides useful information on the domain structure of the surface in agreement with the direction and intensity of the induced magnetic anisotropy. This induced uniaxial magnetic anisotropy plays a very important role on the Hc(f) and EL(f) curves, (f: frequency), being drastic the presence and direction of the induced magnetic anisotropy. In addition, these frequency dependencies show a significant change at the frequency around 100 Hz.

  17. Method of magnetic susceptibility mapping of drilled cores. Experimental measurements for geologic structures determination

    International Nuclear Information System (INIS)

    Delrive, C.

    1993-01-01

    The evaluation of the safety of a deep geologic repository for dangerous materials requires the knowledge of the interstitial system of the surrounding host rock. A method is proposed for the determination of geologic structures (in particular fractures) from the magnetic susceptibility mapping of drilled cores. The feasibility of the method has been demonstrated using a SQUID magneto-gradient meter. A measurement tool using a new magnetic susceptibility captor and a testing bench have been developed. This tool allows the measurement of rocks with a magnetic susceptibility greater than 10 -5 SI units and can generate magnetic susceptibility maps with 4 x 4 mm 2 pixels. A magnetic visibility criterion has been defined which allows to foresee if a structure is visible or not. According to the measurements done, it is shown that any centimeter-scale structure with a sufficient magnetic contrast (20%) with respect to the matrix is visible. Therefore, the dip and the orientation of such structure can be determined with a 3 degree and a 5 degree precision, respectively. The position of the structure along the core axis is known with a 4 mm precision. On the other hand, about half of the magnetic contrasts observed do not correspond to the visual analyses and can be explained by very small variations of the mineralogic composition. This last point offers some interesting ways for future research using magnetic susceptibility mapping. (J.S.). 31 refs., 90 figs., 18 tabs., 2 photos., 6 appends

  18. Magnetophoresis behaviour at low gradient magnetic field and size control of nickel single core nanobeads

    Energy Technology Data Exchange (ETDEWEB)

    Benelmekki, M., E-mail: benelmekki@fisica.uminho.p [Centro de Fisica, Universidade do Minho, Braga (Portugal); Montras, A. [Sepmag Tecnologies, Parc Tecnologic del Valles, Barcelona (Spain); Martins, A.J.; Coutinho, P.J.G. [Centro de Fisica, Universidade do Minho, Braga (Portugal); Martinez, Ll.M. [Sepmag Technologies, Atlanta, GA (United States)

    2011-08-15

    Magnetic separation of organic compounds, proteins, nucleic acids and other biomolecules, and cells from complex reaction mixtures is becoming the most suitable solution for large production in bioindustrial purification and extraction processes. Optimal magnetic properties can be achieved by the use of metals. However, they are extremely sensitive to oxidation and degradation under atmospheric conditions. In this work Ni nanoparticles are synthesised by conventional solution reduction process with the addition of a non-ionic surfactant as a surface agent. The nanoparticles were surfacted in citric acid and then coated with silica to form single core Ni nanobeads. A magnetophoresis study at different magnetic field gradients and at the different steps of synthesis route was performed using Horizontal Low Gradient Magnetic Field (HLGMF) systems. The reversible aggregation times are reduced to a few seconds, allowing a very fast separation process. - Research highlights: Monodispersed single core Ni-silica core-shell structures were prepared. Control of Ni nanoparticles size was achieved using a non-ionic surfactant. Magnetophoresis at different magnetic field gradients was monitored. Magnetophoresis at different steps of synthesis route was performed. Attractive magnetic interactions overcome electrostatic repulsions.

  19. The Study of Spherical Cores with a Toroidal Magnetic Field Configuration

    Energy Technology Data Exchange (ETDEWEB)

    Gholipour, Mahmoud [Research Institute for Astronomy and Astrophysics of Maragha (RIAAM)—Maragha, P.O. Box 55134-441 (Iran, Islamic Republic of)

    2017-04-01

    Observational studies of the magnetic fields in molecular clouds have significantly improved the theoretical models developed for the structure and evolution of dense clouds and for the star formation process as well. The recent observational analyses on some cores indicate that there is a power-law relationship between magnetic field and density in the molecular clouds. In this study, we consider the stability of spherical cores with a toroidal magnetic field configuration in the molecular clouds. For this purpose, we model a spherical core that is in magnetostatic equilibrium. Herein, we propose an equation of density structure, which is a modified form of the isothermal Lane–Emden equation in the presence of the toroidal magnetic field. The proposed equation describes the effect of the toroidal magnetic field on the cloud structure and the mass cloud. Furthermore, we found an upper limit for this configuration of magnetic field in the molecular clouds. Then, the virial theorem is used to consider the cloud evolution leading to an equation in order to obtain the lower limit of the field strength in the molecular cloud. However, the results show that the field strength of the toroidal configuration has an important effect on the cloud structure, whose upper limit is related to the central density and field gradient. The obtained results address some regions of clouds where the cloud decomposition or star formation can be seen.

  20. Magnetic properties of cores from the Wenchuan Earthquake Fault Scientific Drilling Hole-2 (WFSD-2), China

    Science.gov (United States)

    Zhang, L., Jr.; Sun, Z.; Li, H.; Cao, Y.; Ye, X.; Wang, L.; Zhao, Y.; Han, S.

    2015-12-01

    During an earthquake, seismic slip and frictional heating may cause the physical and chemical alterations of magnetic minerals within the fault zone. Rock magnetism provides a method for understanding earthquake dynamics. The Wenchuan earthquake Fault Scientific Drilling Project (WFSD) started right after 2008 Mw7.9 Wenchuan earthquake, to investigate the earthquake faulting mechanism. Hole 2 (WFSD-2) is located in the Pengguan Complex in the Bajiaomiao village (Dujiangyan, Sichuan), and reached the Yingxiu-Beichuan fault (YBF). We measured the surface magnetic susceptibility of the cores in WFSD-2 from 500 m to 1530 m with an interval of 1 cm. Rocks at 500-599.31 m-depth and 1211.49-1530 m-depth are from the Neoproterozoic Pengguang Complex while the section from 599.31 m to 1211.49 m is composed of Late Triassic sediments. The magnetic susceptibility values of the first part of the Pengguan Complex range from 1 to 25 × 10-6 SI, while the second part ranges from 10 to 200 × 10-6 SI, which indicate that the two parts are not from the same rock units. The Late Triassic sedimentary rocks have a low magnetic susceptibility values, ranging from -5 to 20 × 10-6 SI. Most fault zones coincide with the high value of magnetic susceptibility in the WFSD-2 cores. Fault rocks, mainly fault breccia, cataclasite, gouge and pseudotachylite within the WFSD-2 cores, and mostly display a significantly higher magnetic susceptibility than host rocks (5:1 to 20:1). In particular, in the YBF zone of the WFSD-2 cores (from 600 to 960 m), dozens of stages with high values of magnetic susceptibility have been observed. The multi-layered fault rocks with high magnetic susceptibility values might indicate that the YBF is a long-term active fault. The magnetic susceptibility values change with different types of fault rocks. The gouge and pseudotachylite have higher values of magnetic susceptibility than other fault rocks. Other primary rock magnetism analyses were then performed to

  1. Lateral temperature variations at the core-mantle boundary deduced from the magnetic field

    Science.gov (United States)

    Bloxham, Jeremy; Jackson, Andrew

    1990-01-01

    Recent studies of the secular variation of the earth's magnetic field over periods of a few centuries have suggested that the pattern of fluid motion near the surface of earth's outer core may be strongly influenced by lateral temperature variations in the lowermost mantle. This paper introduces a self-consistent method for finding the temperature variations near the core surface by assuming that the dynamical balance there is geostrophic and that lateral density variations there are thermal in origin. As expected, the lateral temperature variations are very small. Some agreement is found between this pattern and the pattern of topography of the core-mantle boundary, but this does not conclusively answer to what extent core surface motions are controlled by the mantle, rather than being determined by processes in the core.

  2. EFFECTS OF FOSSIL MAGNETIC FIELDS ON CONVECTIVE CORE DYNAMOS IN A-TYPE STARS

    International Nuclear Information System (INIS)

    Featherstone, Nicholas A.; Toomre, Juri; Browning, Matthew K.; Brun, Allan Sacha

    2009-01-01

    The vigorous magnetic dynamo action achieved within the convective cores of A-type stars may be influenced by fossil magnetic fields within their radiative envelopes. We study such effects through three-dimensional simulations that model the inner 30% by radius of a 2 M sun A-type star, capturing the convective core and a portion of the overlying radiative envelope within our computational domain. We employ the three-dimensional anelastic spherical harmonic code to model turbulent dynamics within a deep rotating spherical shell. The interaction between a fossil field and the core dynamo is examined by introducing a large-scale magnetic field into the radiative envelope of a mature A star dynamo simulation. We find that the inclusion of a twisted toroidal fossil field can lead to a remarkable transition in the core dynamo behavior. Namely, a super-equipartition state can be realized in which the magnetic energy built by dynamo action is 10-fold greater than the kinetic energy of the convection itself. Such strong-field states may suggest that the resulting Lorentz forces should seek to quench the flows, yet we have achieved super-equipartition dynamo action that persists for multiple diffusion times. This is achieved by the relative co-alignment of the flows and magnetic fields in much of the domain, along with some lateral displacements of the fastest flows from the strongest fields. Convection in the presence of such strong magnetic fields typically manifests as 4-6 cylindrical rolls aligned with the rotation axis, each possessing central axial flows that imbue the rolls with a helical nature. The roll system also possesses core-crossing flows that couple distant regions of the core. We find that the magnetic fields exhibit a comparable global topology with broad, continuous swathes of magnetic field linking opposite sides of the convective core. We have explored several poloidal and toroidal fossil field geometries, finding that a poloidal component is essential

  3. Demonstration of Efficient Core Heating of Magnetized Fast Ignition in FIREX project

    Science.gov (United States)

    Johzaki, Tomoyuki

    2017-10-01

    Extensive theoretical and experimental research in the FIREX ``I project over the past decade revealed that the large angular divergence of the laser generated electron beam is one of the most critical problems inhibiting efficient core heating in electron-driven fast ignition. To solve this problem, beam guiding using externally applied kilo-tesla class magnetic field was proposed, and its feasibility has recently been numerically demonstrated. In 2016, integrated experiments at ILE Osaka University demonstrated core heating efficiencies reaching > 5 % and heated core temperatures of 1.7 keV. In these experiments, a kilo-tesla class magnetic field was applied to a cone-attached Cu(II) oleate spherical solid target by using a laser-driven capacitor-coil. The target was then imploded by G-XII laser and heated by the PW-class LFEX laser. The heating efficiency was evaluated by measuring the number of Cu-K- α photons emitted. The heated core temperature was estimated by the X-ray intensity ratio of Cu Li-like and He-like emission lines. To understand the detailed dynamics of the core heating process, we carried out integrated simulations using the FI3 code system. Effects of magnetic fields on the implosion and electron beam transport, detailed core heating dynamics, and the resultant heating efficiency and core temperature will be presented. I will also discuss the prospect for an ignition-scale design of magnetized fast ignition using a solid ball target. This work is partially supported by JSPA KAKENHI Grant Number JP16H02245, JP26400532, JP15K21767, JP26400532, JP16K05638 and is performed with the support and the auspices of the NIFS Collaboration Research program (NIFS12KUGK057, NIFS15KUGK087).

  4. Synthesis and magnetic properties of cobalt-iron/cobalt-ferrite soft/hard magnetic core/shell nanowires

    Science.gov (United States)

    Leandro Londoño-Calderón, César; Moscoso-Londoño, Oscar; Muraca, Diego; Arzuza, Luis; Carvalho, Peterson; Pirota, Kleber Roberto; Knobel, Marcelo; Pampillo, Laura Gabriela; Martínez-García, Ricardo

    2017-06-01

    A straightforward method for the synthesis of CoFe2.7/CoFe2O4 core/shell nanowires is described. The proposed method starts with a conventional pulsed electrodeposition procedure on alumina nanoporous template. The obtained CoFe2.7 nanowires are released from the template and allowed to oxidize at room conditions over several weeks. The effects of partial oxidation on the structural and magnetic properties were studied by x-ray spectrometry, magnetometry, and scanning and transmission electron microscopy. The results indicate that the final nanowires are composed of 5 nm iron-cobalt alloy nanoparticles. Releasing the nanowires at room conditions promoted surface oxidation of the nanoparticles and created a CoFe2O4 shell spinel-like structure. The shell avoids internal oxidation and promotes the formation of bi-magnetic soft/hard magnetic core/shell nanowires. The magnetic properties of both the initial single-phase CoFe2.7 nanowires and the final core/shell nanowires, reveal that the changes in the properties from the array are due to the oxidation more than effects associated with released processes (disorder and agglomeration).

  5. Torque decomposition and control in an iron core linear permanent magnet motor.

    NARCIS (Netherlands)

    Overboom, T.T.; Smeets, J.P.C.; Stassen, J.M.; Jansen, J.W.; Lomonova, E.

    2012-01-01

    Abstract—This paper concerns the decomposition and control of the torque produced by an iron core linear permanent magnet motor. The proposed method is based on the dq0-decomposition of the three-phase currents using Park’s transformation. The torque is decomposed into a reluctance component and two

  6. Relationship between chemical composition and magnetic susceptibility in sediment cores from Central Indian Ocean Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Pattan, J.N.; Parthiban, G.; Banakar, V.K.; Tomer, A.; Kulkarni, M.

    Three sediment cores in a north–south transect (3 degrees N to 13 degrees S) from different sediment types of the Central Indian Ocean Basin (CIOB) are studied to understand the possible relationship between magnetic susceptibility (Chi) and Al, Fe...

  7. Structural and magnetic properties of multi-core nanoparticles analysed using a generalised numerical inversion method

    Science.gov (United States)

    Bender, P.; Bogart, L. K.; Posth, O.; Szczerba, W.; Rogers, S. E.; Castro, A.; Nilsson, L.; Zeng, L. J.; Sugunan, A.; Sommertune, J.; Fornara, A.; González-Alonso, D.; Barquín, L. Fernández; Johansson, C.

    2017-01-01

    The structural and magnetic properties of magnetic multi-core particles were determined by numerical inversion of small angle scattering and isothermal magnetisation data. The investigated particles consist of iron oxide nanoparticle cores (9 nm) embedded in poly(styrene) spheres (160 nm). A thorough physical characterisation of the particles included transmission electron microscopy, X-ray diffraction and asymmetrical flow field-flow fractionation. Their structure was ultimately disclosed by an indirect Fourier transform of static light scattering, small angle X-ray scattering and small angle neutron scattering data of the colloidal dispersion. The extracted pair distance distribution functions clearly indicated that the cores were mostly accumulated in the outer surface layers of the poly(styrene) spheres. To investigate the magnetic properties, the isothermal magnetisation curves of the multi-core particles (immobilised and dispersed in water) were analysed. The study stands out by applying the same numerical approach to extract the apparent moment distributions of the particles as for the indirect Fourier transform. It could be shown that the main peak of the apparent moment distributions correlated to the expected intrinsic moment distribution of the cores. Additional peaks were observed which signaled deviations of the isothermal magnetisation behavior from the non-interacting case, indicating weak dipolar interactions. PMID:28397851

  8. Hybrid Magnetic Core-Shell Nanophotocatalysts for Environmental Applications

    Energy Technology Data Exchange (ETDEWEB)

    Gaulden, Patrick [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Murph, Simona Hunyadi [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Univ. of Georgia, Athens, GA (United States). Dept. of Physics and Astronomy

    2016-07-29

    This research study describes a facile sol-gel method to creating hybrid iron (III) oxide/silica/titania nanomaterials decorated with gold nanoparticles for use in environmental applications. The multi-functional composition of the nanomaterials allows for photocatalyzed reactions to occur in both the visible and the UV range. The morphologies, elemental composition, and surface charge of the nanoparticles were determined by Scanning Electron Microscopy (SEM), Energy Dispersive X-ray Spectroscopy (EDS), and Phase Analysis Light Scattering (PALS), respectively. The photocatalytic activity of the synthesized hybrid nanoparticles for breaking down a model analyte, methyl orange (MO), was then evaluated using UV-Vis Spectroscopy. The efficiency of the photocatalyst under UV light irradiation was measured and compared to other well-studied nanophotocatalysts, namely titanium oxide and iron oxide nanoparticles. The concentration dependence of both the photocatalyst and the analyte was also investigated. By utilizing the known UV-active properties of TiO2, the magnetic properties of Fe2O3, the optical properties of gold in the visible range of the spectrum, and the high stability of silica, a novel, highly efficient photocatalyst that is active on a broad range of the spectrum (UV-Vis) can be created to destroy organic pollutants in wastewater streams.

  9. Preparation of novel magnetic polyurethane foam nanocomposites by using core-shell nanoparticles

    Directory of Open Access Journals (Sweden)

    Mir Mohammad Alavi Nikje

    Full Text Available Abstract Iron oxide magnetic nanoparticles (NP's converted to the core- shell structres by reacting with by n-(2-aminoethyl-3-aminopropyl trimethoxysilane (AEAP incorporated in polyurethane flexible (PUF foam formulations. Fourier transform spectra, thermal gravimetric analysis, scanning electron images, thermo-mechanical analysis and magnetic properties of the prepared nanocomposites were studied. Obtained data shown that by the increasing of the amine modified magnetic iron oxide NP's up to 3% in the polymer matrix, thermal and magnetic properties improved in comparison with pristine foams. In addition, due to the presence of functional groups on the magnetic NP's surface, hard phases formation decrease in the bulk polymer and cause decreasing of glass transition temperature.

  10. Changes in Earth's core-generated magnetic field, as observed by Swarm

    DEFF Research Database (Denmark)

    Finlay, Chris; Olsen, Nils; Gillet, Nicolas

    By far the largest part of the Earth's magnetic field is generated by motions taking place within our planet's liquid metal outer core. Variations of this core-generated field thus provide us with a unique means of probing the dynamics taking place in the deepest reaches of the Earth....... In this contribution, we will present the core-generated magnetic field, and its recent time changes, as seen by ESA's Earth explorer mission Swarm. We will present a new time-dependent geomagnetic field model, called CHAOS-6, derived from satellite data collected by the Swarm constellation, as well as data from...... the previous missions CHAMP and Oersted together with ground observatory data. Advantage is taken of the constellation aspect of the Swarm mission by ingesting field differences along track and across track between the lower pair of Swarm satellites. Evaluating the global field model at the outer boundary...

  11. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    DEFF Research Database (Denmark)

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede

    2016-01-01

    magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive......Inductive components play an important role in filtering the switching harmonics related to the pulse width modulation in voltage source converters. Particularly, the filter reactor on the converter side of the filter is subjected to rectangular excitation which may lead to significant losses...... in the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...

  12. Magnetic response of hybrid ferromagnetic and antiferromagnetic core-shell nanostructures.

    Science.gov (United States)

    Khan, U; Li, W J; Adeela, N; Irfan, M; Javed, K; Wan, C H; Riaz, S; Han, X F

    2016-03-21

    The synthesis of FeTiO3-Ni(Ni80Fe20) core-shell nanostructures by a two-step method (sol-gel and DC electrodeposition) has been demonstrated. XRD analysis confirms the rhombohedral crystal structure of FeTiO3(FTO) with space group R3[combining macron]. Transmission electron microscopy clearly depicts better morphology of nanostructures with shell thicknesses of ∼25 nm. Room temperature magnetic measurements showed significant enhancement of magnetic anisotropy for the permalloy (Ni80Fe20)-FTO over Ni-FTO core-shell nanostructures. Low temperature magnetic measurements of permalloy-FeTiO3 core-shell structure indicated a strong exchange bias mechanism with magnetic coercivity below the antiferromagnetic Neel temperature (TN = 59 K). The exchange bias is attributed to the alignment of magnetic moments in the antiferromagnetic material at low temperature. Our scheme opens a path towards optimum automotive systems and wireless communications wherein broader bandwidths and smaller sizes are required.

  13. Electrical Core Transformer for Grid Improvement Incorporating Wire Magnetic Components

    Energy Technology Data Exchange (ETDEWEB)

    Harrie R. Buswell, PhD; Dennis Jacobs, PhD; Steve Meng

    2012-03-26

    The research reported herein adds to the understanding of oil-immersed distribution transformers by exploring and demonstrating potential improvements in efficiency and cost utilizing the unique Buswell approach wherein the unit is redesigned, replacing magnetic sheet with wire allowing for improvements in configuration and increased simplicity in the build process. Exploration of new designs is a critical component in our drive to assure reduction of energy waste, adequate delivery to the citizenry, and the robustness of U.S. manufacturing. By moving that conversation forward, this exploration adds greatly to our base of knowledge and clearly outlines an important avenue for further exploration. This final report shows several advantages of this new transformer type (outlined in a report signed by all of our collaborating partners and included in this document). Although materials development is required to achieve commercial potential, the clear benefits of the technology if that development were a given is established. Exploration of new transformer types and further work on the Buswell design approach is in the best interest of the public, industry, and the United States. Public benefits accrue from design alternatives that reduce the overall use of energy, but it must be acknowledged that new DOE energy efficiency standards have provided some assurance in that regard. Nonetheless the burden of achieving these new standards has been largely shifted to the manufacturers of oil-immersed distribution transformers with cost increasing up to 20% of some units versus 2006 when this investigation was started. Further, rising costs have forced the industry to look closely are far more expensive technologies which may threaten U.S. competitiveness in the distribution transformer market. This concern is coupled with the realization that many units in the nation's grid are beyond their optimal life which suggests that the nation may be headed for an infrastructure

  14. Scientific Drilling of Impact Craters - Well Logging and Core Analyses Using Magnetic Methods (Invited)

    Science.gov (United States)

    Fucugauchi, J. U.; Perez-Cruz, L. L.; Velasco-Villarreal, M.

    2013-12-01

    Drilling projects of impact structures provide data on the structure and stratigraphy of target, impact and post-impact lithologies, providing insight on the impact dynamics and cratering. Studies have successfully included magnetic well logging and analyses in core and cuttings, directed to characterize the subsurface stratigraphy and structure at depth. There are 170-180 impact craters documented in the terrestrial record, which is a small proportion compared to expectations derived from what is observed on the Moon, Mars and other bodies of the solar system. Knowledge of the internal 3-D deep structure of craters, critical for understanding impacts and crater formation, can best be studied by geophysics and drilling. On Earth, few craters have yet been investigated by drilling. Craters have been drilled as part of industry surveys and/or academic projects, including notably Chicxulub, Sudbury, Ries, Vredefort, Manson and many other craters. As part of the Continental ICDP program, drilling projects have been conducted on the Chicxulub, Bosumtwi, Chesapeake, Ries and El gygytgyn craters. Inclusion of continuous core recovery expanded the range of paleomagnetic and rock magnetic applications, with direct core laboratory measurements, which are part of the tools available in the ocean and continental drilling programs. Drilling studies are here briefly reviewed, with emphasis on the Chicxulub crater formed by an asteroid impact 66 Ma ago at the Cretaceous/Paleogene boundary. Chicxulub crater has no surface expression, covered by a kilometer of Cenozoic sediments, thus making drilling an essential tool. As part of our studies we have drilled eleven wells with continuous core recovery. Magnetic susceptibility logging, magnetostratigraphic, rock magnetic and fabric studies have been carried out and results used for lateral correlation, dating, formation evaluation, azimuthal core orientation and physical property contrasts. Contributions of magnetic studies on impact

  15. A novel approach to preparing magnetic protein microspheres with core-shell structure

    Science.gov (United States)

    Jiang, Wei; Sun, Zhendong; Li, Fengsheng; Chen, Kai; Liu, Tianyu; Liu, Jialing; Zhou, Tianle; Guo, Rui

    2011-03-01

    Magnetic protein microspheres with core-shell structure were prepared through a novel approach based on the sonochemical method and the emulsion solvent evaporation method. The microspheres are composed of the oleic acid and undecylenic acid modified Fe 3O 4 cores and coated with globular bovine serum albumin (BSA). Under an optimized condition, up to 57.8 wt% of approximately 10 nm superparamagnetic Fe 3O 4 nanoparticles could be uniformly encapsulated into the BSA microspheres with the diameter of approximately 160 nm and the high saturation magnetization of 38.5 emu/g, besides of the abundant functional groups. The possible formation mechanism of magnetic microspheres was discussed in detail.

  16. Reaching the Chu Lower Bound on Q With Magnetic Dipole Antennas Using a Magnetic-Coated PEC Core

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.; Breinbjerg, Olav

    2011-01-01

    We analytically solve the radiation problem for a spherical magnetic dipole antenna with a material-coated perfectly electrically conducting core. Using the closed-form expressions derived for the internal and external stored energies as well as for the radiation quality factor $Q$, we determine...... tends to infinity, the internal stored energy vanishes, and the $Q$ reaches the Chu lower bound, irrespective of the antenna electrical size $ka$ and permittivity of the coating....

  17. Investigating the Effects of I-Shaped Cores in an Outer-Rotor Transverse Flux Permanent Magnet Generator

    DEFF Research Database (Denmark)

    Hosseini, Seyedmohsen; Moghani, Javad Shokrollahi; Jensen, Bogi Bech

    2011-01-01

    This paper deals with the effects of I-shaped cores in an outer-rotor transverse flux permanent magnet generator. Performance characteristics of a typical outer-rotor transverse flux permanent magnet generator are obtained in two cases; with and without I-shaped cores. The results show that altho...... the advantages and disadvantage of using I-shaped cores and emphasizes the necessity of performing a tradeoff study between using and not using I-shaped cores in practical transverse flux permanent magnet generators....

  18. YOUNG STARLESS CORES EMBEDDED IN THE MAGNETICALLY DOMINATED PIPE NEBULA. II. EXTENDED DATA SET

    Energy Technology Data Exchange (ETDEWEB)

    Frau, P.; Girart, J. M.; Padovani, M. [Institut de Ciencies de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciencies, Torre C-5p, E-08193 Bellaterra, Catalunya (Spain); Beltran, M. T.; Sanchez-Monge, A. [INAF-Osservatorio Astrofisico di Arcetri, Largo Enrico Fermi 5, I-50125 Firenze (Italy); Busquet, G. [INAF-Istituto di Astrofisica e Planetologia Spaziali, via Fosso del Cavaliere 100, I-00133 Roma (Italy); Morata, O. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan (China); Masque, J. M.; Estalella, R. [Departament d' Astronomia i Meteorologia and Institut de Ciencies del Cosmos (IEEC-UB), Universitat de Barcelona, Marti i Franques 1, E-08028 Barcelona, Catalunya (Spain); Alves, F. O. [Argelander-Institut fuer Astronomie der Universitaet Bonn, Auf dem Huegel 71, D-53121 Bonn (Germany); Franco, G. A. P. [Departamento de Fisica-ICEx-UFMG, Caixa Postal 702, 30.123-970, Belo Horizonte (Brazil)

    2012-11-01

    The Pipe nebula is a massive, nearby, filamentary dark molecular cloud with a low star formation efficiency threaded by a uniform magnetic field perpendicular to its main axis. It harbors more than a hundred, mostly quiescent, very chemically young starless cores. The cloud is therefore a good laboratory to study the earliest stages of the star formation process. We aim to investigate the primordial conditions and the relation among physical, chemical, and magnetic properties in the evolution of low-mass starless cores. We used the IRAM 30 m telescope to map the 1.2 mm dust continuum emission of five new starless cores, which are in good agreement with previous visual extinction maps. For the sample of nine cores, which includes the four cores studied in a previous work, we derived an A {sub V} to N{sub H{sub 2}} factor of (1.27 {+-} 0.12) Multiplication-Sign 10{sup -21} mag cm{sup 2} and a background visual extinction of {approx}6.7 mag possibly arising from the cloud material. We derived an average core diameter of {approx}0.08 pc, density of {approx}10{sup 5} cm{sup -3}, and mass of {approx}1.7 M {sub Sun }. Several trends seem to exist related to increasing core density: (1) the diameter seems to shrink, (2) the mass seems to increase, and (3) the chemistry tends to be richer. No correlation is found between the direction of the surrounding diffuse medium magnetic field and the projected orientation of the cores, suggesting that large-scale magnetic fields seem to play a secondary role in shaping the cores. We also used the IRAM 30 m telescope to extend the previous molecular survey at 1 and 3 mm of early- and late-time molecules toward the same five new Pipe nebula starless cores, and analyzed the normalized intensities of the detected molecular transitions. We confirmed the chemical differentiation toward the sample and increased the number of molecular transitions of the 'diffuse' (e.g., the 'ubiquitous' CO, C{sub 2}H, and CS), &apos

  19. Distortion of Magnetic Fields in a Starless Core: Near-infrared Polarimetry of FeSt 1–457

    Energy Technology Data Exchange (ETDEWEB)

    Kandori, Ryo; Tamura, Motohide; Kusakabe, Nobuhiko [Department of Astronomy, The University of Tokyo, 7-3-1, Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Nakajima, Yasushi [Hitotsubashi University, 2-1 Naka, Kunitachi, Tokyo 186-8601 (Japan); Kwon, Jungmi [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Nagayama, Takahiro [Kagoshima University, 1-21-35 Korimoto, Kagoshima 890-0065 (Japan); Nagata, Tetsuya [Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Tomisaka, Kohji; Tatematsu, Ken’ichi, E-mail: r.kandori@nao.ac.jp [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2017-08-10

    Magnetic fields are believed to play an important role in controlling the stability and contraction of the dense condensations of gas and dust that lead to the formation of stars and planetary systems. In the present study, the magnetic field of FeSt 1–457, a cold starless molecular cloud core, was mapped on the basis of the polarized near-infrared light from 185 background stars after being dichroically absorbed by dust aligned with the magnetic field in the core. A distinct “hourglass-shaped” magnetic field was identified in the region of the core, and was interpreted as the first evidence of a magnetic field structure distorted by mass condensation in a starless core. The steep curvature of the magnetic field lines obtained in the present study indicates that the distortion was mainly created during the formation phase of the dense core. The derived mass-to-magnetic flux ratio indicates that the core is in a magnetically supercritical state. However, the stability of the core can be considered to be in a nearly critical state if the additional contributions from the thermal and turbulent support are included. Further diffusion of the magnetic field and/or turbulent dissipation would cause the onset of the dynamical collapse of the core. The geometrical relationship between the direction of the magnetic field lines and the elongation of the core was found to be in good agreement with theoretical predictions for the formation of Sun-like stars under the influence of a magnetic field.

  20. Pole-strength of the earth from Magsat and magnetic determination of the core radius

    Science.gov (United States)

    Voorhies, G. V.; Benton, E. R.

    1982-01-01

    A model based on two days of Magsat data is used to numerically evaluate the unsigned magnetic flux linking the earth's surface, and a comparison of the 16.054 GWb value calculated with values from earlier geomagnetic field models reveals a smooth, monotonic, and recently-accelerating decrease in the earth's pole strength at a 50-year average rate of 8.3 MWb, or 0.052%/year. Hide's (1978) magnetic technique for determining the radius of the earth's electrically-conducting core is tested by (1) extrapolating main field models for 1960 and 1965 downward through the nearly-insulating mantle, and then separately comparing them to equivalent, extrapolated models of Magsat data. The two unsigned fluxes are found to equal the Magsat values at a radius which is within 2% of the core radius; and (2) the 1960 main field and secular variation and acceleration coefficients are used to derive models of 1930, 1940 and 1950. The same core magnetic radius value, within 2% of the seismic value, is obtained. It is concluded that the mantle is a nearly-perfect insulator, while the core is a perfect conductor, on the decade time scale.

  1. Contributed Review: Nuclear magnetic resonance core analysis at 0.3 T

    International Nuclear Information System (INIS)

    Mitchell, Jonathan; Fordham, Edmund J.

    2014-01-01

    Nuclear magnetic resonance (NMR) provides a powerful toolbox for petrophysical characterization of reservoir core plugs and fluids in the laboratory. Previously, there has been considerable focus on low field magnet technology for well log calibration. Now there is renewed interest in the study of reservoir samples using stronger magnets to complement these standard NMR measurements. Here, the capabilities of an imaging magnet with a field strength of 0.3 T (corresponding to 12.9 MHz for proton) are reviewed in the context of reservoir core analysis. Quantitative estimates of porosity (saturation) and pore size distributions are obtained under favorable conditions (e.g., in carbonates), with the added advantage of multidimensional imaging, detection of lower gyromagnetic ratio nuclei, and short probe recovery times that make the system suitable for shale studies. Intermediate field instruments provide quantitative porosity maps of rock plugs that cannot be obtained using high field medical scanners due to the field-dependent susceptibility contrast in the porous medium. Example data are presented that highlight the potential applications of an intermediate field imaging instrument as a complement to low field instruments in core analysis and for materials science studies in general

  2. Lamination effects on a 3D model of the magnetic core of power transformers

    Directory of Open Access Journals (Sweden)

    Poveda-Lerma Antonio

    2017-12-01

    Full Text Available In this paper the lamination effect on the model of a power transformer’s core with stacked E-I structure is analyzed. The distribution of the magnetic flux in the laminations depends on the stacking method. In this work it is shown, using a 3D FEM model and an experimental prototype, that the non-uniform distribution of the flux in a laminated E-I core with alternate-lap joint stack increases substantially the average value of the magnetic flux density in the core, compared with a butt joint stack. Both the simulated model and the experimental tests show that the presence of constructive air-gaps in the E-I junctions gives rise to a zig-zag flux in the depth direction. This inter-lamination flux reduces the magnetic flux density in the I-pieces and increases substantially the magnetic flux density in the E-pieces, with highly saturated points that traditional 2D analysis cannot reproduce. The relation between the number of laminations included in the model, and the computational resourses needed to build it, is also evaluated in this work.

  3. Study of two medium size 'C' core electromagnets generating low magnetic fields

    International Nuclear Information System (INIS)

    Bhatia, M.S.; Dass, S.; Chatterjee, U.K.

    1987-01-01

    Magnetic field requirements of laboratories may impose constraints that often call for a variety of non-standard designs. The designer has to fulfil these demands without letting the design to become too inefficient. Since no ready design procedures are available he has to resort to intuition calculation and modelling. In spite of this there may be wide discrepancy between the design values and the actual results. This report describes the experience gained on two 'C' core electromagnets being used by authors. These magnets generate low magnetic fields over reasonably large volumes, a requirement that runs opposite to that of most other magnets. The study reveals the dependence of overall performance efficiency, field uniformity etc. on the design parameters. 31 figures. (author)

  4. Core/shell fluorescent magnetic silica-coated composite nanoparticles for bioconjugation

    Science.gov (United States)

    He, Rong; You, Xiaogang; Shao, Jun; Gao, Feng; Pan, Bifeng; Cui, Daxiang

    2007-08-01

    A new class of highly fluorescent, photostable, and magnetic core/shell nanoparticles has been synthesized from a reverse microemulsion method. The obtained bifunctional nanocomposites were characterized by transmission electron microscopy (TEM), ultraviolet-visible (UV-vis) spectrometry, photoluminescence (PL) spectrometry, and fluorescence microscopy in a magnetic field. To further improve their biocompatibility, the silica-coated nanoparticles were functionalized with amino groups. The fluorescent magnetic composite nanoparticles (FMCNPs) had a typical diameter of 50 ± 5 nm and a saturation magnetization of 3.21 emu g-1 at room temperature, and exhibited strong excitonic photoluminescence. Through activation with glutaraldehyde, the FMCNPs were successfully conjugated with goat anti-mouse immunoglobin G (GM IgG), and the bioactivity and binding specificity of the as-prepared FMCNPs-GM IgG were confirmed via immunofluorescence assays, commonly used in bioanalysis. So they are potentially useful for many applications in biolabelling, imaging, drug targeting, bioseparation and bioassays.

  5. Core/shell fluorescent magnetic silica-coated composite nanoparticles for bioconjugation

    International Nuclear Information System (INIS)

    He Rong; You Xiaogang; Shao Jun; Gao Feng; Pan Bifeng; Cui Daxiang

    2007-01-01

    A new class of highly fluorescent, photostable, and magnetic core/shell nanoparticles has been synthesized from a reverse microemulsion method. The obtained bifunctional nanocomposites were characterized by transmission electron microscopy (TEM), ultraviolet-visible (UV-vis) spectrometry, photoluminescence (PL) spectrometry, and fluorescence microscopy in a magnetic field. To further improve their biocompatibility, the silica-coated nanoparticles were functionalized with amino groups. The fluorescent magnetic composite nanoparticles (FMCNPs) had a typical diameter of 50 ± 5 nm and a saturation magnetization of 3.21 emu g -1 at room temperature, and exhibited strong excitonic photoluminescence. Through activation with glutaraldehyde, the FMCNPs were successfully conjugated with goat anti-mouse immunoglobin G (GM IgG), and the bioactivity and binding specificity of the as-prepared FMCNPs-GM IgG were confirmed via immunofluorescence assays, commonly used in bioanalysis. So they are potentially useful for many applications in biolabelling, imaging, drug targeting, bioseparation and bioassays

  6. One-pot synthesis and characterization of rhodamine derivative-loaded magnetic core-shell nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Jin, E-mail: jzhang@eng.uwo.ca; Li Jiaxin [University of Western Ontario, Department of Chemical and Biochemical Engineering (Canada); Razavi, Fereidoon S. [Brock University, Department of Physics (Canada); Mumin, Abdul Md. [University of Western Ontario, Department of Chemical and Biochemical Engineering (Canada)

    2011-05-15

    A new method to produce elaborate nanostructure with magnetic and fluorescent properties in one entity is reported in this article. Magnetite (Fe{sub 3}O{sub 4}) coated with fluorescent silica (SiO{sub 2}) shell was produced through the one-pot reaction, in which one reactor was utilized to realize the synthesis of superparamagnetic core of Fe{sub 3}O{sub 4}, the formation of SiO{sub 2} coating through the condensation and polymerization of tetraethylorthosilicate (TEOS), and the encapsulation of tetramethyl rhodamine isothiocyanate-dextran (TRITC-dextran) within silica shell. Transmission electron microscopy (TEM), energy dispersive X-ray (EDX) analysis, and X-ray diffraction (XRD) were carried out to investigate the core-shell structure. The magnetic core of the core-shell nanoparticles is 60 {+-} 10 nm in diameter. The thickness of the fluorescent SiO{sub 2} shell is estimated at 15 {+-} 5 nm. In addition, the fluorescent signal of the SiO{sub 2} shell has been detected by the laser confocal scanning microscopy (LCSM) with emission wavelength ({lambda}{sub em}) at 566 nm. In addition, the magnetic properties of TRITC-dextran loaded silica-coating iron oxide nanoparticles (Fe{sub 3}O{sub 4}-SiO{sub 2} NPs) were studied. The hysteresis loop of the core-shell NPs measured at room temperature shows that the saturation magnetization (M{sub s}) is not reached even at the field of 70 kOe (7T). Meanwhile, the very low coercivity (H{sub c}) and remanent magnetization (M{sub r}) are 0.375 kOe and 6.6 emu/g, respectively, at room temperature. It indicates that the core-shell particles have the superparamagnetic properties. The measured blocking temperature (T{sub B}) of the TRITC-dextran loaded Fe{sub 3}O{sub 4}-SiO{sub 2} NPs is about 122.5 K. It is expected that the multifunctional core-shell nanoparticles can be used in bio-imaging.

  7. Highly temperature responsive core-shell magnetic particles: synthesis, characterization and colloidal properties.

    Science.gov (United States)

    Rahman, Md Mahbubor; Chehimi, Mohamed M; Fessi, Hatem; Elaissari, Abdelhamid

    2011-08-15

    Temperature responsive magnetic polymer submicron particles were prepared by two step seed emulsion polymerization process. First, magnetic seed polymer particles were obtained by emulsion polymerization of styrene using potassium persulfate (KPS) as an initiator and divinylbenzne (DVB) as a cross-linker in the presence of oil-in-water magnetic emulsion (organic ferrofluid droplets). Thereafter, DVB cross-linked magnetic polymer particles were used as seed in the precipitation polymerization of N-isopropylacrylamide (NIPAM) to induce thermosensitive PNIPAM shell onto the hydrophobic polymer surface of the cross-linked magnetic polymer particles. To impart cationic functional groups in the thermosensitive PNIPAM backbone, the functional monomer aminoethylmethacrylate hydrochloride (AEMH) was used to polymerize with NIPAM while N,N'-methylenebisacrylamide (MBA) and 2, 2'-azobis (2-methylpropionamidine) dihydrochloride (V-50) were used as a cross-linker and as an initiator respectively. The effect of seed to monomer (w/w) ratio along with seed nature on the final particle morphology was investigated. Dynamic light scattering (DLS) results demonstrated particles swelling at below volume phase transition temperature (VPTT) and deswelling above the VPTT. The perfect core (magnetic) shell (polymer) structure of the particles prepared was confirmed by Transmission Electron Microscopy (TEM). The chemical composition of the particles were determined by thermogravimetric analysis (TGA). The effect of temperature, pH, ionic strength on the colloidal properties such as size and zeta potential of the micron sized thermo-sensitive magnetic particles were also studied. In addition, a short mechanistic discussion on the formation of core-shell morphology of magnetic polymer particles has also been discussed. Copyright © 2011 Elsevier Inc. All rights reserved.

  8. Fabrication of a solenoid-type inductor with Fe-based soft magnetic core

    International Nuclear Information System (INIS)

    Lei Chong; Zhou Yong; Gao Xiaoyu; Ding Wen; Cao Ying; Choi, Hyung; Won, Jonghwa

    2007-01-01

    A solenoid-type inductor was fabricated by MEMS (Microelectromechanical systems) technique. The fabrication process uses UV-LIGA, dry etching, fine polishing, and electroplating technique to achieve high performance of the solenoid-type inductor. Fe-based soft magnetic thin film was sputtered as the magnetic core, and polyimide was used as the insulation materials. The inductor was in size of 4x4 mm with coil width of 20 μm and space of 35 μm. The inductance is 1.61 μH at a frequency of 5 MHz with the maximum quality factor of 1.42

  9. Study of AC Magnetic Properties and Core Losses of Fe/Fe3O4-epoxy Resin Soft Magnetic Composite

    Science.gov (United States)

    Laxminarayana, T. A.; Manna, Subhendu Kumar; Fernandes, B. G.; Venkataramani, N.

    Soft Magnetic Composites (SMC) were prepared by coating of nanocrystalline Fe3O4 particles, synthesized by co-precipitation method, on atomized iron powder of particle size less than 53 μm in size using epoxy resin as a binder between iron and Fe3O4. Fe3O4 was chosen, for its high electric resistivity and suitable magnetic properties, to keep the coating layer magnetic and seek improvement to the magnetic properties of SMC. SEM images and XRD patterns were recorded in order to investigate the coatings on the surface of iron powder. A toroid was prepared by cold compaction of coated iron powder at 1050 MPa and subsequently cured at 150˚C for 1 hr in argon atmosphere. For comparison of properties, a toroid of uncoated iron powder was also compacted at 1050 MPa and annealed at 600˚C for 2 hr in argon atmosphere. The coated iron powder composite has a resistivity of greater than 200 μΩm, measured by four probe method. A comparison of Magnetic Hysteresis loops and core losses using B-H Loop tracer in the frequency range 0 to 1500 Hz on the coated and uncoated iron powder is reported.

  10. Magnetic Behavior of Ni-Fe Core-Shell and Alloy Nanowires

    Science.gov (United States)

    Tripathy, Jagnyaseni; Vargas, Jose; Spinu, Leonard; Wiley, John

    2013-03-01

    Template assisted synthesis was used to fabricate a series of Ni-Fe core-shell and alloy nanowires. By controlling reaction conditions as well as pore structure, both systems could be targeted and magnetic properties followed as a function of architectures. In the core-shell structure coercivity increases with decrease in shell thickness while for the alloys, coercivity squareness improve with increase pore diameter. Details on the systematic studies of these materials will be presented in terms of hysteretic measurements, including first order reversal curves (FORC), and FMR data. Magnetic variation as a function of structure and nanowire aspect ratios will be presented and the origins of these behaviors discussed. Advanced Material Research Institute

  11. High permeability cores to optimize the stimulation of deeply located brain regions using transcranial magnetic stimulation

    International Nuclear Information System (INIS)

    Salvador, R; Miranda, P C; Roth, Y; Zangen, A

    2009-01-01

    Efficient stimulation of deeply located brain regions with transcranial magnetic stimulation (TMS) poses many challenges, arising from the fact that the induced field decays rapidly and becomes less focal with depth. We propose a new method to improve the efficiency of TMS of deep brain regions that combines high permeability cores, to increase focality and field intensity, with a coil specifically designed to induce a field that decays slowly with increasing depth. The performance of the proposed design was investigated using the finite element method to determine the total electric field induced by this coil/core arrangement on a realistically shaped homogeneous head model. The calculations show that the inclusion of the cores increases the field's magnitude by as much as 25% while also decreasing the field's decay with depth along specific directions. The focality, as measured by the area where the field's norm is greater than 1/√2 of its maximum value, is also improved by as much as 15% with some core arrangements. The coil's inductance is not significantly increased by the cores. These results show that the presence of the cores might make this specially designed coil even more suited for the effective stimulation of deep brain regions.

  12. High permeability cores to optimize the stimulation of deeply located brain regions using transcranial magnetic stimulation

    Science.gov (United States)

    Salvador, R.; Miranda, P. C.; Roth, Y.; Zangen, A.

    2009-05-01

    Efficient stimulation of deeply located brain regions with transcranial magnetic stimulation (TMS) poses many challenges, arising from the fact that the induced field decays rapidly and becomes less focal with depth. We propose a new method to improve the efficiency of TMS of deep brain regions that combines high permeability cores, to increase focality and field intensity, with a coil specifically designed to induce a field that decays slowly with increasing depth. The performance of the proposed design was investigated using the finite element method to determine the total electric field induced by this coil/core arrangement on a realistically shaped homogeneous head model. The calculations show that the inclusion of the cores increases the field's magnitude by as much as 25% while also decreasing the field's decay with depth along specific directions. The focality, as measured by the area where the field's norm is greater than 1/\\sqrt 2 of its maximum value, is also improved by as much as 15% with some core arrangements. The coil's inductance is not significantly increased by the cores. These results show that the presence of the cores might make this specially designed coil even more suited for the effective stimulation of deep brain regions.

  13. High permeability cores to optimize the stimulation of deeply located brain regions using transcranial magnetic stimulation

    Energy Technology Data Exchange (ETDEWEB)

    Salvador, R; Miranda, P C [Institute of Biophysics and Biomedical Engineering, Faculty of Sciences, University of Lisbon, 1749-016 Lisbon (Portugal); Roth, Y [Advanced Technology Center, Sheba Medical Center, Tel-Hashomer (Israel); Zangen, A [Neurobiology Department, Weizmann Institute of Science, Rehovot 76100 (Israel)], E-mail: rnsalvador@fc.ul.pt

    2009-05-21

    Efficient stimulation of deeply located brain regions with transcranial magnetic stimulation (TMS) poses many challenges, arising from the fact that the induced field decays rapidly and becomes less focal with depth. We propose a new method to improve the efficiency of TMS of deep brain regions that combines high permeability cores, to increase focality and field intensity, with a coil specifically designed to induce a field that decays slowly with increasing depth. The performance of the proposed design was investigated using the finite element method to determine the total electric field induced by this coil/core arrangement on a realistically shaped homogeneous head model. The calculations show that the inclusion of the cores increases the field's magnitude by as much as 25% while also decreasing the field's decay with depth along specific directions. The focality, as measured by the area where the field's norm is greater than 1/{radical}2 of its maximum value, is also improved by as much as 15% with some core arrangements. The coil's inductance is not significantly increased by the cores. These results show that the presence of the cores might make this specially designed coil even more suited for the effective stimulation of deep brain regions.

  14. Single-core magnetic markers in rotating magnetic field based homogeneous bioassays and the law of mass action

    Energy Technology Data Exchange (ETDEWEB)

    Dieckhoff, Jan, E-mail: j.dieckhoff@tu-bs.de [Institut fuer Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany); Schrittwieser, Stefan; Schotter, Joerg [Molecular Diagnostics, AIT Austrian Institute of Technology, Vienna (Austria); Remmer, Hilke; Schilling, Meinhard; Ludwig, Frank [Institut fuer Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany)

    2015-04-15

    In this work, we report on the effect of the magnetic nanoparticle (MNP) concentration on the quantitative detection of proteins in solution with a rotating magnetic field (RMF) based homogeneous bioassay. Here, the phase lag between 30 nm iron oxide single-core particles and the RMF is analyzed with a fluxgate-based measurement system. As a test analyte anti-human IgG is applied which binds to the protein G functionalized MNP shell and causes a change of the phase lag. The measured phase lag changes for a fixed MNP and a varying analyte concentration are modeled with logistic functions. A change of the MNP concentration results in a nonlinear shift of the logistic function with the analyte concentration. This effect results from the law of mass action. Furthermore, the bioassay results are used to determine the association constant of the binding reaction. - Highlights: • A rotating magnetic field based homogeneous bioassay concept was presented. • Here, single-core iron oxide nanoparticles are applied as markers. • The impact of the particle concentration on the bioassay results is investigated. • The relation between particle concentration and bioassay sensitivity is nonlinear. • This finding can be reasonably explained by the law of mass action.

  15. Plasmon-Resonant Nanoparticles and Nanostars With Magnetic Cores: Synthesis and Magnetomotive Imaging

    OpenAIRE

    Song, Hyon-Min; Wei, Qingshan; Ong, Quy K.; Wei, Alexander

    2010-01-01

    Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs), and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core–shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness, and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mil...

  16. Influence of time dependent longitudinal magnetic fields on the cooling process, exchange bias and magnetization reversal mechanism in FM core/AFM shell nanoparticles: a Monte Carlo study.

    Science.gov (United States)

    Yüksel, Yusuf; Akıncı, Ümit

    2016-12-07

    Using Monte Carlo simulations, we have investigated the dynamic phase transition properties of magnetic nanoparticles with ferromagnetic core coated by an antiferromagnetic shell structure. Effects of field amplitude and frequency on the thermal dependence of magnetizations, magnetization reversal mechanisms during hysteresis cycles, as well as on the exchange bias and coercive fields have been examined, and the feasibility of applying dynamic magnetic fields on the particle have been discussed for technological and biomedical purposes.

  17. Muon spin rotation studies of electronic excitations and magnetism in the vortex cores of superconductors

    International Nuclear Information System (INIS)

    Sonier, J E

    2007-01-01

    The focus of this paper is on recent progress in muon spin rotation (μSR) studies of the vortex cores in type-II superconductors. By comparison of μSR measurements of the vortex core size in a variety of materials with results from techniques that directly probe electronic states, the effect of delocalized quasiparticles on the spatial variation of field in a lattice of interacting vortices has been determined for both single-band and multi-band superconductors. These studies demonstrate the remarkable accuracy of what some still consider an exotic technique. In recent years μSR has also been used to search for magnetism in and around the vortex cores of high-temperature superconductors. As a local probe μSR is specially suited for detecting static or quasistatic magnetism having short-range or random spatial correlations. As discussed in this review, μSR experiments support a generic phase diagram of competing superconducting and magnetic order parameters, characterized by a quantum phase transition to a state where the competing order is spatially nonuniform

  18. Plasmon-resonant nanoparticles and nanostars with magnetic cores: synthesis and magnetomotive imaging.

    Science.gov (United States)

    Song, Hyon-Min; Wei, Qingshan; Ong, Quy K; Wei, Alexander

    2010-09-28

    Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs) and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core-shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mildly reducing conditions, resulting in NSTs with physical features similar to those produced from colloidal gold seeds. NSTs could be produced below 100 nm from tip to tip, but seed size had a significant impact on growth habit, with larger seed particles producing submicrometer-sized "morning stars". Both NSTs and aggregated core-shell NPs are responsive to in-plane magnetic field gradients and can provide enhanced near-infrared (NIR) contrast under MM conditions, but do so by different mechanisms. NSTs can modulate polarized NIR scattering with minimal translational motion, giving the appearance of a periodic but stationary "blinking", whereas core-shell NP aggregates require lateral displacement for signal modulation. The polarization-sensitive MM imaging modality offers the dual advantage of enhanced signal quality and reduced background signal and can be applied toward the detection of magnetomotive NSTs in heterogeneous biological samples, as illustrated by their detection inside of granular cells such as macrophages.

  19. Magnetic model for a horse-spleen ferritin with a three-phase core structure

    Energy Technology Data Exchange (ETDEWEB)

    Jung, J.H.; Eom, T.W. [Quantum Photonic Science Research Center, Department of Physics and Research Institute for Natural Sciences, Hanyang University, Seoul 133-791 (Korea, Republic of); Lee, Y.P., E-mail: yplee@hanyang.ac.kr [Quantum Photonic Science Research Center, Department of Physics and Research Institute for Natural Sciences, Hanyang University, Seoul 133-791 (Korea, Republic of); Rhee, J.Y. [Department of Physics, Sungkyunkwan University, Suwon (Korea, Republic of); Choi, E.H. [Kwangwoon University, Seoul (Korea, Republic of)

    2011-12-15

    The increasing interests in magnetic nanoparticles has prompted research on ferritin, which is naturally a well-defined iron-storage protein in most living organisms. However, the exact magnetic behavior of ferritin is not well understood, because the crystal structures of ferritin and ferrihydrite, its major component, are not fully understood. Briefly, we discuss the previous magnetization models of ferritin and ferrihydrite and we present a new model ({Sigma}3L) of the initial magnetization of ferritin, considering its different phases. The new model includes three Langevin-function terms, which represent three different magnetic moments provided by the likely hydroxide and oxide mineral phases in ferritin. Compared to previous models, our simple model fits the experimental data 12 times better in terms of the sum of least squares. The magnetic independence of each component supports the multi-phase compositional model of the mineral core of horse-spleen ferritin. This {Sigma}3L model gives a quantization of the amounts of the different phases within horse-spleen ferritins that matches other published experimental data: 60-80% ferrihydrite, 15-25% maghemite/magnetite, and 1-10% hematite. - Highlights: > We present a new model ({Sigma}3L) of the initial magnetization of ferritin, considering its different phases. > New model includes three Langevin-function terms, which represent three different magnetic moments provided by ferritin phases. > Compared to previous models, our simple model fits the experimental data 12 times better in terms of the sum of least square. > The magnetic independence of each component supports that ferritin and ferrihydrite are composed of different phases.

  20. Influence of magnetic field configuration on magnetohydrodynamic waves in Earth's core

    Science.gov (United States)

    Knezek, Nicholas; Buffett, Bruce

    2018-04-01

    We develop a numerical model to study magnetohydrodynamic waves in a thin layer of stratified fluid near the surface of Earth's core. Past studies have been limited to using simple background magnetic field configurations. However, the choice of field distribution can dramatically affect the structure and frequency of the waves. To permit a more general treatment of background magnetic field and layer stratification, we combine finite volume and Fourier methods to describe the wave motions. We validate our model by comparisons to previous studies and examine the influence of background magnetic field configuration on two types of magnetohydrodynamic waves. We show that the structure of zonal Magnetic-Archimedes-Coriolis (MAC) waves for a dipole background field is unstable to small perturbations of the field strength in the equatorial region. Modifications to the wave structures are computed for a range of field configurations. In addition, we show that non-zonal MAC waves are trapped near the equator for realistic magnetic field distributions, and that their latitudinal extent depends upon the distribution of magnetic field strength at the CMB.

  1. Metal Amorphous Nanocomposite (MANC) Alloy Cores with Spatially Tuned Permeability for Advanced Power Magnetics Applications

    Science.gov (United States)

    Byerly, K.; Ohodnicki, P. R.; Moon, S. R.; Leary, A. M.; Keylin, V.; McHenry, M. E.; Simizu, S.; Beddingfield, R.; Yu, Y.; Feichter, G.; Noebe, R.; Bowman, R.; Bhattacharya, S.

    2018-06-01

    Metal amorphous nanocomposite (MANC) alloys are an emerging class of soft magnetic materials showing promise for a range of inductive components targeted for higher power density and higher efficiency power conversion applications including inductors, transformers, and rotating electrical machinery. Magnetization reversal mechanisms within these alloys are typically determined by composition optimization as well as controlled annealing treatments to generate a nanocomposite structure composed of nanocrystals embedded in an amorphous precursor. Here we demonstrate the concept of spatially varying the permeability within a given component for optimization of performance by using the strain annealing process. The concept is realized experimentally through the smoothing of the flux profile from the inner to outer core radius achieved by a monotonic variation in tension during the strain annealing process. Great potential exists for an extension of this concept to a wide range of other power magnetic components and more complex spatially varying permeability profiles through advances in strain annealing techniques and controls.

  2. Conductance oscillations of core-shell nanowires in transversal magnetic fields

    Science.gov (United States)

    Manolescu, Andrei; Nemnes, George Alexandru; Sitek, Anna; Rosdahl, Tomas Orn; Erlingsson, Sigurdur Ingi; Gudmundsson, Vidar

    2016-05-01

    We analyze theoretically electronic transport through a core-shell nanowire in the presence of a transversal magnetic field. We calculate the conductance for a variable coupling between the nanowire and the attached leads and show how the snaking states, which are low-energy states localized along the lines of the vanishing radial component of the magnetic field, manifest their existence. In the strong-coupling regime they induce flux periodic, Aharonov-Bohm-like, conductance oscillations, which, by decreasing the coupling to the leads, evolve into well-resolved peaks. The flux periodic oscillations arise due to interference of the snaking states, which is a consequence of backscattering at either the contacts with leads or magnetic or potential barriers in the wire.

  3. Synthesis and magnetic properties of inverted core-shell polyaniline-ferrite composite

    Energy Technology Data Exchange (ETDEWEB)

    Donescu, Dan [National Institute for Research & Development in Chemistry and Petrochemistry - ICECHIM, 202 Spl. Independentei, 060021, Bucharest (Romania); Fierascu, Radu Claudiu, E-mail: radu_claudiu_fierascu@yahoo.com [National Institute for Research & Development in Chemistry and Petrochemistry - ICECHIM, 202 Spl. Independentei, 060021, Bucharest (Romania); Ghiurea, Marius [National Institute for Research & Development in Chemistry and Petrochemistry - ICECHIM, 202 Spl. Independentei, 060021, Bucharest (Romania); Manaila-Maximean, Doina [University Politehnica of Bucharest, Department of Physics, 313 Spl. Independentei, 060042, Bucharest (Romania); Nicolae, Cristian Andi; Somoghi, Raluca; Spataru, Catalin Ilie [National Institute for Research & Development in Chemistry and Petrochemistry - ICECHIM, 202 Spl. Independentei, 060021, Bucharest (Romania); Stanica, Nicolae [Institute of Physical Chemistry “Ilie Murgulescu”, 202 Spl. Independentei, 060021, Bucharest (Romania); Raditoiu, Valentin [National Institute for Research & Development in Chemistry and Petrochemistry - ICECHIM, 202 Spl. Independentei, 060021, Bucharest (Romania); Vasile, Eugeniu [SC METAV – CD SA, 31 C. A. Rosetti Str., 021051, Bucharest (Romania)

    2017-08-31

    The present paper studies the effect of polyaniline grafting on magnetite functionalized with aminopropyltrimethoxysilane. All the compounds were characterized by analytical techniques (X-ray fluorescence, X-ray diffraction, Fourier transform infrared spectroscopy, thermal analysis, Transmission electron microscopy), as well as by determining their magnetic properties. The electron microscopy analysis of the hybrids shows similar morphologies for all the samples. The presence of the iron atoms on the surface of the final product supports the idea of the existence of an inverted core-shell type structure, the more polar ferrite orienting itself towards water. The correlation between the maximum grafting probability and the maximum magnetization is evidenced, demonstrating the importance of the polymer grafting method on the magnetic properties.

  4. Thin grain oriented electrical steel for PWM voltages fed magnetic cores

    Directory of Open Access Journals (Sweden)

    Thierry Belgrand

    2018-04-01

    Full Text Available This paper reports on performances of high permeability grain oriented electrical steel when used in association with power electronic switching devices. Loss measurement results obtained from the Epstein test, using sinusoidal or various PWM voltages in medium frequency range, show that for both studied thicknesses (HGO 0.23mm and HGO 0.18mm, comparing performances at a fixed induction level between the various situations may not be the most convenient method. The effect of magnetic domain refinement has been investigated. After having shown the interest of lowering the thickness, an alternative way of looking at losses is proposed that may help to design the magnetic core when it comes to the matter of reducing size in considering frequency and magnetization levels.

  5. Magnets

    International Nuclear Information System (INIS)

    Young, I.R.

    1984-01-01

    A magnet pole piece for an NMR imaging magnet is made of a plurality of magnetic wires with one end of each wire held in a non-magnetic spacer, the other ends of the wires being brought to a pinch, and connected to a magnetic core. The wires may be embedded in a synthetic resin and the magnetisation and uniformity thereof can be varied by adjusting the density of the wires at the spacer which forms the pole piece. (author)

  6. Top-down freezing in a Fe-FeS core and Ganymede's present-day magnetic field

    Science.gov (United States)

    Rückriemen, Tina; Breuer, Doris; Spohn, Tilman

    2018-06-01

    Ganymede's core most likely possesses an active dynamo today, which produces a magnetic field at the surface of ∼ 719 nT. Thermochemical convection triggered by cooling of the core is a feasible power source for the dynamo. Experiments of different research groups indicate low pressure gradients of the melting temperatures for Fe-FeS core alloys at pressures prevailing in Ganymede's core ( < 10 GPa). This may entail that the core crystallizes from the top instead of from the bottom as is expected for Earth's core. Depending on the core sulfur concentration being more iron- or more sulfur-rich than the eutectic concentration either snowing iron crystals or a solid FeS layer can form at the top of the core. We investigate whether these two core crystallization scenarios are capable of explaining Ganymede's present magnetic activity. To do so, we set up a parametrized one-dimensional thermal evolution model. We explore a wide range of parameters by running a large set of Monte Carlo simulations. Both freezing scenarios can explain Ganymede's present-day magnetic field. Dynamos of iron snow models are rather young ( < 1 Gyr), whereas dynamos below the FeS layer can be both young and much older ( ∼ 3.8 Gyr). Successful models preferably contain less radiogenic heat sources in the mantle than the chondritic abundance and show a correlation between the reference viscosity in the mantle and the initial core sulfur concentration.

  7. Measurement of magnetic susceptibility on tailings cores report on cores obtained from the Ontario Research Foundation lysimeter experiment

    International Nuclear Information System (INIS)

    1984-10-01

    Bulk susceptibility and induced magnetic remanence results are reported for 40 cores obtained from the uranium tailings lysimeter experiment at the Ontario Research Foundation. Both methods indicate a broad threefold subdivision of the tailings pile. An upper zone is characterized by an enhanced susceptibility level, which is related to enhanced concentration of both magnetite and hematite. Depletion zones, where present, are of limited areal extent and strongly developed. An intermediate zone is characterized by a mixture of large areas of reduced susceptibility that separate smaller regions of slightly enhanced susceptibility. The zones of susceptibility depletion appear to define a dendritic drainage pattern. Locally in this zone magnetite is enhanced and hematite depleted. In the lowermost zone susceptibility levels are reduced over most of the tailings bed. Only in the upper most right hand corner is there any vestige of a positive susceptibility concentration. Both magnetite and hematite are strongly depleted in this lower zone. Visually it is apparent that this lowermost depleted zone correlates to the zones of strongest 'yellowcake' development

  8. What does determine the sign of core in Magnetic Flux Rope structures of the Earth's magnetotail

    Directory of Open Access Journals (Sweden)

    D. V. Sarafopoulos

    2014-09-01

    Full Text Available This paper primarily examines the key factors being involved in precisely determining the sign of the core field in a magnetic flux rope (MFR like structure embedded in the tailward plasma flow associated with the Earth's magnetotail. Magnetic flux ropes are frequently detected by satellites moving smoothly northwards (upwards or southwards (downwards and crossing almost the whole plasma sheet; the sign of the rope's core is associated with the local tail's motion: If the tail is bending to an upward or downward direction, then the sign of the rope's core, being essentially an intense By deviation, will be positive or negative correspondingly. On the basis of this observational finding, a major question concerns the mechanism by which the tail's motion is dictated. The reconnection process acting in the tail will obviously produce symmetric structures of MFRs (with respect to the neutral sheet plane; therefore, the detected organized asymmetry may be an additional indication in the whole magnetotail' s dynamics. Moreover, we discuss the issue of the core's sign in cases without any significant magnetotail's motion. A model interpreting the diagnosed behavior is introduced: Once a tailward ion jet is produced in a thinned plasma sheet, it might form clockwise or counterclockwise ion vortices (i.e., loop-like ion currents providing the "magnetic core" with the appropriate sign. The crucial role of the interplanetary By deviation of the magnetic field (IMF is scrutinized and taken into account. The whole model is tested under the condition of long-lasting extraordinary events characterized by a persistent-intense By deviation with a duration up to 34 min. This work, based on Geotail single-satellite measurements, is not a statistical one; it is a first approach allowing the reconstruction of measurements in the whole range of the magnetotail's deflections, from negligible up to stronger significant magnetotail movements, and should be therefore

  9. Multi-photon excited luminescence of magnetic FePt core-shell nanoparticles.

    Science.gov (United States)

    Seemann, K M; Kuhn, B

    2014-07-01

    We present magnetic FePt nanoparticles with a hydrophilic, inert, and biocompatible silico-tungsten oxide shell. The particles can be functionalized, optically detected, and optically manipulated. To show the functionalization the fluorescent dye NOPS was bound to the FePt core-shell nanoparticles with propyl-triethoxy-silane linkers and fluorescence of the labeled particles were observed in ethanol (EtOH). In aqueous dispersion the NOPS fluorescence is quenched making them invisible using 1-photon excitation. However, we observe bright luminescence of labeled and even unlabeled magnetic core-shell nanoparticles with multi-photon excitation. Luminescence can be detected in the near ultraviolet and the full visible spectral range by near infrared multi-photon excitation. For optical manipulation, we were able to drag clusters of particles, and maybe also single particles, by a focused laser beam that acts as optical tweezers by inducing an electric dipole in the insulated metal nanoparticles. In a first application, we show that the luminescence of the core-shell nanoparticles is bright enough for in vivo multi-photon imaging in the mouse neocortex down to cortical layer 5.

  10. Air core poloidal magnetic field system for a toroidal plasma producing device

    International Nuclear Information System (INIS)

    Marcus, F.B.

    1978-01-01

    A poloidal magnetics system for a plasma producing device of toroidal configuration is provided that reduces both the total volt-seconds requirement and the magnitude of the field change at the toroidal field coils. The system utilizes an air core transformer wound between the toroidal field (TF) coils and the major axis outside the TF coils. Electric current in the primary windings of this transformer is distributed and the magnetic flux returned by air core windings wrapped outside the toroidal field coils. A shield winding that is closely coupled to the plasma carries a current equal and opposite to the plasma current. This winding provides the shielding function and in addition serves in a fashion similar to a driven conducting shell to provide the equilibrium vertical field for the plasma. The shield winding is in series with a power supply and a decoupling coil located outside the TF coil at the primary winding locations. The present invention requires much less energy than the usual air core transformer and is capable of substantially shielding the toroidal field coils from poloidal field flux

  11. Characterization of single-core magnetite nanoparticles for magnetic imaging by SQUID relaxometry

    International Nuclear Information System (INIS)

    Adolphi, Natalie L; Huber, Dale L; Monson, Todd C; Provencio, Paula P; Bryant, Howard C; Fegan, Danielle L; Tessier, Trace E; Flynn, Edward R; Lim, JitKang; Majetich, Sara A; Trujillo, Jason E; Lovato, Debbie M; Butler, Kimberly S; Larson, Richard S; Hathaway, Helen J

    2010-01-01

    Optimizing the sensitivity of SQUID (superconducting quantum interference device) relaxometry for detecting cell-targeted magnetic nanoparticles for in vivo diagnostics requires nanoparticles with a narrow particle size distribution to ensure that the Neel relaxation times fall within the measurement timescale (50 ms-2 s, in this work). To determine the optimum particle size, single-core magnetite nanoparticles (with nominal average diameters 20, 25, 30 and 35 nm) were characterized by SQUID relaxometry, transmission electron microscopy, SQUID susceptometry, dynamic light scattering and zeta potential analysis. The SQUID relaxometry signal (detected magnetic moment/kg) from both the 25 nm and 30 nm particles was an improvement over previously studied multi-core particles. However, the detected moments were an order of magnitude lower than predicted based on a simple model that takes into account the measured size distributions (but neglects dipolar interactions and polydispersity of the anisotropy energy density), indicating that improved control of several different nanoparticle properties (size, shape and coating thickness) will be required to achieve the highest detection sensitivity. Antibody conjugation and cell incubation experiments show that single-core particles enable a higher detected moment per cell, but also demonstrate the need for improved surface treatments to mitigate aggregation and improve specificity.

  12. Characterization of single-core magnetite nanoparticles for magnetic imaging by SQUID relaxometry

    Energy Technology Data Exchange (ETDEWEB)

    Adolphi, Natalie L [Department of Biochemistry and Molecular Biology, University of New Mexico, Albuquerque, NM 87131 (United States); Huber, Dale L; Monson, Todd C; Provencio, Paula P [Sandia National Laboratories, P. O. Box 5800, Albuquerque, NM 87185 (United States); Bryant, Howard C; Fegan, Danielle L; Tessier, Trace E; Flynn, Edward R [Senior Scientific, LLC, 11109 Country Club NE, Albuquerque, NM 87111 (United States); Lim, JitKang; Majetich, Sara A [Department of Physics, Carnegie Mellon University, Pittsburgh, PA 15213 (United States); Trujillo, Jason E; Lovato, Debbie M; Butler, Kimberly S; Larson, Richard S [Department of Pathology, Cancer Research and Treatment Center, University of New Mexico, Albuquerque, NM 87131 (United States); Hathaway, Helen J, E-mail: NAdolphi@salud.unm.ed [Department of Cell Biology and Physiology, University of New Mexico, Albuquerque, NM 87131 (United States)

    2010-10-07

    Optimizing the sensitivity of SQUID (superconducting quantum interference device) relaxometry for detecting cell-targeted magnetic nanoparticles for in vivo diagnostics requires nanoparticles with a narrow particle size distribution to ensure that the Neel relaxation times fall within the measurement timescale (50 ms-2 s, in this work). To determine the optimum particle size, single-core magnetite nanoparticles (with nominal average diameters 20, 25, 30 and 35 nm) were characterized by SQUID relaxometry, transmission electron microscopy, SQUID susceptometry, dynamic light scattering and zeta potential analysis. The SQUID relaxometry signal (detected magnetic moment/kg) from both the 25 nm and 30 nm particles was an improvement over previously studied multi-core particles. However, the detected moments were an order of magnitude lower than predicted based on a simple model that takes into account the measured size distributions (but neglects dipolar interactions and polydispersity of the anisotropy energy density), indicating that improved control of several different nanoparticle properties (size, shape and coating thickness) will be required to achieve the highest detection sensitivity. Antibody conjugation and cell incubation experiments show that single-core particles enable a higher detected moment per cell, but also demonstrate the need for improved surface treatments to mitigate aggregation and improve specificity.

  13. Environmental magnetic and petroleum hydrocarbons records in sediment cores from the north east coast of Tamilnadu, Bay of Bengal, India.

    Science.gov (United States)

    Venkatachalapathy, R; Veerasingam, S; Basavaiah, N; Ramkumar, T; Deenadayalan, K

    2011-04-01

    In this study, mineral magnetic properties and petroleum hydrocarbons were statistically analysed in four sediment cores (C1, A1, T1 and K1) from the north east coast of Tamilnadu, India to examine the feasibility of PHC concentrations assessment using magnetic susceptibility. The C1 and A1 cores reveal a clear horizon of increase in PHC above 35 and 50 cm respectively suggesting the excess anthropogenic loading occurred in the recent past. Magnetic properties which were enhanced in the upper part of the sediment cores were the result of ferrimagnetic minerals from anthropogenic sources. Factor analysis confirmed that the input of magnetic minerals and petroleum hydrocarbons in Chennai coastal sediments are derived from the same sources. The present study shows that instead of expensive and destructive PHC chemical methods, magnetic susceptibility is found to be a suitable, cheap and rapid method for detailed study of petroleum hydrocarbon contamination in marine sediments. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Synthesis of Ni core NiO shell nanostructure and magnetic investigation for shell thickness determination

    International Nuclear Information System (INIS)

    Arabi, H.; Bruck, E.; Tichelaar, F.D.

    2007-01-01

    Full text: Nickel oxide has received a considerable amount of attention in recent years for its catalytic, electronic and magnetic properties. Ni nanoparticles with an average size of 8 nm were prepared by dc - arc discharge in argon atmosphere. A current of 130 A and 300 milli bar pressure of argon have been applied. The produced Ni nanoparticles were annealed for oxidizing in air at 350 for six hours to produce antiferromagnetic NiO particles. The structure of Ni and NiO nanoparticles and size estimation of them studied by means of X-ray diffraction. The size and morphology of the particles were also characterized by high resolution transmission microscopy (TEM). The Ni core NiO shell structure, resulting from the oxidation process, were studied by magnetic properties measurements. A quantum design squid magnetometer, model MPMS5S was used for measuring saturation magnetization of both nanoparticles of Ni with and without NiO layer. By knowing the density of Ni and NiO, we were able to deduce the thickness of the Ni core and NiO outer layer. They are around 3 and 5 nanometers respectively. (authors)

  15. A novel system for rapid measurement of high-frequency magnetic properties of toroidal cores of different sizes

    CERN Document Server

    Derebasi, N; Moses, A J; Fox, D

    2000-01-01

    A novel system for power loss and B-H measurements on toroidal magnetic cores was built to operate up to 200 kHz. Measurement data taken using sophisticated software at 10 MHz sampling rate and 16-bit resolution shows the system is versatile and can be used to test a wide range of core sizes and materials with an error <+-3%.

  16. Core/shell magnetic mesoporous silica nanoparticles with radially oriented wide mesopores

    Directory of Open Access Journals (Sweden)

    Nikola Ž. Knežević

    2014-06-01

    Full Text Available Core/shell nanoparticles, containing magnetic iron-oxide (maghemite core and mesoporous shell with radial porous structure, were prepared by dispersing magnetite nanoparticles and adding tetraethylorthosilicate to a basic aqueous solution containing structure-templating cetyltrimethylammonium bromide and a pore-swelling mesithylene. The material is characterized by SEM and TEM imaging, nitrogen sorption and powder X-ray diffraction. Distinctive features of the prepared material are its high surface area (959 m2/g, wide average pore diameter (12.4 nm and large pore volume (2.3 cm3/g. The material exhibits radial pore structure and the high angle XRD pattern characteristic for maghemite nanoparticles, which are obtained upon calcination of the magnetite-containing material. The observed properties of the prepared material may render the material applicable in separation, drug delivery, sensing and heterogeneous catalysis.

  17. Magnetic properties of Co-ferrite-doped hydroxyapatite nanoparticles having a core/shell structure

    International Nuclear Information System (INIS)

    Petchsang, N.; Pon-On, W.; Hodak, J.H.; Tang, I.M.

    2009-01-01

    The magnetic properties of Co-ferrite-doped hydroxyapatite (HAP) nanoparticles of composition Ca 10-3x Fe 2x Co x (PO 4 ) 6 (OH) 2 (where x=0, 0.1, 0.2, 0.3, 0.4 and 0.5% mole) are studied. Transmission electron microscope micrograms show that the 90 nm size nanoparticles annealed at 1250 o C have a core/shell structure. Their electron diffraction patterns show that the shell is composed of the hydroxyapatite and the core is composed of the Co-ferrite, CoFe 2 O 4 . Electron spin resonance measurements indicate that the Co 2+ ions are being substituted into the Ca(1) sites in HAP lattice. X-ray diffraction studies show the formation of impurity phases as higher amounts of the Fe 3+ /Co 2+ ions which are substituted into the HAP host matrix. The presence of two sextets (one for the A-site Fe 3+ and the other for the B-site Fe 3+ ) in the Moessbauer spectrum for all the doped samples clearly indicates that the CoFe 2 O 4 .cores are in the ferromagnetic state. Evidence of the impurity phases is seen in the appearance of doublet patterns in the Moessbauer spectrums for the heavier-doped (x=0.4 and 0.5) specimens. The decrease in the saturation magnetizations and other magnetic properties of the nanoparticles at the higher doping levels is consistent with some of the Fe 3+ and Co 2+ which being used to form the CoO and Fe 2 O 3 impurity phase seen in the XRD patterns.

  18. THE ANGULAR MOMENTUM OF MAGNETIZED MOLECULAR CLOUD CORES: A TWO-DIMENSIONAL-THREE-DIMENSIONAL COMPARISON

    International Nuclear Information System (INIS)

    Dib, Sami; Csengeri, Timea; Audit, Edouard; Hennebelle, Patrick; Pineda, Jaime E.; Goodman, Alyssa A.; Bontemps, Sylvain

    2010-01-01

    In this work, we present a detailed study of the rotational properties of magnetized and self-gravitating dense molecular cloud (MC) cores formed in a set of two very high resolution three-dimensional (3D) MC simulations with decaying turbulence. The simulations have been performed using the adaptative mesh refinement code RAMSES with an effective resolution of 4096 3 grid cells. One simulation represents a mildly magnetically supercritical cloud and the other a strongly magnetically supercritical cloud. We identify dense cores at a number of selected epochs in the simulations at two density thresholds which roughly mimic the excitation densities of the NH 3 (J - K) = (1,1) transition and the N 2 H + (1-0) emission line. A noticeable global difference between the two simulations is the core formation efficiency (CFE) of the high-density cores. In the strongly supercritical simulations, the CFE is 33% per unit free-fall time of the cloud (t ff,cl ), whereas in the mildly supercritical simulations this value goes down to ∼6 per unit t ff,cl . A comparison of the intrinsic specific angular momentum (j 3D ) distributions of the cores with the specific angular momentum derived using synthetic two-dimensional (2D) velocity maps of the cores (j 2D ) shows that the synthetic observations tend to overestimate the true value of the specific angular momentum by a factor of ∼8-10. We find that the distribution of the ratio j 3D /j 2D of the cores peaks at around ∼0.1. The origin of this discrepancy lies in the fact that contrary to the intrinsic determination of j which sums up the individual gas parcels' contributions to the angular momentum, the determination of the specific angular momentum using the standard observational procedure which is based on a measurement on the global velocity gradient under the hypothesis of uniform rotation smoothes out the complex fluctuations present in the 3D velocity field. Our results may well provide a natural explanation for the

  19. Quench detection of superconducting magnet by dual-core optical fiber

    International Nuclear Information System (INIS)

    Tsukamoto, O.; Kawai, K.; Kokubun, Y.; Takao, T.

    1988-01-01

    A quench-detecting technique using two single-mode optical cores in one fiber has been developed. The technique can detect quench from a temperature rise of 1.0 K at 4.2 K. An electromagnetic force-stress to the fiber did not deteriorate quench detection sensitivity. A quench detector using this method was immune from electromagnetic noise and free from troubles caused by high voltage tension. Problems arising when applying this method to a large scale magnet and possible improvements in the instrumentation are discussed

  20. Industrialization of nanocrystalline Fe–Si–B–P–Cu alloys for high magnetic flux density cores

    International Nuclear Information System (INIS)

    Takenaka, Kana; Setyawan, Albertus D.; Sharma, Parmanand; Nishiyama, Nobuyuki; Makino, Akihiro

    2016-01-01

    Nanocrystalline Fe–Si–B–P–Cu alloys exhibit high saturation magnetic flux density (B s ) and extremely low magnetic core loss (W), simultaneously. Low amorphous-forming ability of these alloys hinders their application potential in power transformers and motors. Here we report a solution to this problem. Minor addition of C is found to be effective in increasing the amorphous-forming ability of Fe–Si–B–P–Cu alloys. It allows fabrication of 120 mm wide ribbons (which was limited to less than 40 mm) without noticeable degradation in magnetic properties. The nanocrystalline (Fe 85.7 Si 0.5 B 9.5 P 3.5 Cu 0.8 ) 99 C 1 ribbons exhibit low coercivity (H c )~4.5 A/m, high B s ~1.83 T and low W~0.27 W/kg (@ 1.5 T and 50 Hz). Success in fabrication of long (60–100 m) and wide (~120 mm) ribbons, which are made up of low cost elements is promising for mass production of energy efficient high power transformers and motors - Highlights: • Minor addition of C in FeSiBPCu alloy increases amorphous-forming ability. • The FeSiBPCuC alloy exhibits B s close to Si-steel and Core loss lower than it. • Excellent soft magnetic properties were obtained for 120 mm wide ribbons. • Nanocrystalline FeSiBPCuC alloy can be produced at industrial scale with low cost. • The alloy is suitable for making low energy loss power transformers and motors.

  1. DYNAMICS OF MULTI-CORED MAGNETIC STRUCTURES IN THE QUIET SUN

    International Nuclear Information System (INIS)

    Requerey, Iker S.; Iniesta, Jose Carlos Del Toro; Rubio, Luis R. Bellot; Pillet, Valentín Martínez; Solanki, Sami K.; Schmidt, Wolfgang

    2015-01-01

    We report on the dynamical interaction of quiet-Sun magnetic fields and granular convection in the solar photosphere as seen by Sunrise. We use high spatial resolution (0.″15–0.″18) and temporal cadence (33 s) spectropolarimetric Imaging Magnetograph eXperiment data, together with simultaneous CN and Ca ii H filtergrams from Sunrise Filter Imager. We apply the SIR inversion code to the polarimetric data in order to infer the line of sight velocity and vector magnetic field in the photosphere. The analysis reveals bundles of individual flux tubes evolving as a single entity during the entire 23 minute data set. The group shares a common canopy in the upper photospheric layers, while the individual tubes continually intensify, fragment and merge in the same way that chains of bright points in photometric observations have been reported to do. The evolution of the tube cores are driven by the local granular convection flows. They intensify when they are “compressed” by surrounding granules and split when they are “squeezed” between two moving granules. The resulting fragments are usually later regrouped in intergranular lanes by the granular flows. The continual intensification, fragmentation and coalescence of flux results in magnetic field oscillations of the global entity. From the observations we conclude that the magnetic field oscillations first reported by Martínez González et al. correspond to the forcing by granular motions and not to characteristic oscillatory modes of thin flux tubes

  2. Synthesis and characterization of magnetic and non-magnetic core-shell polyepoxide micrometer-sized particles of narrow size distribution.

    Science.gov (United States)

    Omer-Mizrahi, Melany; Margel, Shlomo

    2009-01-15

    Core polystyrene microspheres of narrow size distribution were prepared by dispersion polymerization of styrene in a mixture of ethanol and 2-methoxy ethanol. Uniform polyglycidyl methacrylate/polystyrene core-shell micrometer-sized particles were prepared by emulsion polymerization at 73 degrees C of glycidyl methacrylate in the presence of the core polystyrene microspheres. Core-shell particles with different properties (size, surface morphology and composition) have been prepared by changing various parameters belonging to the above seeded emulsion polymerization process, e.g., volumes of the monomer glycidyl methacrylate and the crosslinker monomer ethylene glycol dimethacrylate. Magnetic Fe(3)O(4)/polyglycidyl methacrylate/polystyrene micrometer-sized particles were prepared by coating the former core-shell particles with magnetite nanoparticles via a nucleation and growth mechanism. Characterization of the various particles has been accomplished by routine methods such as light microscopy, SEM, FTIR, BET and magnetic measurements.

  3. Crystallization kinetics and magnetic properties of FeSiCr amorphous alloy powder cores

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Hu-ping [School of Logistics Engineering, Wuhan University of Technology, Wuhan 430063 (China); Wang, Ru-wu, E-mail: ruwuwang@hotmail.com [National Engineering Research Center For Silicon Steel, Wuhan 430080 (China); College of Materials Science and Metallurgical Engineering, Wuhan University of Science and Technology, Wuhan 430081 (China); Wei, Ding [School of Optical and Electronic Information, Huazhong University of Science and Technology, Wuhan 430074 (China); Zeng, Chun [National Engineering Research Center For Silicon Steel, Wuhan 430080 (China)

    2015-07-01

    The crystallization kinetics of FeSiCr amorphous alloy, characterized by the crystallization activation energy, Avrami exponent and frequency factor, was studied by non-isothermal differential scanning calorimetric (DSC) measurements. The crystallization activation energy and frequency factor of amorphous alloy calculated from Augis–Bennett model were 476 kJ/mol and 5.5×10{sup 18} s{sup −1}, respectively. The Avrami exponent n was calculated to be 2.2 from the Johnson–Mehl–Avrami (JMA) equation. Toroid-shaped Fe-base amorphous powder cores were prepared from the commercial FeSiCr amorphous alloy powder and subsequent cold pressing using binder and insulation. The characteristics of FeSiCr amorphous alloy powder and the effects of compaction pressure and insulation content on the magnetic properties, i.e., effective permeability μ{sub e}, quality factor Q and DC-bias properties of FeSiCr amorphous alloy powder cores, were investigated. The FeSiCr amorphous alloy powder cores exhibit a high value of quality factor and a stable permeability in the frequency range up to 1 MHz, showing superior DC-bias properties with a “percent permeability” of more than 82% at H=100 Oe. - Highlights: • The crystallization kinetics of FeSiCr amorphous alloy was investigated. • The FeSiCr powder cores exhibit a high value of Q and a stable permeability. • The FeSiCr powder cores exhibit superior DC-bias properties.

  4. Large-scale fluid motion in the earth's outer core estimated from non-dipole magnetic field data

    International Nuclear Information System (INIS)

    Matsushima, Masaki; Honkura, Yoshimori

    1989-01-01

    Fluid motions in the Earth's outer core can be estimated from magnetic field data at the Earth's surface based on some assumptions. The basic standpoint here is that the non-dipole magnetic field is generated by the interaction between a strong toroidal magnetic field, created by differential rotation, and the convective motion in the outer core. Large-scale convective motions are studied to express them in terms of the poloidal velocity field expanded into a series of spherical harmonics. The radial distribution of differential rotation is estimated from the balance between the effective couple due to angular momentum transfer and the electromagnetic couple. Then the radial dependence of the toroidal magnetic field is derived from the interaction between the differential rotation thus estimated and the dipole magnetic field within the outer core. Magnetic field data are applied to a secular variation model which takes into account the fluctuations of the standing and drifting parts of the non-zonal magnetic field. The velocity field in the outer core is estimated for two cases. It is revealed that the pattern of convective motions is generally characterized by large-scale motions in the quasi-steady case. In the non-steady case, the magnitude of the velocity field is much larger, indicating a more dynamic feature. (N.K.)

  5. A DETERMINATION OF THE FLUX DENSITY IN CORE OF DISTRIBUTION TRANSFORMERS, WHAT BUILT WITH THE COMMON USING OF GRAIN AND NON GRAIN ORIENTED MAGNETIC STEELS

    Directory of Open Access Journals (Sweden)

    I.V. Pentegov

    2015-12-01

    Full Text Available Purpose. The development of calculation method to determinate the flux densities in different parts of the magnetic cores of distribution transformers, what built from different types magnetic steel (mixed core. Methodology. The method is based on the scientific positions of Theoretical Electrical Engineering – the theory of the electromagnetic field in nonlinear mediums to determine the distribution of magnetic flux in mixed core of transformer, what are using different types of steel what have the different magnetic properties. Results. The developed method gives possible to make calculation of the flux density and influence of skin effect in different parts of the magnetic cores of distribution transformer, where are used mix of grain oriented (GO and non grain oriented (NGO steels. Was determinate the general basic conditions for the calculation of flux density in the laminations from grain and non grain oriented steels of the magnetic core: the strength of magnetic field for the laminations of particular part of mixed core is the same; the sum of the magnetic fluxes in GO and NGO steels in particular part of mixed core is equal with the designed magnetic flux in this part of mixed core. Discover, the magnetic flux in mixed core of the transformer has specific distribution between magnetic steels. The flux density is higher in laminations from GO steel and smaller in laminations from the NGO steel. That is happened because for magnetic flux is easier pass through laminations from GO steel, what has better magnetic conductance than laminations from NGO steel. Originality. The common using of different types of magnetic steels in cores for distribution transformers gives possibility to make design of transformer with low level of no load losses, high efficiency and with optimal cost. Practical value. The determination of the flux density in different parts of magnetic core with GO and NGO steels gives possibility make accurate calculation of

  6. Magnetic characterization of the stator core of a high-speed motor made of an ultrathin electrical steel sheet using the magnetic property evaluation system

    Directory of Open Access Journals (Sweden)

    Mohachiro Oka

    2018-04-01

    Full Text Available Recently, the application areas for electric motors have been expanding. For instance, electric motors are used in new technologies such as rovers, drones, cars, and robots. The motor used in such machinery should be small, high-powered, highly-efficient, and high-speed. In such motors, loss at high-speed rotation must be especially minimal. Eddy-current loss in the stator core is known to increase greatly during loss at high-speed rotation of the motor. To produce an efficient high-speed motor, we are developing a stator core for a motor using an ultrathin electrical steel sheet with only a small amount of eddy-current loss. Furthermore, the magnetic property evaluation for efficient, high-speed motor stator cores that use conventional commercial frequency is insufficient. Thus, we made a new high-speed magnetic property evaluation system to evaluate the magnetic properties of the efficient high-speed motor stator core. This system was composed of high-speed A/D converters, D/A converters, and a high-speed power amplifier. In experiments, the ultrathin electrical steel sheet dramatically suppressed iron loss and, in particular, eddy-current loss. In addition, a new high-speed magnetic property evaluation system accurately evaluated the magnetic properties of the efficient high-speed motor stator core.

  7. Magnetic characterization of the stator core of a high-speed motor made of an ultrathin electrical steel sheet using the magnetic property evaluation system

    Science.gov (United States)

    Oka, Mohachiro; Enokizono, Masato; Mori, Yuji; Yamazaki, Kazumasa

    2018-04-01

    Recently, the application areas for electric motors have been expanding. For instance, electric motors are used in new technologies such as rovers, drones, cars, and robots. The motor used in such machinery should be small, high-powered, highly-efficient, and high-speed. In such motors, loss at high-speed rotation must be especially minimal. Eddy-current loss in the stator core is known to increase greatly during loss at high-speed rotation of the motor. To produce an efficient high-speed motor, we are developing a stator core for a motor using an ultrathin electrical steel sheet with only a small amount of eddy-current loss. Furthermore, the magnetic property evaluation for efficient, high-speed motor stator cores that use conventional commercial frequency is insufficient. Thus, we made a new high-speed magnetic property evaluation system to evaluate the magnetic properties of the efficient high-speed motor stator core. This system was composed of high-speed A/D converters, D/A converters, and a high-speed power amplifier. In experiments, the ultrathin electrical steel sheet dramatically suppressed iron loss and, in particular, eddy-current loss. In addition, a new high-speed magnetic property evaluation system accurately evaluated the magnetic properties of the efficient high-speed motor stator core.

  8. Carboxymethyl chitosan-modified magnetic-cored dendrimer as an amphoteric adsorbent

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hye-Ran [Department of Civil and Environmental Engineering, Hanyang University, 222 Wangsimni-ro, Seongdong-gu, Seoul 133-791 (Korea, Republic of); Jang, Jun-Won [Pohang Institute of Metal Industry Advancement, 56 Jigok-ro, Nam-gu, Pohang-si, Gyeongsangbuk-do 790-834 (Korea, Republic of); Park, Jae-Woo, E-mail: jaewoopark@hanyang.ac.kr [Department of Civil and Environmental Engineering, Hanyang University, 222 Wangsimni-ro, Seongdong-gu, Seoul 133-791 (Korea, Republic of)

    2016-11-05

    Highlights: • Carboxymethyl chitosan was attached to magnetic-cored dendrimer as terminal groups. • High sorptive capacity of carboxymethyl chitosan is added to dendritic structure. • This new adsorbent can be easily separated from water with magnetic force. • It could be reused as an adsorbent more than five-times with simple pH adjustment. - Abstract: Carboxymethyl chitosan-modified magnetic-cored dendrimers (CCMDs) were successfully synthesized in a three step method. The synthesized samples were characterized using X-ray diffraction, transmission electron microscopy, scanning electron microscopy, vibrating sample magnetometer, thermogravimetry analysis, zeta potential analyzer, X-ray photoelectron spectroscopy, surface area analysis, and Fourier transform infrared spectroscopy. The CCMD exhibited selective adsorption for anionic and cationic compounds at specific pH conditions. With the substitution of amino groups of MD with carboxymethyl chitosan moieties, the adsorption sites for cationic compounds were greatly increased. Since the adsorption onto CCMD was mainly electrostatic interaction, the adsorption of MB and MO was significantly affected by the pHs. The optimal adsorption pH values were 3 and 11 for MO and MB. The maximal adsorption of MO and MB on the CCMD at pH values of 3 and 11 were 20.85 mg g{sup −1} and 96.31 mg g{sup −1}, respectively. Reuse of the CCMD as an adsorbent was experimentally tested through adsorption and desorption with simple pH control. More than 99% and 91% of the initial adsorption of MB and MO on the CCMD was maintained with five consecutive recycling.

  9. Outstanding efficiency in energy conversion for electric motors constructed by nanocrystalline soft magnetic alloy “NANOMET®” cores

    Directory of Open Access Journals (Sweden)

    N. Nishiyama

    2016-05-01

    Full Text Available Recently updated nanocrystalline soft magnetic Fe-Co-Si-B-P-Cu alloys “NANOMET®” exhibit high saturation magnetic flux density (Bs > 1.8 T, low coercivity (Hc < 10 A/m and low core loss (W1.7/50 ∼ 0.4 W/kg even in a ribbon form with a thickness of up to 40 μm. By utilize excellent magnetic softness, several products such as motors or transformers for electrical appliances are now under developing by industry-academia collaboration. In particular, it is found that a brushless DC motor using NANOMET® core exhibited remarkable improvement in energy consumption. The prototype motor with an outer core diameter of 70 mm and a core thickness of 50 mm was constructed using laminated nano-crystallized NANOMET® ribbons. Core-loss for the constructed motor was improved from 1.4 W to 0.4 W only by replacing the non-oriented Si-steel core with NANOMET® one. The overall motor efficiency is evaluated to be 3% improvement. In this work, the relation between processing and resulting magnetic properties will be presented. In addition, feasibility for commercialization will also be discussed.

  10. ORR core re-configuration measurements to increase the fast neutron flux in the Magnetic Fusion Energy (MFE) experiments

    International Nuclear Information System (INIS)

    Hobbs, R.W.; Stinnett, R.M.; Sims, T.M.

    1985-06-01

    A study has been made of the relative increases obtainable in the fast neutron flux in the Magnetic Fusion Energy (MFE) experiment positions by reconfiguring the current ORR core. The study was made at the request of the MFE program to examine the percentage increase possible in the current displacement per atom (dpa) rate (assumed proportional to the fast flux). The principle methods investigated to increase the fast flux consisted of reducing the current core size (number of fuel elements) to increase the core average power density and arrangement of the fuel elements in the reduced-size core to tilt the core power distribution towards the MFE positions. The study concluded that fast fluxes in the E-3 core position could be increased by approximately 15 to 20% over current values and in E-5 by approximately 45 to 55%

  11. Third-generation site characterization: Cryogenic core collection, nuclear magnetic resonance, and electrical resistivity

    Science.gov (United States)

    Kiaalhosseini, Saeed

    In modern contaminant hydrology, management of contaminated sites requires a holistic characterization of subsurface conditions. Delineation of contaminant distribution in all phases (i.e., aqueous, non-aqueous liquid, sorbed, and gas), as well as associated biogeochemical processes in a complex heterogeneous subsurface, is central to selecting effective remedies. Arguably, a factor contributing to the lack of success of managing contaminated sites effectively has been the limitations of site characterization methods that rely on monitoring wells and grab sediment samples. The overarching objective of this research is to advance a set of third-generation (3G) site characterization methods to overcome shortcomings of current site characterization techniques. 3G methods include 1) cryogenic core collection (C3) from unconsolidated geological subsurface to improve recovery of sediments and preserving key attributes, 2) high-throughput analysis (HTA) of frozen core in the laboratory to provide high-resolution, depth discrete data of subsurface conditions and processes, 3) resolution of non-aqueous phase liquid (NAPL) distribution within the porous media using a nuclear magnetic resonance (NMR) method, and 4) application of a complex resistivity method to track NAPL depletion in shallow geological formation over time. A series of controlled experiments were conducted to develop the C 3 tools and methods. The critical aspects of C3 are downhole circulation of liquid nitrogen via a cooling system, the strategic use of thermal insulation to focus cooling into the core, and the use of back pressure to optimize cooling. The C3 methods were applied at two contaminated sites: 1) F.E. Warren (FEW) Air Force Base near Cheyenne, WY and 2) a former refinery in the western U.S. The results indicated that the rate of core collection using the C3 methods is on the order of 30 foot/day. The C3 methods also improve core recovery and limits potential biases associated with flowing sands

  12. Short-Range Correlated Magnetic Core-Shell CrO2/Cr2O3 Nanorods: Experimental Observations and Theoretical Considerations

    Directory of Open Access Journals (Sweden)

    Ashish C. Gandhi

    2018-05-01

    Full Text Available With the evolution of synthesis and the critical characterization of core-shell nanostructures, short-range magnetic correlation is of prime interest in employing their properties to develop novel devices and widespread applications. In this regard, a novel approach of the magnetic core-shell saturated magnetization (CSSM cylinder model solely based on the contribution of saturated magnetization in one-dimensional CrO2/Cr2O3 core-shell nanorods (NRs has been developed and applied for the determination of core-diameter and shell-thickness. The nanosized effect leads to a short-range magnetic correlation of ferromagnetic core-CrO2 extracted from CSSM, which can be explained using finite size scaling method. The outcome of this study is important in terms of utilizing magnetic properties for the critical characterization of core-shell nanomagnetic materials.

  13. Exchange biased Co3O4 nanowires: A new insight into its magnetic core-shell nature

    Science.gov (United States)

    Thomas, S.; Jose, A.; Thanveer, T.; Anantharaman, M. R.

    2017-06-01

    We investigated interfacial exchange coupling effect in nano casted Co3O4 nanowires. Magnetometry measurements indicated that the magnetic response of the wires has two contributions. First one from the core of the wire which has characteristics of a 2D-DAFF(two-dimensional diluted antiferromagnet in a field). The second one is from uncompensated surface spins which get magnetically ordered towards the field direction once field cooled below 25 K. Below 25 K, the net magnetization of the core of the wire gets exchange coupled with the uncompensated surface spins giving rise to exchange bias effect. The unique 2D-DAFF/spin-glass core/shell heterostructure showed a pronounced training effect in the first field cycling itself. The magnitude of exchange bias field showed a maximum at intermediate cooling fields and for the higher cooling field, exchange bias got reduced.

  14. Reduction of core loss in non-oriented (NO) electrical steel by electroless-plated magnetic coating

    International Nuclear Information System (INIS)

    Chivavibul, Pornthep; Enoki, Manabu; Konda, Shigeru; Inada, Yasushi; Tomizawa, Tamotsu; Toda, Akira

    2011-01-01

    An important issue in development of electrical steels for core-laminated products is to reduce core loss to improve energy conversion efficiency. This is usually obtained by tailoring the composition, microstructure, and texture of electrical steels themselves. A new technique to reduce core loss in electrical steel has been investigated. This technique involves electroless plating of magnetic thin coating onto the surface of electrical steel. The material system was electroless Ni-Co-P coatings with different thicknesses (1, 5, and 10 μm) deposited onto the surface of commercially available Fe-3% Si electrical steel. Characterization of deposited Ni-Co-P coating was carried out using X-ray diffraction (XRD), scanning electron microscope (SEM), and energy dispersive X-ray (EDX) spectrometer. The deposited Ni-Co-P coatings were amorphous and composed of 56-59% Ni, 32-35% Co, and 8-10% P by mass. The effect of coatings on core loss of the electrical steel was determined using single sheet test. A core loss reduction of 4% maximum was achieved with the Ni-Co-P coating of 1 μm thickness at 400 Hz and 0.3 T. - Research Highlights: → New approach to reduce core loss of electrical steel by magnetic coating. → Ni-Co-P coating influences core loss of NO electrical steel. → Core loss increases in RD direction but reduces in TD direction.

  15. Fabrication of solenoid-type inductor with electroplated NiFe magnetic core

    International Nuclear Information System (INIS)

    Gao Xiaoyu; Cao Ying; Zhou Yong; Ding Wen; Lei Chong; Chen Jian

    2006-01-01

    Solenoid-type inductor with ultra-low profile was fabricated by MEMS (Microelectromechanical systems) technique. NiFe film was electroplated as the magnetic core, and polyimide with a low relative permittivity was used as the insulation material. In the fabrication process, UV-LIGA, dry etching, fine polishing and electroplating technique have been adopted to achieve high performance of the solenoid-type inductor. The inductor was in size of 1.5 mmx0.9 mmx0.1 mm with coil width of 20 μm and aspect ratio of 5:1. The inductance and the quality factor were 0.42-0.345 μH and 1.8-5.3 in the frequency range of 1-10 MHz, respectively

  16. The Role of Magnetic Resonance Imaging in Athletic Pubalgia and Core Muscle Injury.

    Science.gov (United States)

    Coker, Dana J; Zoga, Adam C

    2015-08-01

    Magnetic resonance imaging (MRI) has become the standard of care imaging modality for a difficult, often misunderstood spectrum of musculoskeletal injury termed athletic pubalgia or core muscle injury. Armed with a dedicated noncontrast athletic pubalgia protocol and a late model phased array receiver coil, the musculoskeletal imager can play a great role in effective diagnosis and treatment planning for lesions, including osteitis pubis, midline pubic plate lesions, and rectus abdominis/adductor aponeurosis injury. Beyond these established patterns of MRI findings, there are many confounders and contributing pathologies about the pelvis in patients with activity related groin pain, including internal and periarticular derangements of the hip. The MRI is ideally suited to delineate the extent of expected injury and to identify the unexpected visceral and musculoskeletal lesions.

  17. Analytical Expression of Equivalent Transverse Magnetic Permeability for Three-core Wire Armoured Submarine Cables

    DEFF Research Database (Denmark)

    Viafora, Nicola; Baù, Matteo; Dall, Laurits Bergholdt

    2016-01-01

    As three-core wire-armoured submarine cables become progressively more relevant, the need for refined modelling techniques grows likewise. IEC Standard 60287 indications though are still widely recognized to be insufficiently accurate, since several effects due to the presence of the collective...... wire armour are ignored. This paper therefore offers an insight into the induced losses mechanism as a function of the armour wires electromagnetic properties. The analysis is focused on the influence of the armour transverse permeability, whose overall resultant value is estimated by means...... the induced sheath power losses due to the presence of the armour, whereas the proposed approach improves the accuracy, as the magnetic flux density enhancement within the cable is accounted for....

  18. Magnetized Converging Flows toward the Hot Core in the Intermediate/High-mass Star-forming Region NGC 6334 V

    Energy Technology Data Exchange (ETDEWEB)

    Juárez, Carmen; Girart, Josep M. [Institut de Ciències de l’Espai, (CSIC-IEEC), Campus UAB, Carrer de Can Magrans, S/N, E-08193 Cerdanyola del Vallès, Catalonia (Spain); Zamora-Avilés, Manuel; Palau, Aina; Ballesteros-Paredes, Javier [Instituto de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, P.O. Box 3-72, 58090, Morelia, Michoacán (Mexico); Tang, Ya-Wen; Koch, Patrick M.; Liu, Hauyu Baobab [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei, 10617, Taiwan (China); Zhang, Qizhou [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Qiu, Keping, E-mail: juarez@ice.cat [School of Astronomy and Space Science, Nanjing University, 163 Xianlin Avenue, Nanjing 210023 (China)

    2017-07-20

    We present Submillimeter Array (SMA) observations at 345 GHz toward the intermediate/high-mass cluster-forming region NGC 6334 V. From the dust emission we spatially resolve three dense condensations, the brightest one presenting the typical chemistry of a hot core. The magnetic field (derived from the dust polarized emission) shows a bimodal converging pattern toward the hot core. The molecular emission traces two filamentary structures at two different velocities, separated by 2 km s{sup −1}, converging to the hot core and following the magnetic field distribution. We compare the velocity field and the magnetic field derived from the SMA observations with magnetohydrodynamic simulations of star-forming regions dominated by gravity. This comparison allows us to show how the gas falls in from the larger-scale extended dense core (∼0.1 pc) of NGC 6334 V toward the higher-density hot core region (∼0.02 pc) through two distinctive converging flows dragging the magnetic field, whose strength seems to have been overcome by gravity.

  19. Magnetized Converging Flows toward the Hot Core in the Intermediate/High-mass Star-forming Region NGC 6334 V

    International Nuclear Information System (INIS)

    Juárez, Carmen; Girart, Josep M.; Zamora-Avilés, Manuel; Palau, Aina; Ballesteros-Paredes, Javier; Tang, Ya-Wen; Koch, Patrick M.; Liu, Hauyu Baobab; Zhang, Qizhou; Qiu, Keping

    2017-01-01

    We present Submillimeter Array (SMA) observations at 345 GHz toward the intermediate/high-mass cluster-forming region NGC 6334 V. From the dust emission we spatially resolve three dense condensations, the brightest one presenting the typical chemistry of a hot core. The magnetic field (derived from the dust polarized emission) shows a bimodal converging pattern toward the hot core. The molecular emission traces two filamentary structures at two different velocities, separated by 2 km s −1 , converging to the hot core and following the magnetic field distribution. We compare the velocity field and the magnetic field derived from the SMA observations with magnetohydrodynamic simulations of star-forming regions dominated by gravity. This comparison allows us to show how the gas falls in from the larger-scale extended dense core (∼0.1 pc) of NGC 6334 V toward the higher-density hot core region (∼0.02 pc) through two distinctive converging flows dragging the magnetic field, whose strength seems to have been overcome by gravity.

  20. Plasma-assisted synthesis and study of structural and magnetic properties of Fe/C core shell

    Science.gov (United States)

    Shinde, K. P.; Ranot, M.; Choi, C. J.; Kim, H. S.; Chung, K. C.

    2017-07-01

    Pure and carbon-encapsulated iron nanoparticles with an average diameter of 25 nm were synthesized by using the DC plasma arc discharge method. Fe core nanoparticles were encapsulated with carbon layer, which is acting as protection layer against both oxidation and chemical reaction. The morphology and the Fe/C core/shell structure of the nanoparticles were studied by using field emission scanning electron microscopy and transmission electron microscopy. The x-ray diffraction study showed that the α-Fe phase exists with γ-Fe as an impurity. The studied samples have been interrelated with the variation of saturation magnetization, remanent magnetization and coercive field with the amount of carbon coating. The pure α-Fe sample shows saturation magnetization = 172 emu/g, and coercive field = 150 Oe, on the other hand few layer carbon coated α-Fe sample shows saturation magnetization =169 emu/g with higher coercive field 398 Oe.

  1. Plasma-assisted synthesis and study of structural and magnetic properties of Fe/C core shell

    Directory of Open Access Journals (Sweden)

    K. P. Shinde

    2017-07-01

    Full Text Available Pure and carbon-encapsulated iron nanoparticles with an average diameter of 25 nm were synthesized by using the DC plasma arc discharge method. Fe core nanoparticles were encapsulated with carbon layer, which is acting as protection layer against both oxidation and chemical reaction. The morphology and the Fe/C core/shell structure of the nanoparticles were studied by using field emission scanning electron microscopy and transmission electron microscopy. The x-ray diffraction study showed that the α-Fe phase exists with γ-Fe as an impurity. The studied samples have been interrelated with the variation of saturation magnetization, remanent magnetization and coercive field with the amount of carbon coating. The pure α-Fe sample shows saturation magnetization = 172 emu/g, and coercive field = 150 Oe, on the other hand few layer carbon coated α-Fe sample shows saturation magnetization =169 emu/g with higher coercive field 398 Oe.

  2. COLLAPSE AND FRAGMENTATION OF MAGNETIC MOLECULAR CLOUD CORES WITH THE ENZO AMR MHD CODE. I. UNIFORM DENSITY SPHERES

    International Nuclear Information System (INIS)

    Boss, Alan P.; Keiser, Sandra A.

    2013-01-01

    Magnetic fields are important contributors to the dynamics of collapsing molecular cloud cores, and can have a major effect on whether collapse results in a single protostar or fragmentation into a binary or multiple protostar system. New models are presented of the collapse of magnetic cloud cores using the adaptive mesh refinement code Enzo2.0. The code was used to calculate the ideal magnetohydrodynamics (MHD) of initially spherical, uniform density, and rotation clouds with density perturbations, i.e., the Boss and Bodenheimer standard isothermal test case for three-dimensional (3D) hydrodynamics codes. After first verifying that Enzo reproduces the binary fragmentation expected for the non-magnetic test case, a large set of models was computed with varied initial magnetic field strengths and directions with respect to the cloud core axis of rotation (parallel or perpendicular), density perturbation amplitudes, and equations of state. Three significantly different outcomes resulted: (1) contraction without sustained collapse, forming a denser cloud core; (2) collapse to form a single protostar with significant spiral arms; and (3) collapse and fragmentation into binary or multiple protostar systems, with multiple spiral arms. Comparisons are also made with previous MHD calculations of similar clouds with a barotropic equations of state. These results for the collapse of initially uniform density spheres illustrate the central importance of both magnetic field direction and field strength for determining the outcome of dynamic protostellar collapse.

  3. Magnetic resonance imaging criteria of successful core decompression in avascular necrosis of the hip

    Energy Technology Data Exchange (ETDEWEB)

    Radke, S.; Kirschner, S.; Seipel, V.; Rader, C.; Eulert, J. [Department of Orthopaedic Surgery, Koenig-Ludwig-Haus, Julius-Maximilians University, Wuerzburg, Brettreichstr.11, 97074, Wuerzburg (Germany)

    2004-09-01

    To identify imaging criteria that determine the outcome of core decompression (CD) in femoral-head avascular necrosis (AVN). Radiographs and magnetic resonance imaging (MRI) of 65 hips with early stage AVN treated by core decompression between January 1990 and December 2000 for AVN were reviewed. All hips were categorized into two groups according to the result of CD using total hip arthroplasty (THA) as an end point. Hips that had no THA at follow-up were allocated to group I; those treated with a THA were allocated to group II. CD results were calculated for each group using THA as an end point. The parameters analyzed were the presence or absence of edema associated with the double-line sign on the preoperative MRI, the type of epiphyseal scar (ES) according to Jing, and the type of necrosis according to Mitchell. On follow-up, 45 hips had no THA (group I); 20 patients had a THA (group II). Patients with a radiographic crescent sign and those with edema associated with the double-line sign progressed to THA significantly more frequently. The extent of the necrosis had less discriminatory effect between the two groups. ES and necrotic tissue types had no prognostic value. In regard to the success of CD, it is important to differentiate on MRI between a double line sign plus bone marrow edema and a double-line sign only. (orig.)

  4. Magnetic resonance imaging criteria of successful core decompression in avascular necrosis of the hip

    International Nuclear Information System (INIS)

    Radke, S.; Kirschner, S.; Seipel, V.; Rader, C.; Eulert, J.

    2004-01-01

    To identify imaging criteria that determine the outcome of core decompression (CD) in femoral-head avascular necrosis (AVN). Radiographs and magnetic resonance imaging (MRI) of 65 hips with early stage AVN treated by core decompression between January 1990 and December 2000 for AVN were reviewed. All hips were categorized into two groups according to the result of CD using total hip arthroplasty (THA) as an end point. Hips that had no THA at follow-up were allocated to group I; those treated with a THA were allocated to group II. CD results were calculated for each group using THA as an end point. The parameters analyzed were the presence or absence of edema associated with the double-line sign on the preoperative MRI, the type of epiphyseal scar (ES) according to Jing, and the type of necrosis according to Mitchell. On follow-up, 45 hips had no THA (group I); 20 patients had a THA (group II). Patients with a radiographic crescent sign and those with edema associated with the double-line sign progressed to THA significantly more frequently. The extent of the necrosis had less discriminatory effect between the two groups. ES and necrotic tissue types had no prognostic value. In regard to the success of CD, it is important to differentiate on MRI between a double line sign plus bone marrow edema and a double-line sign only. (orig.)

  5. Large enhanced dielectric permittivity in polyaniline passivated core-shell nano magnetic iron oxide by plasma polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Joy, Lija K.; Sooraj, V.; Sethulakshmi, N.; Anantharaman, M. R., E-mail: mraiyer@yahoo.com [Department of Physics, Cochin University of Science and Technology, Cochin-682022, Kerala (India); Sajeev, U. S. [Department of Physics, Government College, Kottayam-686613, Kerala (India); Nair, Swapna S. [Department of Physics, School of Mathematical and Physical Sciences, Central University of Kerala, Kasargode-671123, Kerala (India); Narayanan, T. N. [CSIR-Central Electrochemical Research Institute, Karaikkudi-630006, Tamil Nadu (India); Ajayan, P. M. [Department of Material Science and Nano Engineering, Rice University, 6100 Main Street, Houston, Texas 7700 (United States)

    2014-03-24

    Commercial samples of Magnetite with size ranging from 25–30 nm were coated with polyaniline by using radio frequency plasma polymerization to achieve a core shell structure of magnetic nanoparticle (core)–Polyaniline (shell). High resolution transmission electron microscopy images confirm the core shell architecture of polyaniline coated iron oxide. The dielectric properties of the material were studied before and after plasma treatment. The polymer coated magnetite particles exhibited a large dielectric permittivity with respect to uncoated samples. The dielectric behavior was modeled using a Maxwell–Wagner capacitor model. A plausible mechanism for the enhancement of dielectric permittivity is proposed.

  6. HEDO-2, Magnetic Field Calculation and Plot of Air Core Coils

    International Nuclear Information System (INIS)

    Preis, H.; Martin, P.

    1979-01-01

    1 - Nature of physical problem solved: HEDO-2 allows calculation of the magnetic field, magnetic volume forces, and the self and mutual inductance coefficients of arbitrary air-core coil systems. In addition, the program is suitable for the calculation and graphic representation of field and contour lines (lines B = const). 2 - Method of solution: Approximation of the spatially distributed currents by line currents, in which the number of closed line currents per coil can be freely chosen in accordance with the calculating accuracy required. All types of calculations possible with HEDO-2 are based on the field representation of line currents. 3 - Restrictions on the complexity of the problem: (a) The coils must have rectangular winding cross sections. (b) The contour of each coil must be symmetric to at least one coordinate axis. (c) The function describing the contour and the derivative of the function must be continuous. (d) Maximum number of coils n=200; (e) Maximum number of test points p=2000; (f) Test points ought not to be located on a line conductor

  7. Paleomagnetism and environmental magnetism of GLAD800 sediment cores from Bear Lake, Utah and Idaho

    Science.gov (United States)

    Heil, C.W.; King, J.W.; Rosenbaum, J.G.; Reynolds, R.L.; Colman, Steven M.

    2009-01-01

    A ???220,000-year record recovered in a 120-m-long sediment core from Bear Lake, Utah and Idaho, provides an opportunity to reconstruct climate change in the Great Basin and compare it with global climate records. Paleomagnetic data exhibit a geomagnetic feature that possibly occurred during the Laschamp excursion (ca. 40 ka). Although the feature does not exhibit excursional behavior (???40?? departure from the expected value), it might provide an additional age constraint for the sequence. Temporal changes in salinity, which are likely related to changes in freshwater input (mainly through the Bear River) or evaporation, are indicated by variations in mineral magnetic properties. These changes are represented by intervals with preserved detrital Fe-oxide minerals and with varying degrees of diagenetic alteration, including sulfidization. On the basis of these changes, the Bear Lake sequence is divided into seven mineral magnetic zones. The differing magnetic mineralogies among these zones reflect changes in deposition, preservation, and formation of magnetic phases related to factors such as lake level, river input, and water chemistry. The occurrence of greigite and pyrite in the lake sediments corresponds to periods of higher salinity. Pyrite is most abundant in intervals of highest salinity, suggesting that the extent of sulfidization is limited by the availability of SO42-. During MIS 2 (zone II), Bear Lake transgressed to capture the Bear River, resulting in deposition of glacially derived hematite-rich detritus from the Uinta Mountains. Millennial-scale variations in the hematite content of Bear Lake sediments during the last glacial maximum (zone II) resemble Dansgaard-Oeschger (D-O) oscillations and Heinrich events (within dating uncertainties), suggesting that the influence of millennial-scale climate oscillations can extend beyond the North Atlantic and influence climate of the Great Basin. The magnetic mineralogy of zones IV-VII (MIS 5, 6, and 7

  8. Magnetic and fluorescent core-shell nanoparticles for ratiometric pH sensing

    International Nuclear Information System (INIS)

    Lapresta-Fernandez, Alejandro; Doussineau, Tristan; Moro, Artur J; Dutz, Silvio; Steiniger, Frank; Mohr, Gerhard J

    2011-01-01

    This paper describes the preparation of nanoparticles composed of a magnetic core surrounded by two successive silica shells embedding two fluorophores, showing uniform nanoparticle size (50-60 nm in diameter) and shape, which allow ratiometric pH measurements in the pH range 5-8. Uncoated iron oxide magnetic nanoparticles (∼10 nm in diameter) were formed by the coprecipitation reaction of ferrous and ferric salts. Then, they were added to a water-in-oil microemulsion where the hydrophilic silica shells were obtained through hydrolysis and condensation of tetraethoxyorthosilicate together with the corresponding silylated dye derivatives-a sulforhodamine was embedded in the inner silica shell and used as the reference dye while a pH-sensitive fluorescein was incorporated in the outer shell as the pH indicator. The magnetic nanoparticles were characterized using vibrating sample magnetometry, dynamic light scattering, transmission electron microscopy, x-ray diffraction and Fourier transform infrared spectroscopy. The relationship between the analytical parameter, that is, the ratio of fluorescence between the sensing and reference dyes versus the pH was adjusted to a sigmoidal fit using a Boltzmann type equation giving an apparent pK a value of 6.8. The fluorescence intensity of the reference dye did not change significantly (∼3.0%) on modifying the pH of the nanoparticle dispersion. Finally, the proposed method was statistically validated against a reference procedure using samples of water and physiological buffer with 2% of horse serum, indicating that there are no significant statistical differences at a 95% confidence level.

  9. From core/shell to hollow Fe/γ-Fe_2O_3 nanoparticles: evolution of the magnetic behavior

    International Nuclear Information System (INIS)

    Nemati, Z; Khurshid, H; Alonso, J; Phan, M H; Mukherjee, P; Srikanth, H

    2015-01-01

    High quality Fe/γ-Fe_2O_3 core/shell, core/void/shell, and hollow nanoparticles with two different sizes of 8 and 12 nm were synthesized, and the effect of morphology, surface and finite-size effects on their magnetic properties including the exchange bias (EB) effect were systematically investigated. We find a general trend for both systems that as the morphology changes from core/shell to core/void/shell, the magnetization of the system decays and inter-particle interactions become weaker, while the effective anisotropy and the EB effect increase. The changes are more drastic when the nanoparticles become completely hollow. Noticeably, the morphological change from core/shell to hollow increases the mean blocking temperature for the 12 nm particles but decreases for the 8 nm particles. The low-temperature magnetic behavior of the 12 nm particles changes from a collective super-spin-glass system mediated by dipolar interactions for the core/shell nanoparticles to a frustrated cluster glass-like state for the shell nanograins in the hollow morphology. On the other hand for the 8 nm nanoparticles core/shell and hollow particles the magnetic behavior is more similar, and a conventional spin glass-like transition is obtained at low temperatures. In the case of the hollow nanoparticles, the coupling between the inner and outer spin layers in the shell gives rise to an enhanced EB effect, which increases with increasing shell thickness. This indicates that the morphology of the shell plays a crucial role in this kind of exchange-biased systems. (paper)

  10. A Chronostratigraphic and Environment Magnetic Study of Drill Cores Collected in the Mozambique Channel on Cruise MD13

    Science.gov (United States)

    Ray, D. J.; DeBone, K. N.; Smesny, J.; Chadinha, C.; Mitchell, B.; Acton, G. D.; Kulhanek, D. K.

    2017-12-01

    The South Atlantic Petroleum Company donated drill cores from 18 sites cored in October 2013 in the Mozambique Channel off Madagascar by the RV Marion Dufresne. Up to 30.11 m of sediment was recovered from cores collected at two localities, referred to as Juan de Nova ( 16.5°S, 42.9°E) and Belo Profound ( 19.5°S, 42.2°E), in water depths of 2,157-2,795 m. The cores are composed mostly of mixtures of fairly homogenous biogenic ooze and clay that is highly bioturbated, with turbidites occurring relatively commonly (about every meter or two) in most of the cores, although rarely in others (e.g., Core MD13-3506). The core color varies between light tan, olive gray, light brown, and light reddish brown. The darker colors probably reflect higher proportion of terrigenous input and the lighter intervals more biogenic input. We collected rock magnetic and paleomagnetic data along the cores and conducted initial calcareous nannofossil biostratigraphic analyses in order to provide stratigraphic and chronologic constraints and to investigate paleoenvironment changes. Records of magnetic susceptibility are used to correlate stratigraphy between sites and then are correlated to well-dated global records of climate change, such as the marine oxygen isotope record. The correlation to oxygen isotope records, which is constrained by biostratigraphic and paleomagnetic observations, helps refine the chronostratigraphy and allows us to interpret the variations in lithology and magnetic properties in the context of global climate change.

  11. Characterization of a high-temperature superconducting conductor on round core cables in magnetic fields up to 20 T

    Energy Technology Data Exchange (ETDEWEB)

    van der Laan, D. C.; Noyes, P. D.; Miller, G. E.; Weijers, H. W.; Willering, G. P.

    2013-02-13

    The next generation of high-ï¬eld magnets that will operate at magnetic ï¬elds substantially above 20 T, or at temperatures substantially above 4.2 K, requires high-temperature superconductors (HTS). Conductor on round core (CORC) cables, in which RE-Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} (RE = rare earth) (REBCO) coated conductors are wound in a helical fashion on a flexible core, are a practical and versatile HTS cable option for low-inductance, high-field magnets. We performed the first tests of CORC magnet cables in liquid helium in magnetic fields of up to 20 T. A record critical current I{sub c} of 5021 A was measured at 4.2 K and 19 T. In a cable with an outer diameter of 7.5 mm, this value corresponds to an engineering current density J{sub e} of 114 A mm{sup -2} , the highest J{sub e} ever reported for a superconducting cable at such high magnetic fields. Additionally, the first magnet wound from an HTS cable was constructed from a 6 m-long CORC cable. The 12-turn, double-layer magnet had an inner diameter of 9 cm and was tested in a magnetic field of 20 T, at which it had an I{sub c} of 1966 A. The cables were quenched repetitively without degradation during the measurements, demonstrating the feasibility of HTS CORC cables for use in high-field magnet applications.

  12. Novel Fe-based nanocrystalline powder cores with excellent magnetic properties produced using gas-atomized powder

    Science.gov (United States)

    Chang, Liang; Xie, Lei; Liu, Min; Li, Qiang; Dong, Yaqiang; Chang, Chuntao; Wang, Xin-Min; Inoue, Akihisa

    2018-04-01

    FeSiBPNbCu nanocrystalline powder cores (NPCs) with excellent magnetic properties were fabricated by cold-compaction of the gas-atomized amorphous powder. Upon annealing at the optimum temperature, the NPCs showed excellent magnetic properties, including high initial permeability of 88, high frequency stability up to 1 MHz with a constant value of 85, low core loss of 265 mW/cm3 at 100 kHz for Bm = 0.05 T, and superior DC-bias permeability of 60% at a bias field of 100 Oe. The excellent magnetic properties of the present NPCs could be attributed to the ultrafine α-Fe(Si) phase precipitated in the amorphous matrix and the use of gas-atomized powder coated with a uniform insulation layer.

  13. Transitions to improved core electron heat confinement triggered by low order rational magnetic surfaces in the stellarator TJ-II

    International Nuclear Information System (INIS)

    Estrada, T.; Medina, F.; Lopez-Bruna, D.; AscasIbar, E.; BalbIn, R.; Cappa, A.; Castejon, F.; Eguilior, S.; Fernandez, A.; Guasp, J.; Hidalgo, C.; Petrov, S.

    2007-01-01

    Transitions to improved core electron heat confinement are triggered by low order rational magnetic surfaces in TJ-II electron cyclotron heated (ECH) plasmas. Experiments are performed changing the magnetic shear around the rational surface n = 3/m = 2 to study its influence on the transition; ECH power modulation is used to look at transport properties. The improvement in the electron heat confinement shows no obvious dependence on the magnetic shear. Transitions triggered by the rational surface n = 4/m = 2 show, in addition, an increase in the ion temperature synchronized with the increase in the electron temperature. Ion temperature changes had not been previously observed either in TJ-II or in any other helical device. SXR measurements demonstrate that, under certain circumstances, the rational surface positioned inside the plasma core region precedes and provides a trigger for the transition

  14. Ag@ZnO core-shell nanoparticles study by first principle: The structural, magnetic and optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Hai-Xia [Department of Physics, University of Science and Technology Beijing, Beijing 100083 (China); Wang, Xiao-Xu [Department of Physics, University of Science and Technology Beijing, Beijing 100083 (China); Beijing Computing Center, Beijing 100094 (China); Hu, Yao-Wen [Department of Physics, Tsinghua University, Beijing 100084 (China); Song, Hong-Quan; Huo, Jin-Rong; Li, Lu [Department of Physics, University of Science and Technology Beijing, Beijing 100083 (China); Qian, Ping, E-mail: ustbqianp@163.com [Department of Physics, University of Science and Technology Beijing, Beijing 100083 (China); Song, Yu-Jun [Department of Physics, University of Science and Technology Beijing, Beijing 100083 (China)

    2016-12-15

    Ag@ZnO core-shell nanoparticles of around 72 atoms have been investigated by the density functional theory, revealing proving for the first time that the core-shell structure exhibits a shrinkage phenomenon from outer shell in agreement with the other studies in literatures. Our calculations predict that the Ag@ZnO core-shell structure is a ferromagnetic spin polarized state, and the magnetism mainly stems from the spin splitting of 2p electrons of O atoms. In addition, the total and partial DOS of Ag@ZnO indicate that the nanostructure is a half-metallic nanoparticle and has the characters of the p-type semiconductor. Furthermore, the optical properties calculations show that the absorption edge of Ag@ZnO have a red shift and good photocatalysis compare to that of the bulk ZnO. These results of the Ag@ZnO core-shell structure obtain a well agreement with the experimental measurement. - Graphical abstract: Geometric structure of (a) Ag@ZnO core-shell nanostructure; (b) the core of Ag; (c) the shell of ZnO The core-shell nanoparticle Ag@ZnO contains Ag inner core of radius of 4 Å and ZnO outer shell with thickness of 2 Å. Ag@ZnO core-shell nanoparticles of around 72 atoms have been proved for the first time that the core-shell structure exhibit a shrinkage phenomenon from outer shell. Our calculations predict that the Ag@ZnO core-shell structure is a half-metallic nanoparticle and has the characters of the p-type semiconductor. The absorption edge of Ag@ZnO have a red shift and get good photo-catalysis compare to that of the bulk ZnO.

  15. Immobilization of cholesterol oxidase on magnetic fluorescent core-shell-structured nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Jun, E-mail: hjun@whut.edu.cn; Liu, Huichao; Zhang, Peipei; Zhang, Pengfei; Li, Mengshi; Ding, Liyun

    2015-12-01

    The magnetic fluorescent core-shell structured nanoparticles, Fe{sub 3}O{sub 4}@SiO{sub 2}(F)@meso–SiO{sub 2} nanoparticles, were prepared. Cholesterol oxidase (COD) was immobilized on their surface to form Fe{sub 3}O{sub 4}@SiO{sub 2}(F)@meso–SiO{sub 2}@COD nanoparticles. Optimal immobilization was achieved with 2.5% (v/v) APTES, 2.0% (v/v) GA, 10 mg COD (in 15 mg carrier) and solution pH of 7.0. Fe{sub 3}O{sub 4}@SiO{sub 2}(F)@meso–SiO{sub 2}@COD nanoparticles showed maximal catalytic activity at pH 7.0 and 50 °C. The thermal, storage and operational stabilities of COD were improved greatly after its immobilization. After the incubation at 50 °C for 5 h, the nanoparticles and free COD retained 80% and 46% of its initial activity, respectively. After kept at 4 °C for 30 days, the nanoparticles and free COD maintained 86% and 65% of initial activity, respectively. The nanoparticles retained 71% of its initial activity after 7 consecutive operations. Since Fe{sub 3}O{sub 4}@SiO{sub 2}(F)@meso–SiO{sub 2}@COD nanoparticles contained tris(2,2-bipyridyl)dichloro-ruthenium(II) hexahydrate (Ru(bpy){sub 3}Cl{sub 2}) and were optical sensitive to oxygen in solution, it might be used as the sensing material and has the application potential in multi parameter fiber optic biosensor based on enzyme catalysis and oxygen consumption. - Highlights: • COD was immobilized on magnetic fluorescent core-shell structured nanoparticles. • The nanoparticles were optical sensitive to oxygen in water solution. • The nanoparticles have remarkable improved stability compared with free COD. • The nanoparticles can probably be used in multi parameter fiber optic Biosensor.

  16. Shape-Controlled Synthesis of Magnetic Iron Oxide@SiO₂-Au@C Particles with Core-Shell Nanostructures.

    Science.gov (United States)

    Li, Mo; Li, Xiangcun; Qi, Xinhong; Luo, Fan; He, Gaohong

    2015-05-12

    The preparation of nonspherical magnetic core-shell nanostructures with uniform sizes still remains a challenge. In this study, magnetic iron oxide@SiO2-Au@C particles with different shapes, such as pseduocube, ellipsoid, and peanut, were synthesized using hematite as templates and precursors of magnetic iron oxide. The as-obtained magnetic particles demonstrated uniform sizes, shapes, and well-designed core-shell nanostructures. Transmission electron microscopy (TEM) and energy dispersive X-ray spectroscopy (EDX) analysis showed that the Au nanoparticles (AuNPs) of ∼6 nm were uniformly distributed between the silica and carbon layers. The embedding of the metal nanocrystals into the two different layers prevented the aggregation and reduced the loss of the metal nanocrystals during recycling. Catalytic performance of the peanut-like particles kept almost unchanged without a noticeable decrease in the reduction of 4-nitrophenol (4-NP) in 8 min even after 7 cycles, indicating excellent reusability of the particles. Moreover, the catalyst could be readily recycled magnetically after each reduction by an external magnetic field.

  17. Copper, gold, and silver decorated magnetic core-polymeric shell nanostructures for destruction of pathogenic bacteria

    Science.gov (United States)

    Padervand, Mohsen; Karanji, Ahmad Kiani; Elahifard, Mohammad Reza

    2017-05-01

    Fe3O4 magnetic nanoparticles (MNPs) were prepared by co-precipitation method. The nanoparticles were silica coated using TEOS, and then modified by the polymeric layers of polypropylene glycol (PPG) and polyethylene glycol (PEG). Finally, the core-shell samples were decorated with Ag, Au, and Cu nanoparticles. The products were characterized by vibrating sample magnetometry (VSM), TGA, SEM, XRD, and FTIR methods. The antibacterial activity of the prepared samples was evaluated in inactivation of E. coli and S. aureus microorganisms, representing the Gram-negative and Gram-positive species, respectively. The effect of solid dosage, bacteria concentration and type of polymeric modifier on the antibacterial activity was investigated. TEM images of the bacteria were recorded after the treatment time and according to the observed changes in the cell wall, the mechanism of antibacterial action was discussed. The prepared nanostructures showed high antibacterial activity against both Gram-negative and Gram-positive bacteria. This was due to the leaching of metal ions which subsequently led to the lysis of bacteria. A theoretical investigation was also done by studying the interaction of loaded metals with the nucleotide components of the microorganism DNA, and the obtained results were used to explain the experimental data. Finally, based on the observed inactivation curves, we explain the antibacterial behavior of the prepared nanostructures mathematically.

  18. A compact high-voltage pulse generator based on pulse transformer with closed magnetic core.

    Science.gov (United States)

    Zhang, Yu; Liu, Jinliang; Cheng, Xinbing; Bai, Guoqiang; Zhang, Hongbo; Feng, Jiahuai; Liang, Bo

    2010-03-01

    A compact high-voltage nanosecond pulse generator, based on a pulse transformer with a closed magnetic core, is presented in this paper. The pulse generator consists of a miniaturized pulse transformer, a curled parallel strip pulse forming line (PFL), a spark gap, and a matched load. The innovative design is characterized by the compact structure of the transformer and the curled strip PFL. A new structure of transformer windings was designed to keep good insulation and decrease distributed capacitance between turns of windings. A three-copper-strip structure was adopted to avoid asymmetric coupling of the curled strip PFL. When the 31 microF primary capacitor is charged to 2 kV, the pulse transformer can charge the PFL to 165 kV, and the 3.5 ohm matched load can deliver a high-voltage pulse with a duration of 9 ns, amplitude of 84 kV, and rise time of 5.1 ns. When the load is changed to 50 ohms, the output peak voltage of the generator can be 165 kV, the full width at half maximum is 68 ns, and the rise time is 6.5 ns.

  19. An active magnetic bearing with high Tc superconducting coils and ferromagnetic cores

    International Nuclear Information System (INIS)

    Brown, G.V.; DiRusso, E.; Provenza, A.J.

    1996-01-01

    A proof-of-feasibility demonstration showed that high-T c , superconductor (HTS) coils can be used in a high-load, active magnetic bearing in LN 2 . A homopolar radial bearing with commercially wound HTS (Bi 2223) bias and control coils produced over 890 N (200 lb) radial load capacity (measured nonrotating) and supported a shaft to 14000 rpm. The goal was to show that HTS coils can operate stably with ferromagnetic cores in a feedback controlled system at a current density similar to that for Cu in LN 2 . The bias coil, wound with nontwisted, multifilament HTS conductor, dissipated negligible power for its direct current. The control coils, wound with monofilament HTS sheathed in Ag, dissipated negligible power for direct current. AC losses increased rapidly with frequency and quadratically with AC amplitude. Above about 2 Hz, the effective resistance of the control coils exceeds that of the silver which is in electrical parallel with the oxide superconductor. These results show that twisted multifilament conductor is not needed for stable levitation but may be desired to reduce control power for sizable dynamic loads

  20. Engineered core-shell magnetic nanoparticle for MR dual-modal tracking and safe magnetic manipulation of ependymal cells in live rodents

    Science.gov (United States)

    Peng, Yung-Kang; Lui, Cathy N. P.; Chen, Yu-Wei; Chou, Shang-Wei; Chou, Pi-Tai; Yung, Ken K. L.; Edman Tsang, S. C.

    2018-01-01

    Tagging recognition group(s) on superparamagnetic iron oxide is known to aid localisation (imaging), stimulation and separation of biological entities using magnetic resonance imaging (MRI) and magnetic agitation/separation (MAS) techniques. Despite the wide applicability of iron oxide nanoparticles in T 2-weighted MRI and MAS, the quality of the images and safe manipulation of the exceptionally delicate neural cells in a live brain are currently the key challenges. Here, we demonstrate the engineered manganese oxide clusters-iron oxide core-shell nanoparticle as an MR dual-modal contrast agent for neural stem cells (NSCs) imaging and magnetic manipulation in live rodents. As a result, using this engineered nanoparticle and associated technologies, identification, stimulation and transportation of labelled potentially multipotent NSCs from a specific location of a live brain to another by magnetic means for self-healing therapy can therefore be made possible.

  1. Detent Force Reduction of a C-Core Linear Flux-Switching Permanent Magnet Machine with Multiple Additional Teeth

    Directory of Open Access Journals (Sweden)

    Yi Du

    2017-03-01

    Full Text Available C-core linear flux-switching permanent magnet (PM machines (LFSPMs are attracting more and more attention due to their advantages of simplicity and robustness of the secondary side, high power density and high torque density, in which both PMs and armature windings are housed in the primary side. The primary salient tooth wound with a concentrated winding consists of C-shaped iron core segments between which PMs are sandwiched and the magnetization directions of these PMs are adjacent and alternant in the horizontal direction. On the other hand, the secondary side is composed of a simple iron core with salient teeth so that it is very suitable for long stroke applications. However, the detent force of the C-core LFSPM machine is relatively high and the magnetic circuit is unbalanced due to the end effect. Thus, a new multiple additional tooth which consists of an active and a traditional passive additional tooth, is employed at each end side of the primary in this paper, so that the asymmetry due to end effect can be depressed and the detent force can be reduced by adjusting the passive additional tooth position. By using the finite element method, the characteristics and performances of the proposed machine are analyzed and verified.

  2. Lithology and chronology of ice-sheet fluctuations (magnetic susceptibility of cores from the western Ross Sea)

    Science.gov (United States)

    Jennings, Anne E.

    1993-01-01

    The goals of the marine geology part of WAIS include reconstructing the chronology and areal extent of ice-sheet fluctuations and understanding the climatic and oceanographic influences on ice-sheet history. As an initial step toward attaining these goals, down-core volume magnetic susceptibility (MS) logs of piston cores from three N-S transects in the western Ross Sea are compared. The core transects are within separate petrographic provinces based on analyses of till composition. The provinces are thought to reflect the previous locations of ice streams on the shelf during the last glaciation. Magnetic susceptibility is a function of magnetic mineral composition, sediment texture, and sediment density. It is applied in the western Ross Sea for two purposes: (1) to determine whether MS data differentiates the three transects (i.e., flow lines), and thus can be used to make paleodrainage reconstructions of the late Wisconsinan ice sheet; and (2) to determine whether the MS data can aid in distinguishing basal till diamictons from diamictons of glacial-marine origin and thus, aid paleoenvironmental interpretations. A comparison of the combined data of cores in each transect is presented.

  3. Preparation of Multifunctional Fe@Au Core-Shell Nanoparticles with Surface Grafting as a Potential Treatment for Magnetic Hyperthermia

    Directory of Open Access Journals (Sweden)

    Ren-Jei Chung

    2014-01-01

    Full Text Available Iron core gold shell nanoparticles grafted with Methotrexate (MTX and indocyanine green (ICG were synthesized for the first time in this study, and preliminarily evaluated for their potential in magnetic hyperthermia treatment. The core-shell Fe@Au nanoparticles were prepared via the microemulsion process and then grafted with MTX and ICG using hydrolyzed poly(styrene-alt-maleic acid (PSMA to obtain core-shell Fe@Au-PSMA-ICG/MTX nanoparticles. MTX is an anti-cancer therapeutic, and ICG is a fluorescent dye. XRD, TEM, FTIR and UV-Vis spectrometry were performed to characterize the nanoparticles. The data indicated that the average size of the nanoparticles was 6.4 ± 09 nm and that the Au coating protected the Fe core from oxidation. MTX and ICG were successfully grafted onto the surface of the nanoparticles. Under exposure to high frequency induction waves, the superparamagnetic nanoparticles elevated the temperature of a solution in a few minutes, which suggested the potential for an application in magnetic hyperthermia treatment. The in vitro studies verified that the nanoparticles were biocompatible; nonetheless, the Fe@Au-PSMA-ICG/MTX nanoparticles killed cancer cells (Hep-G2 via the magnetic hyperthermia mechanism and the release of MTX.

  4. Preparation of Multifunctional Fe@Au Core-Shell Nanoparticles with Surface Grafting as a Potential Treatment for Magnetic Hyperthermia.

    Science.gov (United States)

    Chung, Ren-Jei; Shih, Hui-Ting

    2014-01-24

    Iron core gold shell nanoparticles grafted with Methotrexate (MTX) and indocyanine green (ICG) were synthesized for the first time in this study, and preliminarily evaluated for their potential in magnetic hyperthermia treatment. The core-shell Fe@Au nanoparticles were prepared via the microemulsion process and then grafted with MTX and ICG using hydrolyzed poly(styrene-alt-maleic acid) (PSMA) to obtain core-shell Fe@Au-PSMA-ICG/MTX nanoparticles. MTX is an anti-cancer therapeutic, and ICG is a fluorescent dye. XRD, TEM, FTIR and UV-Vis spectrometry were performed to characterize the nanoparticles. The data indicated that the average size of the nanoparticles was 6.4 ± 09 nm and that the Au coating protected the Fe core from oxidation. MTX and ICG were successfully grafted onto the surface of the nanoparticles. Under exposure to high frequency induction waves, the superparamagnetic nanoparticles elevated the temperature of a solution in a few minutes, which suggested the potential for an application in magnetic hyperthermia treatment. The in vitro studies verified that the nanoparticles were biocompatible; nonetheless, the Fe@Au-PSMA-ICG/MTX nanoparticles killed cancer cells (Hep-G2) via the magnetic hyperthermia mechanism and the release of MTX.

  5. Magnetic Fe{sub 3}O{sub 4}-Au core-shell nanostructures for surface enhanced Raman scattering

    Energy Technology Data Exchange (ETDEWEB)

    Wheeler, D.A.; Adams, S.A.; Zhang, J.Z. [Department of Chemistry and Biochemistry, University of California, Santa Cruz, Santa Cruz, CA 95064 (United States); Lopez-Luke, T. [Department of Chemistry and Biochemistry, University of California, Santa Cruz, Santa Cruz, CA 95064 (United States); Cento de Investigaciones en Optica, A.P. 1-948 Leon, Gto. 37150 (Mexico); Torres-Castro, A. [Universidad Autonoma de Nuevo Leon, A.P. 126-F, Monterrey, NL, 66450 (Mexico)

    2012-11-15

    The synthesis, structural and optical characterization, and application of superparamagnetic and water-dispersed Fe{sub 3}O{sub 4}-Au core-shell nanoparticles for surface enhanced Raman scattering (SERS) is reported. The structure of the nanoparticles was determined by scanning transmission electron microscopy (STEM) and high-resolution transmission electron microscopy (HRTEM). STEM images of the Fe{sub 3}O{sub 4}-Au core-shell nanoparticles reveal an average diameter of 120 nm and a high degree of surface roughness. The nanoparticles, which display superparamagnetic properties due to the core Fe{sub 3}O{sub 4} material, exhibit a visible surface plasmon resonance (SPR) peaked at 580 nm due to the outer gold shell. The nanoparticles are used as a substrate for surface enhanced Raman scattering (SERS) with rhodamine 6G (R6G) as a Raman reporter molecule. The SERS enhancement factor is estimated to be on the order of 10{sup 6}, which is {proportional_to} 2 times larger than that of conventional gold nanoparticles (AuNPs) under similar conditions. Significantly, magnetically-induced aggregation of the Fe{sub 3}O{sub 4}-Au core-shell nanoparticles substantially enhanced SERS activity compared to non-magnetically-aggregated Fe{sub 3}O{sub 4}-Au nanoparticles. This is attributed to both increased scattering from the aggregates as well as ''hot spots'' due to more junction sites in the magnetically-induced aggregates. The magnetic properties of the Fe{sub 3}O{sub 4} core, coupled with the optical properties of the Au shell, make the Fe{sub 3}O{sub 4}-Au nanoparticles unique for various potential applications including biological sensing and therapy. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Synthesis of Magnetic Rattle-Type Silica with Controllable Magnetite and Tunable Size by Pre-Shell-Post-Core Method.

    Science.gov (United States)

    Chen, Xue; Tan, Longfei; Meng, Xianwei

    2016-03-01

    In this study, we have developed the pre-shell-post-core route to synthesize the magnetic rattle-type silica. This method has not only simplified the precursor's process and reduced the reacting time, but also ameliorated the loss of magnetite and made the magnetite content and the inner core size controllable and tunable. The magnetite contents and inner core size can be easily controlled by changing the type and concentration of alkali, reaction system and addition of water. The results show that alkali aqueous solution promotes the escape of the precursor iron ions from the inner space of rattle-type silica and results in the loss of magnetite. In this case, NaOH ethanol solution is better for the formation of magnetite than ammonia because it not only offers an appropriate alkalinity to facilitate the synthesis of. magnetic particles, but also avoids the escape of the iron ions from the mesopores of rattle-type silica. The synthesis process is very simple and efficient, and it takes no more than 2 hours to complete the total preparation and handling of the magnetic rattle-type silica. The end-product Fe3O4@SiO2 nanocomposites also have good magnetic properties which will perform potential application in biomedical science.

  7. Improved soft magnetic properties in nanocrystalline FeCuNbSiB Nanophy{sup ®} cores by intense magnetic field annealing

    Energy Technology Data Exchange (ETDEWEB)

    Madugundo, Rajasekhar; Geoffroy, Olivier [Univ. Grenoble Alpes, Inst NEEL, F-38000 Grenoble (France); CNRS, Inst NEEL, F-38000 Grenoble (France); Grenoble Electrical Engineering Laboratory (G2Elab), Bâtiment GreEn-ER, 21 avenue des martyrs, 38031 Grenoble (France); Waeckerle, Thierry [Aperam Research Center, 58160 Imphy (France); Frincu, Bianca; Kodjikian, Stéphanie [Univ. Grenoble Alpes, Inst NEEL, F-38000 Grenoble (France); CNRS, Inst NEEL, F-38000 Grenoble (France); Rivoirard, Sophie, E-mail: sophie.rivoirard@neel.cnrs.fr [Univ. Grenoble Alpes, Inst NEEL, F-38000 Grenoble (France); CNRS, Inst NEEL, F-38000 Grenoble (France)

    2017-01-15

    The effect of high external magnetic field (up to 7 T) on soft magnetic properties in nanocrystalline Fe{sub 74.1}Si{sub 15.7}Nb{sub 3.1}B{sub 6.1}Cu{sub 1} Nanophy{sup ®} cores has been investigated. The as-quenched amorphous ribbons were nanocrystallized by annealing between 540 and 620 °C in transverse magnetic field. By varying annealing field from 0 to 7 T, induced anisotropy ranging from as low as 4 J/m{sup 3} to as high as 41 J/m{sup 3} is obtained. It is responsible for an increase in the cut-off frequency up to 300 kHz when the material is submitted to dynamic magnetic excitations. A minimum coercivity of 0.74 A/m is observed in the core annealed in 1 T associated to low losses. The relative permeability decreases on increasing the annealing field intensity with a minimum value of 13,654 at 7 T. Such permeability level opens the way to new applications of the Nanophy{sup ®} alloys. - Highlights: • Effect of magnetic field (0–7 T) in nanocrystalline Nanophy{sup ®} cores was investigated. • Amorphous ribbons were annealing between 540 and 620 °C in transverse magnetic field. • Induced anisotropy ranging from 4 to 41 J/m{sup 3} was obtained by annealing in field 0−7 T. • Permeability ranging between 135,122 and 13,654 was obtained. • A minimum coercivity of 0.74 A/m was observed.

  8. Large-scale synthesis of Ni-Ag core-shell nanoparticles with magnetic, optical and anti-oxidation properties

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chung-Che; Chen, Dong-Hwang [Department of Chemical Engineering, National Cheng Kung University, Tainan, Taiwan 701, Taiwan (China)

    2006-07-14

    The large-scale synthesis and characterization of Ni-core/Ag-shell (Ni at Ag) nanoparticles by the successive hydrazine reduction of nickel chloride and silver nitrate in ethylene glycol using polyethyleneimine (PEI) as a protective agent are described. The resultant Ni at Ag nanoparticles had a mean core diameter of 6.2 nm and a shell thickness of 0.85 nm, without significant change in the nickel concentration of 0.25-25 mM for the Ag coating. Also, both Ni cores and Ag nanoshells had an fcc structure and PEI was capped on the particle surface. X-ray photoelectron spectroscopy analysis confirmed that the Ni cores were fully covered by Ag nanoshells. In addition, the Ni at Ag nanoparticles exhibited a characteristic absorption band at 430 nm and were nearly superparamagnetic. Based on the weight of Ni cores, the saturation magnetization (M{sub s}), remanent magnetization (M{sub r}) and coercivity (H{sub c}) were obtained as 17.2 emu g{sup -1}, 4.0 emu g{sup -1} and 81 Oe, respectively. Furthermore, the resultant Ni at Ag nanoparticles exhibited better anti-oxidation properties than Ni nanoparticles did due to the protection of the Ag nanoshells.

  9. Magnetization measurements and XMCD studies on ion irradiated iron oxide and core-shell iron/iron-oxide nanomaterials

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Maninder; Qiang, You; Jiang, Weilin; Pearce, Carolyn; McCloy, John S.

    2014-12-02

    Magnetite (Fe3O4) and core-shell iron/iron-oxide (Fe/Fe3O4) nanomaterials prepared by a cluster deposition system were irradiated with 5.5 MeV Si2+ ions and the structures determined by x-ray diffraction as consisting of 100% magnetite and 36/64 wt% Fe/FeO, respectively. However, x-ray magnetic circular dichroism (XMCD) indicates similar surfaces in the two samples, slightly oxidized and so having more Fe3+ than the expected magnetite structure, with XMCD intensity much lower for the irradiated core-shell samples indicating weaker magnetism. X-ray absorption spectroscopy (XAS) data lack the signature for FeO, but the irradiated core-shell system consists of Fe-cores with ~13 nm of separating oxide crystallite, so it is likely that FeO exists deeper than the probe depth of the XAS (~5 nm). Exchange bias (Hex) for both samples becomes increasingly negative as temperature is lowered, but the irradiated Fe3O4 sample shows greater sensitivity of cooling field on Hex. Loop asymmetries and Hex sensitivities of the irradiated Fe3O4 sample are due to interfaces and interactions between grains which were not present in samples before irradiation as well as surface oxidation. Asymmetries in the hysteresis curves of the irradiated core/shell sample are related to the reversal mechanism of the antiferromagnetic FeO and possibly some near surface oxidation.

  10. Evidence for an impact-induced magnetic fabric in Allende, and exogenous alternatives to the core dynamo theory for Allende magnetization

    Science.gov (United States)

    Muxworthy, Adrian R.; Bland, Phillip A.; Davison, Thomas M.; Moore, James; Collins, Gareth S.; Ciesla, Fred J.

    2017-10-01

    We conducted a paleomagnetic study of the matrix of Allende CV3 chondritic meteorite, isolating the matrix's primary remanent magnetization, measuring its magnetic fabric and estimating the ancient magnetic field intensity. A strong planar magnetic fabric was identified; the remanent magnetization of the matrix was aligned within this plane, suggesting a mechanism relating the magnetic fabric and remanence. The intensity of the matrix's remanent magnetization was found to be consistent and low ( 6 μT). The primary magnetic mineral was found to be pyrrhotite. Given the thermal history of Allende, we conclude that the remanent magnetization was formed during or after an impact event. Recent mesoscale impact modeling, where chondrules and matrix are resolved, has shown that low-velocity collisions can generate significant matrix temperatures, as pore-space compaction attenuates shock energy and dramatically increases the amount of heating. Nonporous chondrules are unaffected, and act as heat-sinks, so matrix temperature excursions are brief. We extend this work to model Allende, and show that a 1 km/s planar impact generates bulk porosity, matrix porosity, and fabric in our target that match the observed values. Bimodal mixtures of a highly porous matrix and nominally zero-porosity chondrules make chondrites uniquely capable of recording transient or unstable fields. Targets that have uniform porosity, e.g., terrestrial impact craters, will not record transient or unstable fields. Rather than a core dynamo, it is therefore possible that the origin of the magnetic field in Allende was the impact itself, or a nebula field recorded during transient impact heating.

  11. Pure-iron/iron-based-alloy hybrid soft magnetic powder cores compacted at ultra-high pressure

    Science.gov (United States)

    Saito, Tatsuya; Tsuruta, Hijiri; Watanabe, Asako; Ishimine, Tomoyuki; Ueno, Tomoyuki

    2018-04-01

    We developed Fe/FeSiAl soft magnetic powder cores (SMCs) for realizing the miniaturization and high efficiency of an electromagnetic conversion coil in the high-frequency range (˜20 kHz). We found that Fe/FeSiAl SMCs can be formed with a higher density under higher compaction pressure than pure-iron SMCs. These SMCs delivered a saturation magnetic flux density of 1.7 T and iron loss (W1/20k) of 158 kW/m3. The proposed SMCs exhibited similar excellent characteristics even in block shapes, which are closer to the product shapes.

  12. Pure-iron/iron-based-alloy hybrid soft magnetic powder cores compacted at ultra-high pressure

    Directory of Open Access Journals (Sweden)

    Tatsuya Saito

    2018-04-01

    Full Text Available We developed Fe/FeSiAl soft magnetic powder cores (SMCs for realizing the miniaturization and high efficiency of an electromagnetic conversion coil in the high-frequency range (∼20 kHz. We found that Fe/FeSiAl SMCs can be formed with a higher density under higher compaction pressure than pure-iron SMCs. These SMCs delivered a saturation magnetic flux density of 1.7 T and iron loss (W1/20k of 158 kW/m3. The proposed SMCs exhibited similar excellent characteristics even in block shapes, which are closer to the product shapes.

  13. Two emissive-magnetic composite platforms for Hg(II) sensing and removal: The combination of magnetic core, silica molecular sieve and rhodamine chemosensors

    Science.gov (United States)

    Mao, Hanping; Liu, Zhongshou

    2018-01-01

    In this paper, a composite sensing platform for Hg(II) optical sensing and removal was designed and reported. A core-shell structure was adopted, using magnetic Fe3O4 nanoparticles as the core, silica molecular sieve MCM-41 as the shell, respectively. Two rhodamine derivatives were synthesized as chemosensor and covalently immobilized into MCM-41 tunnels. Corresponding composite samples were characterized with SEM/TEM images, XRD analysis, IR spectra, thermogravimetry and N2 adsorption/desorption analysis, which confirmed their core-shell structure. Their emission was increased by Hg(II), showing emission turn on effect. High selectivity, linear working curves and recyclability were obtained from these composite samples.

  14. Scanning microscopy of magnetic domains using the Fe 3p core level transverse magneto-optical Kerr effect

    Science.gov (United States)

    Friedrich, J.; Rozhko, I.; Voss, J.; Hillebrecht, F. U.; Kisker, E.; Wedemeier, V.

    1999-04-01

    We demonstrate the feasibility of the vacuum ultraviolet analog to visible-light magneto-optical imaging of magnetic structures using the resonantly enhanced transverse magneto-optical Kerr effect at core level thresholds with incident p-polarized radiation. The advantages are element specificity and a variable information depth. We used the scanning x-ray microscope at HASYLAB capable of obtaining about 1 μm resolution by means of its focusing ellipsoidal ring mirror. The p-polarized component of the reflected light was selected using multilayer reflection at an additional plane mirror downstream to the sample. Micrographs of the optical reflectivity were taken in the vicinity of the Fe 3p core level threshold at 53.7 and 56.5 eV photon energy where the magneto-optical effect is of opposite sign. Magnetic domains are visible in the difference of both recorded images.

  15. Electrostatic Self-Assembly of Au Nanoparticles onto Thermosensitive Magnetic Core-Shell Microgels for Thermally Tunable and Magnetically Recyclable Catalysis.

    Science.gov (United States)

    Liu, Guoqiang; Wang, Daoai; Zhou, Feng; Liu, Weimin

    2015-06-01

    A facile route to fabricate a nanocomposite of Fe3O4@poly[N-isopropylacrylamide (NIPAM)-co-2-(dimethylamino)ethyl methacrylate (DMAEMA)]@Au (Fe3O4@PND@Au) is developed for magnetically recyclable and thermally tunable catalysis. The negatively charged Au nanoparticles with an average diameter of 10 nm are homogeneously loaded onto positively charged thermoresponsive magnetic core-shell microgels of Fe3O4@poly(NIPAM-co-DMAEMA) (Fe3O4@PND) through electrostatic self-assembly. This type of attachment offers perspectives for using charged polymeric shell on a broad variety of nanoparticles to immobilize the opposite-charged nanoparticles. The thermosensitive PND shell with swollen or collapsed properties can be as a retractable Au carrier, thereby tuning the aggregation or dispersion of Au nanoparticles, which leads to an increase or decrease of catalytic activity. Therefore, the catalytic activity of Fe3O4@PND@Au can be modulated by the volume transition of thermosensitive microgel shells. Importantly, the mode of tuning the aggregation or dispersion of Au nanoparticles using a thermosensitive carrier offers a novel strategy to adjust and control the catalytic activity, which is completely different with the traditional regulation mode of controlling the diffusion of reactants toward the catalytic Au core using the thermosensitive poly(N-isopropylacrylamide) network as a nanogate. Concurrent with the thermally tunable catalysis, the magnetic susceptibility of magnetic cores enables the Fe3O4@PND@Au nanocomposites to be capable of serving as smart nanoreactors for thermally tunable and magnetically recyclable catalysis. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. An active homopolar magnetic bearing with high temperature superconductor (HTS) coils and ferromagnetic cores

    Science.gov (United States)

    Brown, G. V.; Dirusso, E.; Provenza, A. J.

    1995-01-01

    A proof-of-feasibility demonstration showed that high temperature superconductor (HTS) coils can be used in a high-load, active magnetic bearing in liquid nitrogen. A homopolar radial bearing with commercially wound HTS (Bi 2223) bias and control coils produced over 200 lb (890 N) radial load capacity (measured non-rotating) and supported a shaft to 14000 rpm. The goal was to show that HTS coils can operate stably with ferromagnetic cores in a feedback controlled system at a current density similar to that in Cu in liquid nitrogen. Design compromises permitted use of circular coils with rectangular cross section. Conductor improvements will eventually permit coil shape optimization, higher current density and higher bearing load capacity. The bias coil, wound with non-twisted, multifilament HTS conductor, required negligible power to carry its direct current. The control coils were wound with monofilament HTS sheathed in Ag. These dissipated negligible power for direct current (i.e. for steady radial load components). When an alternating current (AC) was added, the AC component dissipated power which increased rapidly with frequency and quadratically with AC amplitude. In fact at frequencies above about 2 hz, the effective resistance of the control coil conductor actually exceeds that of the silver which is in electrical parallel with the oxide superconductor. This is at least qualitatively understandable in the context of a Bean-type model of flux and current penetration into a Type II superconductor. Fortunately the dynamic currents required for bearing stability are of small amplitude. These results show that while twisted multifilament conductor is not needed for stable levitation, twisted multifilaments will be required to reduce control power for sizable dynamic loads, such as those due to unbalance.

  17. Application of a permanent magnet biased E-Core reluctance actuator in a magnetically suspended ceiling actuator

    NARCIS (Netherlands)

    Overboom, T.T.; Jansen, J.W.; Lomonova, E.

    2010-01-01

    In the paper a novel actuator is presented for a magnetically suspended ceiling actuator. The actuator consists of several stator segments which contain the coils and the magnets. The armature, therefore, has a totally passive design. Because of its salient structure, a translational force can be

  18. Investigation of magnetic and magneto-transport properties of ferromagnetic-charge ordered core-shell nanostructures

    Science.gov (United States)

    Das, Kalipada

    2017-10-01

    In our present study, we address in detail the magnetic and magneto-transport properties of ferromagnetic-charge ordered core-shell nanostructures. In these core-shell nanostructures, well-known half metallic La0.67Sr0.33MnO3 nanoparticles (average particle size, ˜20 nm) are wrapped by the charge ordered antiferromagnetic Pr0.67Ca0.33MnO3 (PCMO) matrix. The intrinsic properties of PCMO markedly modify it into such a core-shell form. The robustness of the PCMO matrix becomes fragile and melts at an external magnetic field (H) of ˜20 kOe. The analysis of magneto-transport data indicates the systematic reduction of the electron-electron and electron-magnon interactions in the presence of an external magnetic field in these nanostructures. The pronounced training effect appears in this phase separated compound, which was analyzed by considering the second order tunneling through the grain boundaries of the nanostructures. Additionally, the analysis of low field magnetoconductance data supports the second order tunneling and shows the close value of the universal limit (˜1.33).

  19. Synthesis and characterization of fluorinated magnetic core-shell nanoparticles for inhibition of insulin amyloid fibril formation

    International Nuclear Information System (INIS)

    Skaat, Hadas; Margel, Shlomo; Belfort, Georges

    2009-01-01

    Maghemite (γ-Fe 2 O 3 ) magnetic nanoparticles of 15.0 ± 2.1 nm are formed by nucleation followed by controlled growth of maghemite thin films on gelatin-iron oxide nuclei. Uniform magnetic γ-Fe 2 O 3 /poly (2,2,3,3,4,4,4-heptafluorobutyl acrylate) (γ-Fe 2 O 3 /PHFBA) core-shell nanoparticles are prepared by emulsion polymerization of the fluorinated monomer 2,2,3,3,4,4,4-heptafluorobutyl acrylate (HFBA) in the presence of the maghemite nanoparticles. The kinetics of the insulin fibrillation process in the absence and in the presence of the γ-Fe 2 O 3 /PHFBA core-shell nanoparticles are elucidated. A significant direct slow transition from α-helix to β-sheets during insulin fibril formation is observed in the presence of the γ-Fe 2 O 3 /PHFBA nanoparticles. This is in contradiction to our previous manuscript, which illustrated that the γ-Fe 2 O 3 core nanoparticles do not affect the kinetics of the formation of the insulin fibrils, and to other previous publications that describe acceleration of the fibrillation process by using various types of nanoparticles. These core-shell nanoparticles may therefore be also useful for the inhibition of conformational changes of other amyloidogenic proteins that lead to neurodegenerative diseases such as Alzheimer's, Parkinson's, Huntington's, mad cow and prion diseases.

  20. Jingle-bell-shaped ferrite hollow sphere with a noble metal core: Simple synthesis and their magnetic and antibacterial properties

    International Nuclear Information System (INIS)

    Li Siheng; Wang Enbo; Tian Chungui; Mao Baodong; Kang Zhenhui; Li Qiuyu; Sun Guoying

    2008-01-01

    In this paper, a simple strategy is developed for rational fabrication of a class of jingle-bell-shaped hollow structured nanomaterials marked as Ag(MFe 2 O 4 ) (M=Ni, Co, Mg, Zn), consisting of ferrite hollow shells and metal nanoparticle cores, using highly uniform colloidal Ag(C) microspheres as template. The final composites were obtained by direct adsorption of metal cations Fe 3+ and M 2+ on the surface of the Ag(C) spheres followed by calcination process to remove the middle carbon shell and transform the metal ions into pure phase ferrites. The as-prepared composites were characterized by X-ray photoelectron spectroscopy (XPS), energy-dispersive X-ray analysis (EDX), X-ray powder diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV-vis spectroscopy and SQUID magnetometer. The results showed that the composites possess the magnetic property of the ferrite shell and the optical together with antibacterial property of the Ag core. - Graphical abstract: MFe 2 O 4 (M=Ni, Co, Mg, Zn) hollow spheres with a noble metal nanoparticle core were successfully prepared by using colloidal metal(C) core-shell spheres as templates with no need of surface modification. The shell thickness and magnetic properties of the ferrite hollow spheres could be controlled by varying the synthetic parameters

  1. Muon-Spin Rotation Measurements of the Magnetic Field Dependence of the Vortex-Core Radius and Magnetic Penetration Depth in NbSe2

    International Nuclear Information System (INIS)

    Sonier, J.E.; Kiefl, R.F.; Brewer, J.H.; Chakhalian, J.; Dunsiger, S.R.; MacFarlane, W.A.; Miller, R.I.; Wong, A.; Luke, G.M.; Brill, J.W.

    1997-01-01

    Muon-spin rotation spectroscopy (μSR) has been used to measure the internal magnetic field distribution in NbSe 2 for H c1 c2 . The deduced profiles of the supercurrent density J s indicate that the vortex-core radius ρ 0 in the bulk decreases sharply with increasing magnetic field. This effect, which is attributed to increased vortex-vortex interactions, does not agree with the dirty-limit microscopic theory. A simple phenomenological equation in which ρ 0 depends on the intervortex spacing is used to model this behavior. In addition, we find for the first time that the in-plane magnetic penetration depth λ ab increases linearly with H in the vortex state of a conventional superconductor. copyright 1997 The American Physical Society

  2. Magnetic field sensor based on the magnetic-fluid-clad combined with singlemode-multimode-singlemode fiber and large core-offset splicing structure

    Science.gov (United States)

    Lv, Ri-qing; Qian, Jun-kai; Zhao, Yong

    2018-03-01

    A simple, compact optical fiber magnetic field sensor is proposed and experimentally demonstrated in this paper. It is based on the magnetic-fluid-clad combined with singlemode-multimode-singlemode fiber structure and large core-offset splicing structure. It was protected by a section of capillary tube and was sealed by UV glue. A sensing property study of the combined optical fiber structure and the proposed sensor were carried out. The experimental results show that the sensitivity of the refractive index of the optical fiber sensing structure is up to 156.63 nm/RIU and the magnetic field sensitivity of the proposed sensor is up to -97.24 pm/Oe in the range from 72.4 Oe to 297.8 Oe. The proposed sensor has several other advantages, such as simple structure, small size, easy fabrication and low cost.

  3. Synthesis of composite nanoparticles using co-precipitation of a magnetic iron-oxide shell onto core nanoparticles

    International Nuclear Information System (INIS)

    Primc, Darinka; Belec, Blaž; Makovec, Darko

    2016-01-01

    Composite nanoparticles can be synthesized by coating a shell made of one material onto core nanoparticles made of another material. Here we report on a novel method for coating a magnetic iron oxide onto the surface of core nanoparticles in an aqueous suspension. The method is based on the heterogeneous nucleation of an initial product of Fe"3"+/Fe"2"+ co-precipitation on the core nanoparticles. The close control of the supersaturation of the precipitating species required for an exclusively heterogeneous nucleation and the growth of the shell were achieved by immobilizing the reactive Fe"3"+ ions in a nitrate complex with urea ([Fe((CO(NH_2)_2)_6](NO_3)_3) and by using solid Mg(OH)_2 as the precipitating reagent. The slow thermal decomposition of the complex at 60 °C homogeneously releases the reactive Fe"3"+ ions into the suspension of the core nanoparticles. The key stage of the process is the thermal hydrolysis of the released Fe"3"+ ions prior to the addition of Mg(OH)_2. The thermal hydrolysis results in the formation of γ-FeOOH, exclusively at the surfaces of the core nanoparticles. After the addition of the solid hydroxide Mg(OH)_2, the pH increases and at pH ~ 5.7 the Fe"2"+ precipitates and reacts with the γ-FeOOH to form magnetic iron oxide with a spinel structure (spinel ferrite) at the surfaces of the core nanoparticles. The proposed low-temperature method for the synthesis of composite nanoparticles is capable of forming well-defined interfaces between the two components, important for the coupling of the different properties. The procedure is environmentally friendly, inexpensive, and appropriate for scaling up to mass production.Graphical abstract

  4. The effect of magnetic field and donor impurity on electron spectrum in spherical core-shell quantum dot

    Science.gov (United States)

    Holovatsky, V. A.; Voitsekhivska, O. M.; Yakhnevych, M. Ya

    2018-04-01

    The effect of homogeneous magnetic field and location of donor impurity on the electron energy spectrum and distribution of its probability density in spherical core-shell quantum dot is investigated. In the framework of the effective mass approximation and rectangular infinitely deep potential well, the solutions of the Schrodinger equation are found using the matrix method. The wave functions are expanded over the complete set of exact functions obtained without the magnetic field and impurity. It is shown that when the induction of magnetic field increases, the ground state of electron in the nanostructure without impurity or on-center impurity is successively formed by the states with m = 0, -1, -2, … (Aharonov-Bohm effect). When donor impurity is located in the shell of the nanostructure the Aharonov-Bohm effect vanishes. The dependences of electron energy spectrum and its wave functions on the location of impurity, placed along the direction of magnetic field or perpendicularly to it, are studied. It is shown, that in the first case, the quantum states are characterized by the certain value of magnetic quantum number m and the expansion contains the wave functions of the states with it only. In the second case, the cylindrical symmetry of the problem is broken and the new quantum states are formed from the states with different values of all three quantum numbers n, l, m and electron energy spectrum weakly depends on the magnetic field induction.

  5. Real time magnetic field and flux measurements for tokamak control using a multi-core PCI Express system

    International Nuclear Information System (INIS)

    Giannone, L.; Schneider, W.; McCarthy, P.J.; Sips, A.C.C.; Treutterer, W.; Behler, K.; Eich, T.; Fuchs, J.C.; Hicks, N.; Kallenbach, A.; Maraschek, M.; Mlynek, A.; Neu, G.; Pautasso, G.; Raupp, G.; Reich, M.; Schuhbeck, K.H.; Stober, J.; Volpe, F.; Zehetbauer, T.

    2009-01-01

    The existing real time system for the position and shape control in ASDEX Upgrade has been extended to calculate magnetic flux surfaces in real time using a multi-core PCI Express system running LabVIEW RT. The availability of reflective memory for LabVIEW RT will allow this system to be connected to the control system and other diagnostics in a multi-platform real time network. The measured response of each magnetic probe to the individual poloidal field coil currents in the absence of plasma current is compared to the calculated value. Prior to a tokamak discharge this comparison can be used to check for failure of the magnetic probe, flux loop or integrator.

  6. Multiplet splitting of x-ray photoemission spectra core levels in magnetic metals

    International Nuclear Information System (INIS)

    Kowalczyk, S.P.; McFeely, F.R.; Ley, L.; Shirley, D.A.

    1975-01-01

    The results of high resolution x-ray photoemission studies of the multiplet splitting of the 3s core levels in the 3d transition metals and the 4s, 5s and 4d core levels in the lanthanide metals are reported

  7. A/C magnetic hyperthermia of melanoma mediated by iron(0)/iron oxide core/shell magnetic nanoparticles: a mouse study

    International Nuclear Information System (INIS)

    Balivada, Sivasai; Koper, Olga B; Tamura, Masaaki; Chikan, Viktor; Bossmann, Stefan H; Troyer, Deryl L; Rachakatla, Raja Shekar; Wang, Hongwang; Samarakoon, Thilani N; Dani, Raj Kumar; Pyle, Marla; Kroh, Franklin O; Walker, Brandon; Leaym, Xiaoxuan

    2010-01-01

    There is renewed interest in magnetic hyperthermia as a treatment modality for cancer, especially when it is combined with other more traditional therapeutic approaches, such as the co-delivery of anticancer drugs or photodynamic therapy. The influence of bimagnetic nanoparticles (MNPs) combined with short external alternating magnetic field (AMF) exposure on the growth of subcutaneous mouse melanomas (B16-F10) was evaluated. Bimagnetic Fe/Fe 3 O 4 core/shell nanoparticles were designed for cancer targeting after intratumoral or intravenous administration. Their inorganic center was protected against rapid biocorrosion by organic dopamine-oligoethylene glycol ligands. TCPP (4-tetracarboxyphenyl porphyrin) units were attached to the dopamine-oligoethylene glycol ligands. The magnetic hyperthermia results obtained after intratumoral injection indicated that micromolar concentrations of iron given within the modified core-shell Fe/Fe 3 O 4 nanoparticles caused a significant anti-tumor effect on murine B16-F10 melanoma with three short 10-minute AMF exposures. We also observed a decrease in tumor size after intravenous administration of the MNPs followed by three consecutive days of AMF exposure 24 hrs after the MNPs injection. These results indicate that intratumoral administration of surface modified MNPs can attenuate mouse melanoma after AMF exposure. Moreover, we have found that after intravenous administration of micromolar concentrations, these MNPs are capable of causing an anti-tumor effect in a mouse melanoma model after only a short AMF exposure time. This is a clear improvement to state of the art

  8. Fabrication, characterization and comparison of composite magnetic materials for high efficiency integrated voltage regulators with embedded magnetic core micro-inductors

    International Nuclear Information System (INIS)

    Bellaredj, Mohamed L F; Mueller, Sebastian; Davis, Anto K; Swaminathan, Madhavan; Mano, Yasuhiko; Kohl, Paul A

    2017-01-01

    High-efficiency integrated voltage regulators (IVRs) require the integration of power inductors, which have low loss and reduced size at very high frequency. The use of a magnetic material core can reduce significantly the inductor area and simultaneously increase the inductance. This paper focuses on the fabrication, characterization and modeling of nickel zinc (NiZn) ferrite and carbonyl iron powder (CIP)-epoxy magnetic composite materials, which are used as the magnetic core materials of embedded inductors in a printed wiring board (PWB) for a system in package (SIP) based buck type IVR. The fabricated composite materials and process are fully compatible with FR4 epoxy resin prepreg and laminate. For 85% weight loading of the magnetic powder (around 100 MHz at room temperature), the composite materials show a relative permeability of 7.5–8.1 for the NiZn ferrite composite and 5.2–5.6 for the CIP composite and a loss tangent value of 0.24–0.28 for the NiZn ferrite composite and 0.09–0.1 for the CIP-composite. The room temperature saturation flux density values are 0.1351 T and 0.5280 T for the NiZn ferrite and the CIP composites, respectively. The frequency dispersion parameters of the magnetic composites are modeled using a simplified Lorentz and Landau–Lifshitz–Gilbert equation for a Debye type relaxation. Embedded magnetic core solenoid inductors were designed based on the composite materials for the output filter of a high-efficiency SIP based buck type IVR. Evaluation of a SIP based buck type IVR with the designed inductors shows that it can reach peak efficiencies of 91.7% at 11 MHz for the NiZn ferrite-composite, 91.6% at 14 MHz for CIP-composite and 87.5% (NiZn ferrite-composite) and 87.3% (CIP-composite) efficiency at 100 MHz for a 1.7 V:1.05 V conversion. For a direct 5 V:1 V conversion using a stacked topology, a peak efficiency of 82% at 10 MHz and 72% efficiency at 100 MHz can be achieved for both materials. (paper)

  9. Fabrication, characterization and comparison of composite magnetic materials for high efficiency integrated voltage regulators with embedded magnetic core micro-inductors

    Science.gov (United States)

    Bellaredj, Mohamed L. F.; Mueller, Sebastian; Davis, Anto K.; Mano, Yasuhiko; Kohl, Paul A.; Swaminathan, Madhavan

    2017-11-01

    High-efficiency integrated voltage regulators (IVRs) require the integration of power inductors, which have low loss and reduced size at very high frequency. The use of a magnetic material core can reduce significantly the inductor area and simultaneously increase the inductance. This paper focuses on the fabrication, characterization and modeling of nickel zinc (NiZn) ferrite and carbonyl iron powder (CIP)-epoxy magnetic composite materials, which are used as the magnetic core materials of embedded inductors in a printed wiring board (PWB) for a system in package (SIP) based buck type IVR. The fabricated composite materials and process are fully compatible with FR4 epoxy resin prepreg and laminate. For 85% weight loading of the magnetic powder (around 100 MHz at room temperature), the composite materials show a relative permeability of 7.5-8.1 for the NiZn ferrite composite and 5.2-5.6 for the CIP composite and a loss tangent value of 0.24-0.28 for the NiZn ferrite composite and 0.09-0.1 for the CIP-composite. The room temperature saturation flux density values are 0.1351 T and 0.5280 T for the NiZn ferrite and the CIP composites, respectively. The frequency dispersion parameters of the magnetic composites are modeled using a simplified Lorentz and Landau-Lifshitz-Gilbert equation for a Debye type relaxation. Embedded magnetic core solenoid inductors were designed based on the composite materials for the output filter of a high-efficiency SIP based buck type IVR. Evaluation of a SIP based buck type IVR with the designed inductors shows that it can reach peak efficiencies of 91.7% at 11 MHz for the NiZn ferrite-composite, 91.6% at 14 MHz for CIP-composite and 87.5% (NiZn ferrite-composite) and 87.3% (CIP-composite) efficiency at 100 MHz for a 1.7 V:1.05 V conversion. For a direct 5 V:1 V conversion using a stacked topology, a peak efficiency of 82% at 10 MHz and 72% efficiency at 100 MHz can be achieved for both materials.

  10. Ultrafast magnetic vortex core switching driven by the topological inverse Faraday effect.

    Science.gov (United States)

    Taguchi, Katsuhisa; Ohe, Jun-ichiro; Tatara, Gen

    2012-09-21

    We present a theoretical discovery of an unconventional mechanism of inverse Faraday effect which acts selectively on topological magnetic structures. The effect, topological inverse Faraday effect, is induced by the spin Berry's phase of the magnetic structure when a circularly polarized light is applied. Thus a spin-orbit interaction is not necessary unlike that in the conventional inverse Faraday effect. We demonstrate by numerical simulation that topological inverse Faraday effect realizes ultrafast switching of a magnetic vortex within a switching time of 150 ps without magnetic field.

  11. Animal MRI Core

    Data.gov (United States)

    Federal Laboratory Consortium — The Animal Magnetic Resonance Imaging (MRI) Core develops and optimizes MRI methods for cardiovascular imaging of mice and rats. The Core provides imaging expertise,...

  12. Core@shell@shell structured carbon-based magnetic ternary nanohybrids: Synthesis and their enhanced microwave absorption properties

    Science.gov (United States)

    Yang, Erqi; Qi, Xiaosi; Xie, Ren; Bai, Zhongchen; Jiang, Yang; Qin, Shuijie; Zhong, Wei; Du, Youwei

    2018-05-01

    High encapsulation efficiency of core@shell@shell structured carbon-based magnetic ternary nanohybrids have been synthesized in high yield by chemical vapor deposition of acetylene directly over octahedral-shaped Fe2O3 nanoparticles. By controlling the pyrolysis temperature, Fe3O4@Fe3C@carbon nanotubes (CNTs) and Fe@Fe3C@CNTs ternary nanohybrids could be selectively produced. The optimal RL values for the as-prepared ternary nanohybrids could reach up to ca. -46.7, -52.7 and -29.5 dB, respectively. The excellent microwave absorption properties of the obtaiend ternary nanohybrids were proved to ascribe to the quarter-wavelength matching model. Moreover, the as-prepared Fe@Fe3C@CNTs ternary nanohybrids displayed remarkably enhanced EM wave absorption capabilities compared to Fe3O4@Fe3C@CNTs due to their excellent dielectric loss abilities, good complementarities between the dielectric loss and the magnetic loss, and high attenuation constant. Generally, this strategy can be extended to explore other categories of core@shell or core@shell@shell structured carbon-based nanohybrids, which is very beneficial to accelerate the advancements of high performance MAMs.

  13. Air core notch-coil magnet with variable geometry for fast-field-cycling NMR.

    Science.gov (United States)

    Kruber, S; Farrher, G D; Anoardo, E

    2015-10-01

    In this manuscript we present details on the optimization, construction and performance of a wide-bore (71 mm) α-helical-cut notch-coil magnet with variable geometry for fast-field-cycling NMR. In addition to the usual requirements for this kind of magnets (high field-to-power ratio, good magnetic field homogeneity, low inductance and resistance values) a tunable homogeneity and a more uniform heat dissipation along the magnet body are considered. The presented magnet consists of only one machined metallic cylinder combined with two external movable pieces. The optimal configuration is calculated through an evaluation of the magnetic flux density within the entire volume of interest. The magnet has a field-to-current constant of 0.728 mT/A, allowing to switch from zero to 0.125 T in less than 3 ms without energy storage assistance. For a cylindrical sample volume of 35 cm(3) the effective magnet homogeneity is lower than 130 ppm. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Superconducting superferric dipole magnet with cold iron core for the VLHC

    CERN Document Server

    Foster, G W

    2002-01-01

    Magnetic system of the stage I Very Large Hadron Collider (VLHC) is based on 2 Tesla superconducting magnets with combined functions. These magnets have a room temperature iron yoke with two 20 mm air gaps. Magnetic field in both horizontally separated air gaps is generated by a single, 100 kA superconducting transmission line. An alternative design with a cold iron yoke, horizontally or vertically separated air gaps is under investigation. The cold iron option with horizontally separated air gaps reduces the amount of iron, which is one of the major cost drivers for the 233-km magnet system of future accelerator. The vertical beam separation decreases the superconductor volume, heat load from the synchrotron radiation and eliminates fringe field from the return bus. Nevertheless, the horizontal beam separation provides lowest volume of the iron yoke and, therefore, smaller heat load on the cryogenic system during cooling down. All these options are discussed and compared in the paper. Superconducting correct...

  15. Development of an RF accelerating structure loaded with multi-ring magnetic cores

    International Nuclear Information System (INIS)

    Morita, Yuichi; Kageyama, Tatsuya; Kato, Ichiro; Yamashita, Satoru

    2012-01-01

    In order to upgrade the J-PARC rings (RCS and MR) for more beam powers, the existing accelerating structures for both rings need to be improved for better performance especially in the long-term reliability. As a solution for this purpose, we have proposed a new accelerating structure loaded with multi-ring core modules. Each core module consists of three ring FINEMET cores with different radial sizes concentrically arranged and sandwiched between two glass epoxy plates with flow channels grooved on the surfaces. The Fe-based FINEMET cores are to be cooled with the turbulent flow of Fluorinert (chemically inert perfluorinated liquid). Therefore, the cores need neither impregnation nor coating with epoxy resin for anti corrosion. A half-gap cavity loaded with three core modules, which is a minimum configuration for the performance test, is under fabrication. Additionally, a high efficient solid state RF amplifier is under development. Thirty two amplifier modules, each of which is a push-pull class-D amplifier driven by power MOSFET hybrids, are combined to deliver RF power up to 60 kW (peak power with a duty factor of 50%) at frequencies 1.7 ± 0.2MHz. The amplitude of the RF output can be modulated by changing the voltage across the drain and source of the power MOSFET in proportion to the wave envelope. This paper reports the recent status of our R and D activities. (author)

  16. Room-temperature synthesis of core-shell structured magnetic covalent organic frameworks for efficient enrichment of peptides and simultaneous exclusion of proteins.

    Science.gov (United States)

    Lin, Guo; Gao, Chaohong; Zheng, Qiong; Lei, Zhixian; Geng, Huijuan; Lin, Zian; Yang, Huanghao; Cai, Zongwei

    2017-03-28

    Core-shell structured magnetic covalent organic frameworks (Fe 3 O 4 @COFs) were synthesized via a facile approach at room temperature. Combining the advantages of high porosity, magnetic responsiveness, chemical stability and selectivity, Fe 3 O 4 @COFs can serve as an ideal absorbent for the highly efficient enrichment of peptides and the simultaneous exclusion of proteins from complex biological samples.

  17. Synthesis and characterization of fluorinated magnetic core-shell nanoparticles for inhibition of insulin amyloid fibril formation

    Energy Technology Data Exchange (ETDEWEB)

    Skaat, Hadas; Margel, Shlomo [Department of Chemistry, Bar-Ilan University, Ramat-Gan 52900 (Israel); Belfort, Georges [Howard P Isermann Department of Chemical and Biological Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)], E-mail: ch348@mail.biu.ac.il, E-mail: belfog@rpi.edu, E-mail: Shlomo.margel@mail.biu.ac.il

    2009-06-03

    Maghemite ({gamma}-Fe{sub 2}O{sub 3}) magnetic nanoparticles of 15.0 {+-} 2.1 nm are formed by nucleation followed by controlled growth of maghemite thin films on gelatin-iron oxide nuclei. Uniform magnetic {gamma}-Fe{sub 2}O{sub 3}/poly (2,2,3,3,4,4,4-heptafluorobutyl acrylate) ({gamma}-Fe{sub 2}O{sub 3}/PHFBA) core-shell nanoparticles are prepared by emulsion polymerization of the fluorinated monomer 2,2,3,3,4,4,4-heptafluorobutyl acrylate (HFBA) in the presence of the maghemite nanoparticles. The kinetics of the insulin fibrillation process in the absence and in the presence of the {gamma}-Fe{sub 2}O{sub 3}/PHFBA core-shell nanoparticles are elucidated. A significant direct slow transition from {alpha}-helix to {beta}-sheets during insulin fibril formation is observed in the presence of the {gamma}-Fe{sub 2}O{sub 3}/PHFBA nanoparticles. This is in contradiction to our previous manuscript, which illustrated that the {gamma}-Fe{sub 2}O{sub 3} core nanoparticles do not affect the kinetics of the formation of the insulin fibrils, and to other previous publications that describe acceleration of the fibrillation process by using various types of nanoparticles. These core-shell nanoparticles may therefore be also useful for the inhibition of conformational changes of other amyloidogenic proteins that lead to neurodegenerative diseases such as Alzheimer's, Parkinson's, Huntington's, mad cow and prion diseases.

  18. The design, fabrication and testing of an iron-core current compensated magnetic channel for cyclotron extraction

    International Nuclear Information System (INIS)

    Laxdale, R.E.; Fong, K.; Houtman, H.

    1994-06-01

    An iron-core current compensated magnetic channel has been built ss part of the TRIUMF 450 MeV H - extraction feasibility project. The channel would operate in the 0.5 T cyclotron field and was designed using the two-dimensional code POISSON. Recent beam tests with the channel installed in the TRIUMF cyclotron confirmed that the electro-mechanical design is reliable and that the effect on the circulating beam is in agreement with calculation. The design and hardware details will be described and the beam test results reported. (author)

  19. Local modification of the magnetic vortex-core velocity by gallium implantation

    Energy Technology Data Exchange (ETDEWEB)

    Langner, Hauke H., E-mail: hlangner@physnet.uni-hamburg.de; Vogel, Andreas; Beyersdorff, Björn [Institut für Angewandte Physik und Zentrum für Mikrostrukturforschung, Universität Hamburg, Jungiusstr. 11, 20355 Hamburg (Germany); Weigand, Markus [Max-Planck-Institut für Intelligente Systeme, Heisenbergstraße 3, 70596 Stuttgart (Germany); Frömter, Robert; Peter Oepen, Hans; Meier, Guido [Institut für Angewandte Physik und Zentrum für Mikrostrukturforschung, Universität Hamburg, Jungiusstr. 11, 20355 Hamburg (Germany); The Hamburg Centre for Ultrafast Imaging, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2014-03-14

    The dynamics of magnetic vortices in microsquares with local modifications of magnetic parameters and thickness are investigated. By implanting gallium ions with focussed ion beam into permalloy thin-film elements, we have locally tailored their magnetic properties and the layer thickness. The vortex of the Landau domain pattern of a square is resonantly excited to a gyrotropic motion and crosses regions with and without implantation. With time-resolved scanning transmission x-ray microscopy, we observe an abrupt change in the vortex velocity close to the borders between the two regions.

  20. Large-Scale Flows and Magnetic Fields Produced by Rotating Convection in a Quasi-Geostrophic Model of Planetary Cores

    Science.gov (United States)

    Guervilly, C.; Cardin, P.

    2017-12-01

    Convection is the main heat transport process in the liquid cores of planets. The convective flows are thought to be turbulent and constrained by rotation (corresponding to high Reynolds numbers Re and low Rossby numbers Ro). Under these conditions, and in the absence of magnetic fields, the convective flows can produce coherent Reynolds stresses that drive persistent large-scale zonal flows. The formation of large-scale flows has crucial implications for the thermal evolution of planets and the generation of large-scale magnetic fields. In this work, we explore this problem with numerical simulations using a quasi-geostrophic approximation to model convective and zonal flows at Re 104 and Ro 10-4 for Prandtl numbers relevant for liquid metals (Pr 0.1). The formation of intense multiple zonal jets strongly affects the convective heat transport, leading to the formation of a mean temperature staircase. We also study the generation of magnetic fields by the quasi-geostrophic flows at low magnetic Prandtl numbers.

  1. Magnetic properties of variably serpentinized peridotites and their implication for the evolution of oceanic core complexes

    NARCIS (Netherlands)

    Maffione, M.; Morris, A.; Plümper, O.|info:eu-repo/dai/nl/37155960X; van Hinsbergen, D.J.J.|info:eu-repo/dai/nl/269263624

    Serpentinization of ultramafic rocks during hydrothermal alteration at mid-ocean ridges profoundly changes the physical, chemical, rheological, and magnetic properties of the oceanic lithosphere. There is renewed interest in this process following the discovery of widespread exposures of

  2. Nano-magnetic particles used in biomedicine: core and coating materials.

    Science.gov (United States)

    Karimi, Z; Karimi, L; Shokrollahi, H

    2013-07-01

    Magnetic nanoparticles for medical applications have been developed by many researchers. Separation, immunoassay, drug delivery, magnetic resonance imaging and hyperthermia are enhanced by the use of suitable magnetic nanoparticles and coating materials in the form of ferrofluids. Due to their low biocompatibility and low dispersion in water solutions, nanoparticles that are used for biomedical applications require surface treatment. Various kinds of coating materials including organic materials (polymers), inorganic metals (gold, platinum) or metal oxides (aluminum oxide, cobalt oxide) have been attracted during the last few years. Based on the recent advances and the importance of nanomedicine in human life, this paper attempts to give a brief summary on the different ferrite nano-magnetic particles and coatings used in nanomedicine. Copyright © 2013 Elsevier B.V. All rights reserved.

  3. Structural and magnetic properties of CoO-Pt core-shell nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Zeleňáková, A.; Zeleňák, V.; Michalik, Štefan; Kováč, J.; Meisel, M. W.

    2014-01-01

    Roč. 89, č. 10 (2014), "104417-1"-"104417-10" ISSN 1098-0121 Institutional support: RVO:68378271 Keywords : CoO-Pt core shell nanoparticles * superparamagnetism * superspin glass state * x-ray diffraction * x-ray absorption spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.736, year: 2014

  4. Magnetic fingerprint in marine sediments: clues from cultivated Magnetovibrio blakemorei and recent cores from Brazilian Coast

    Science.gov (United States)

    Jovane, L.; Florindo, F.; Bazylinski, D. A.; Pellizari, V. H.; Brandini, F. P.; de Almeida, L. A.; Carneiro, F. R.; Braga, E. D.; Lins, U.

    2013-12-01

    The magnetic properties (first order reversal curves, ferromagnetic resonance and decomposition of saturation remanent magnetization acquisition) of Magnetovibrio blakemorei strain MV-1, a marine magnetotactic bacterium, differ from those of other magnetotactic species from sediments deposited in lakes and marine habitats previously studied. This finding suggests that magnetite produced by some magnetotactic bacteria retains magnetic properties in relation to the crystallographic structure of the magnetic phase produced and thus might represent a 'magnetic fingerprint' for a specific magnetotactic bacterium. The technique used to determine this fingerprint is a non-destructive, new technology that might allow for the identification and presence of specific species or types of magnetotactic bacteria in certain environments such as sediment. We also show some preliminary results on the biogeochemical factors that control magnetotactic bacterial populations, documenting the environment and the preservation of bacterial magnetite, which dominates the palaeomagnetic signal throughout recent sediments from Brazilian Coast. We searched for magnetotactic bacteria in order to understand the ecosystems and environmental change related to their presence in sediments. We focused on studying the environmental conditions that allow for the presence of magnetotactic bacteria and magnetosomes in sediments including determining magnetotactic bacterial populations in marine settings, measuring crucial nutrient availability in the water column and in sediments, and examining particulate delivery to the seafloor.

  5. A/C magnetic hyperthermia of melanoma mediated by iron(0/iron oxide core/shell magnetic nanoparticles: a mouse study

    Directory of Open Access Journals (Sweden)

    Koper Olga B

    2010-03-01

    Full Text Available Abstract Background There is renewed interest in magnetic hyperthermia as a treatment modality for cancer, especially when it is combined with other more traditional therapeutic approaches, such as the co-delivery of anticancer drugs or photodynamic therapy. Methods The influence of bimagnetic nanoparticles (MNPs combined with short external alternating magnetic field (AMF exposure on the growth of subcutaneous mouse melanomas (B16-F10 was evaluated. Bimagnetic Fe/Fe3O4 core/shell nanoparticles were designed for cancer targeting after intratumoral or intravenous administration. Their inorganic center was protected against rapid biocorrosion by organic dopamine-oligoethylene glycol ligands. TCPP (4-tetracarboxyphenyl porphyrin units were attached to the dopamine-oligoethylene glycol ligands. Results The magnetic hyperthermia results obtained after intratumoral injection indicated that micromolar concentrations of iron given within the modified core-shell Fe/Fe3O4 nanoparticles caused a significant anti-tumor effect on murine B16-F10 melanoma with three short 10-minute AMF exposures. We also observed a decrease in tumor size after intravenous administration of the MNPs followed by three consecutive days of AMF exposure 24 hrs after the MNPs injection. Conclusions These results indicate that intratumoral administration of surface modified MNPs can attenuate mouse melanoma after AMF exposure. Moreover, we have found that after intravenous administration of micromolar concentrations, these MNPs are capable of causing an anti-tumor effect in a mouse melanoma model after only a short AMF exposure time. This is a clear improvement to state of the art.

  6. From clouds to cores to envelopes to disks: a multi-scale view of magnetized star formation

    Science.gov (United States)

    Hull, Charles; Plambeck, R. L.; TADPOL survey Team

    2014-01-01

    Magnetic fields are thought to play an important role in the formation of stars. However, that importance has been called into question by previous observations showing misalignment between protostellar outflows and magnetic fields (B-fields), as well as inconsistency in field morphology between 10,000 and 1000 AU scales. To investigate these inconsistencies, we used the 1.3 mm full-Stokes polarimeter — which I tested, installed, and calibrated for CARMA, a mm-wave interferometer — to map dust polarization with ~2.5" resolution toward 29 star-forming cores and 8 star-forming regions as part of the TADPOL survey. We find that a subset of the sources have consistent B-field orientations between the large 20") scales measured by single-dish submm bolometers and the small scales measured by CARMA. Those same sources also tend to have higher fractional polarizations (measured by CARMA), presumably because the B-fields are less twisted by dynamic effects. However, even in these sources, which seem to have retained the memory of the global B-field direction, the fields in the cores are misaligned with the disks and outflows in the central protostars — a key result of the TADPOL survey. Furthermore, the cores with lower polarization fractions tend to have B-fields that are perpendicular to outflows, which suggests that in these sources the B-fields have lost the memory of the larger-scale global field, and have been wrapped up by core rotation. This is an important result for disk formation theory, as it suggests that field misalignment may indeed be the solution to the magnetic braking catastrophe. Finally, we find that all sources exhibit the so-called “polarization hole” effect, where the polarization drops significantly near the total intensity peak. When this effect was seen in low-resolution single-dish maps, it was attributed to the averaging of unresolved structure in the plane of the sky. However, the higher resolution maps we present here resolve these

  7. Combining X-Ray Fluorescence and Magnetic Techniques to Quantify Elemental Concentrations in Coral Cores from Belize

    Science.gov (United States)

    Goldfarb, L. A.; Kingsley, C.; Urbalejo, A. A.; Hangsterfer, A.; Gee, J. S.; Carilli, J.; Feinberg, J. M.; Mitra, R.; Bhattacharya, A.; Field, D.

    2017-12-01

    Caribbean coral reefs are some of the most threatened marine ecosystems in the world. Research suggest that environmental stressors of local origin, such as sediment run off, can reduce the resilience of these reefs to global threats such as ocean warming. Material trapped in coral skeletons can provide information on the sources of particulate matter in the ocean ecosystem. Despite the importance of quantifying sources and types of materials trapped in corals, the research community is yet to fully develop techniques that allow accurate representation of trapped matter, which is potentially a major source of metal content in reef building coral skeletons. The dataset presented here is a progress and combination of two works presented at American Geophysical Union 2016 Fall Meeting; In this research, we explore the efficacy of X-Ray Fluorescence (XRF), a widely used tool in environmental studies (but generally not in corals), to estimate detrital metal content in coral cores collected from four locations near Belize, with varying degrees of impact from coastal processes. Four coral cores together cover a period of 1862-2006. Trace, major and minor metal content from these cores have been well-studied using solution-based ICP-MS, providing us with the unique opportunity to test the efficacy of XRF technique in characterizing metal content in these coral cores. We have measured more than 50 metals using XRF every two millimeters along slabs removed from the middle of a coral core spanning to characterize materials present in coral skeletons. We compare the results from XRF to elemental concentrations reported from solution-based ICP-MS. Furthermore, we also compare our XRF data to magnetic measurements we have made in these same coral cores. Overall, it appears that the non-destructive XRF technique is a viable supplement to the ICP-MS in determining sediment and metal content in coral cores, and may be particularly helpful for assessing resistant phases such as

  8. Transformer core

    NARCIS (Netherlands)

    Mehendale, A.; Hagedoorn, Wouter; Lötters, Joost Conrad

    2008-01-01

    A transformer core includes a stack of a plurality of planar core plates of a magnetically permeable material, which plates each consist of a first and a second sub-part that together enclose at least one opening. The sub-parts can be fitted together via contact faces that are located on either side

  9. Transformer core

    NARCIS (Netherlands)

    Mehendale, A.; Hagedoorn, Wouter; Lötters, Joost Conrad

    2010-01-01

    A transformer core includes a stack of a plurality of planar core plates of a magnetically permeable material, which plates each consist of a first and a second sub-part that together enclose at least one opening. The sub-parts can be fitted together via contact faces that are located on either side

  10. Demonstration of the self-magnetic-pinch diode as an X-ray source for flash core-punch radiography

    International Nuclear Information System (INIS)

    Cordova, Steve Ray; Rovang, Dean Curtis; Portillo, Salvador; Oliver, Bryan Velten; Bruner, Nichelle Lee; Ziska, Derek Raymond

    2007-01-01

    Minimization of the radiographic spot size and maximization of the radiation dose is a continuing long-range goal for development of electron beam driven X-ray radiography sources. In collaboration with members of the Atomic Weapons Establishment(AWE), Aldermaston UK, the Advanced Radiographic Technologies Dept. 1645 is conducting research on the development of X-ray sources for flash core-punch radiography. The Hydrodynamics Dept. at AWE has defined a near term radiographic source requirement for scaled core-punch experiments to be 250 rads(at)m with a 2.75 mm source spot-size. As part of this collaborative effort, Dept. 1645 is investigating the potential of the Self-Magnetic-Pinched (SMP) diode as a source for core-punch radiography. Recent experiments conducted on the RITS-6 accelerator [1,2] demonstrated the potential of the SMP diode by meeting and exceeding the near term radiographic requirements established by AWE. During the demonstration experiments, RITS-6 was configured with a low-impedance (40 (Omega)) Magnetically Insulated Transmission Line (MITL), which provided a 75-ns, 180-kA, 7.5-MeV forward going electrical pulse to the diode. The use of a low-impedance MITL enabled greater power coupling to the SMP diode and thus allowed for increased radiation output. In addition to reconfiguring the driver (accelerator), geometric changes to the diode were also performed which allowed for an increase in dose production without sacrificing the time integrated spot characteristics. The combination of changes to both the pulsed power driver and the diode significantly increased the source x-ray intensity

  11. Magnetization-induced enhancement of photoluminescence in core-shell CoFe{sub 2}O{sub 4}@YVO{sub 4}:Eu{sup 3+} composite

    Energy Technology Data Exchange (ETDEWEB)

    Jia, Yanmin, E-mail: ymjia@zjnu.edu.cn, E-mail: wuzheng@zjnu.cn; Zhou, Zhihua; Wei, Yongbin [Department of Physics, Zhejiang Normal University, Jinhua 321004 (China); Wu, Zheng, E-mail: ymjia@zjnu.edu.cn, E-mail: wuzheng@zjnu.cn; Chen, Jianrong [College of Geography and Environmental Sciences, Zhejiang Normal University, Jinhua 321004 (China); Zhang, Yihe [School of Materials Science and Technology, China University of Geosciences, Beijing 100083 (China); Liu, Yongsheng [Department of Physics, Shanghai University of Electric Power, Shanghai 200090 (China)

    2013-12-07

    After the core-shell CoFe{sub 2}O{sub 4}@YVO{sub 4}:Eu{sup 3+} composite synthesized through a facile sol-gel method was magnetized under an external magnetic field of 0.25 T for 4 h, an enhancement of ∼56% in photoluminescence intensity was observed. The remanent magnetization of the CoFe{sub 2}O{sub 4} core increases the intensity of the excited charge transfer transition of VO{sub 4}{sup 3−} group in YVO{sub 4}:Eu{sup 3+} shell, which may enhance the probability related to the Eu{sup 3+} radiative transition {sup 5}D{sub 0}-{sup 7}F{sub 2}, yielding to a high photoluminescence. The obvious remanent-magnetization-induced enhancement in photoluminescence is helpful in developing excellent magnetic/luminescent material for the practical display devices.

  12. r-Process nucleosynthesis from three-dimensional jet-driven core-collapse supernovae with magnetic misalignments

    Science.gov (United States)

    Halevi, Goni; Mösta, Philipp

    2018-06-01

    We investigate r-process nucleosynthesis in three-dimensional general relativistic magnetohydrodynamic simulations of jet-driven supernovae resulting from rapidly rotating, strongly magnetized core-collapse. We explore the effect of misaligning the pre-collapse magnetic field with respect to the rotation axis by performing four simulations: one aligned model and models with 15°, 30°, and 45° misalignments. The simulations we present employ a microphysical finite-temperature equation of state and a leakage scheme that captures the overall energetics and lepton number exchange due to post-bounce neutrino emission and absorption. We track the thermodynamic properties of the ejected material with Lagrangian tracer particles and analyse its composition with the nuclear reaction network SKYNET. By using different neutrino luminosities in post-processing the tracer data with SKYNET, we constrain the impact of uncertainties in neutrino luminosities. We find that, for the aligned model considered here, the use of an approximate leakage scheme results in neutrino luminosity uncertainties corresponding to a factor of 100-1000 uncertainty in the abundance of third peak r-process elements. Our results show that for misalignments of 30° or less, r-process elements are robustly produced as long as neutrino luminosities are reasonably low (≲ 5 × 1052 erg s-1). For a more extreme misalignment of 45°, we find the production of r-process elements beyond the second peak significantly reduced. We conclude that robust r-process nucleosynthesis in magnetorotational supernovae requires a progenitor stellar core with a large poloidal magnetic field component that is at least moderately (within ˜30°) aligned with the rotation axis.

  13. [Adsorption of Cu on Core-shell Structured Magnetic Particles: Relationship Between Adsorption Performance and Surface Properties].

    Science.gov (United States)

    Li, Qiu-mei; Chen, Jing; Li, Hai-ning; Zhang, Xiao-lei; Zhang, Gao-sheng

    2015-12-01

    In order to reveal the relationship between the adsorption performance of adsorbents and their compositions, structure, and surface properties, the core-shell structured Fe₃O₄/MnO2 and Fe-Mn/Mn₂2 magnetic particles were systematically characterized using multiple techniques and their Cu adsorption behaviors as well as mechanism were also investigated in details. It was found that both Fe₃O4 and Fe-Mn had spinel structure and no obvious crystalline phase change was observed after coating with MnO₂. The introduction of Mn might improve the affinity between the core and the shell, and therefore enhanced the amount and distribution uniformity of the MnO₂ coated. Consequently, Fe-Mn/MnO₂ exhibited a higher BET specific surface area and a lower isoelectric point. The results of sorption experiments showed that Fe-Mn had a higher maximal Cu adsorption capacity of 33.7 mg · g⁻¹ at pH 5.5, compared with 17.5 mg · g⁻¹ of Fe₃O4. After coating, the maximal adsorption capacity of Fe-Mn/MnO₂ was increased to 58.2 mg · g⁻¹, which was 2.6 times as high as that of Fe₃O₄/MnO₂ and outperformed the majority of magnetic adsorbents reported in literature. In addition, a specific adsorption of Cu occurred at the surface of Fe₃O₄/MnO₂ or Fe-Mn/MnO₂ through the formation of inner-sphere complexes. In conclusion, the adsorption performance of the magnetic particles was positively related to their compositions, structure, and surface properties.

  14. 87Sr/86Sr dating and preliminary interpretation of magnetic susceptibility logs of giant piston cores from the Rio Grande Rise in the South Atlantic

    Science.gov (United States)

    Lacasse, Christian Michel; Santos, Roberto Ventura; Dantas, Elton Luiz; Vigneron, Quentin; de Sousa, Isabela Moreno Cordeiro; Harlamov, Vadim; Lisniowski, Maria Aline; Pessanha, Ivo Bruno Machado; Frazão, Eugênio Pires; Cavalcanti, José Adilson Dias

    2017-12-01

    Giant piston cores recovered from shallow depths (optimized matching with an internationally recognized timescale of 87Sr/86Sr seawater variation through geological times. Depth-to-age conversion of the magnetic susceptibility logs was implemented based on the identification of correlative peaks between cores and the developed 87Sr/86Sr age model. The influence of Northern Hemisphere glaciation is reflected in these new stratigraphic logs by a gradual increase from ∼2.7 Ma in the lower signal of magnetic susceptibility (below background level), to values approaching the arithmetic means, likely reflecting an overall increase in terrigenous input. The Rio Grande Rise cores have very low Plio-Pleistocene sedimentation rates (∼0.4-0.8 cm/ka), similar to gravity cores from the oligotrophic subtropical South Atlantic (below ∼2000 mbsl), and for which an inverse correlation between carbonate content and magnetic susceptibility was established. The coring depths on the Rio Grande Rise encompass strong gradients in oxygen concentration and other seawater parameters that define today's AAIW/UCDW transition. Depth-dependent variation in sedimentation rates since the onset of Northern Hemisphere glaciation coincides with the incursion of intermediate waters (UCDW, AAIW) in response to the overall reduction of NADW export to the Southern Ocean. Background levels of magnetic susceptibility in the cores suggest that this variation is mainly attributed to terrigenous input. The source region of this material has yet to be traced by considering in particular the mineral composition and paramagnetic properties of the detrital clays.

  15. Series expansion of two-dimensional fields produced by iron-core magnets

    International Nuclear Information System (INIS)

    Satoh, Kotaro.

    1997-02-01

    This paper discusses the validity of a series expansion of two-dimensional magnetic fields with harmonic functions, and suggests that the series may not converge outside of the pole gap. It also points out that this difficulty may appear due to a slow convergence of the series near to the pole edge, even within the convergent area. (author)

  16. Effect of particle-core-vibration coupling near the double closed $^{132}$Sn nucleus from precise magnetic moment measurements

    CERN Multimedia

    Postma, H; Heyde, K; Walker, P; Grant, I; Veskovic, M; Stone, N; Stone, J

    2002-01-01

    % IS301 \\\\ \\\\ Low temperature nuclear orientation of isotope-separator implanted short-lived radio-isotopes makes possible the measurements of nuclear magnetic dipole moments of oriented ground and excited states with half-lives longer than a few seconds. Coupling schemes characterizing the odd nucleons and ground-state deformations can be extracted from the nuclear moments. \\\\ We thus propose to measure the magnetic dipole moments of $^{127-133}$Sb to high precision using NMR/ON at the NICOLE facility. With (double magic +1) $^{133}$Sb as the reference, the main aim of this experiment is to examine whether the collective component in the 7/2$^+$ Sb ground state magnetic dipole moment varies as expected according to particle-core coupling calculations carried out for the Sb (Z=51) isotopes. Comparison of the 1-proton-particle excitations in Sb to 1-proton-hole states in In nuclei will shed light on differences between particle and hole excitations as understood within the present model. Comparison of ...

  17. Spin transfer driven resonant expulsion of a magnetic vortex core for efficient rf detector

    Directory of Open Access Journals (Sweden)

    S. Menshawy

    2017-05-01

    Full Text Available Spin transfer magnetization dynamics have led to considerable advances in Spintronics, including opportunities for new nanoscale radiofrequency devices. Among the new functionalities is the radiofrequency (rf detection using the spin diode rectification effect in spin torque nano-oscillators (STNOs. In this study, we focus on a new phenomenon, the resonant expulsion of a magnetic vortex in STNOs. This effect is observed when the excitation vortex radius, due to spin torques associated to rf currents, becomes larger than the actual radius of the STNO. This vortex expulsion is leading to a sharp variation of the voltage at the resonant frequency. Here we show that the detected frequency can be tuned by different parameters; furthermore, a simultaneous detection of different rf signals can be achieved by real time measurements with several STNOs having different diameters. This result constitutes a first proof-of-principle towards the development of a new kind of nanoscale rf threshold detector.

  18. Efficient multiscale magnetic-domain analysis of iron-core material under mechanical stress

    Science.gov (United States)

    Nishikubo, Atsushi; Ito, Shumpei; Mifune, Takeshi; Matsuo, Tetsuji; Kaido, Chikara; Takahashi, Yasuhito; Fujiwara, Koji

    2018-05-01

    For an efficient analysis of magnetization, a partial-implicit solution method is improved using an assembled domain structure model with six-domain mesoscopic particles exhibiting pinning-type hysteresis. The quantitative analysis of non-oriented silicon steel succeeds in predicting the stress dependence of hysteresis loss with computation times greatly reduced by using the improved partial-implicit method. The effect of cell division along the thickness direction is also evaluated.

  19. Characterization of magnetic core-shell nanoparticles by fluxgate magnetorelaxometry, ac susceptibility, transmission electron microscopy and photon correlation spectroscopy-A comparative study

    International Nuclear Information System (INIS)

    Ludwig, Frank; Heim, Erik; Schilling, Meinhard

    2009-01-01

    We have compared the structure parameters of magnetic core-shell nanoparticles determined from fluxgate magnetorelaxometry measurements applying the moment superposition model with the results from other methods. For the characterization of the magnetic cores, the nanoparticles are immobilized by freeze-drying. The core size distribution estimated for superparamagnetic Fe 3 O 4 magnetic nanoparticles (MNPs) with polyacrylic acid shell agrees well with that from transmission electron microscopy measurements. The distribution of hydrodynamic diameters of nanoparticle suspensions estimated from magnetorelaxometry measurements is in good agreement with that obtained from ac susceptibility and photon correlation spectroscopy measurements. Advantages of magnetorelaxometry compared to the other two integral techniques are that it is fast and the signal is less dominated by larger particles.

  20. 'Smart' Diblock Copolymers as Templates for Magnetic-Core Gold-Shell Nanoparticle Synthesis

    International Nuclear Information System (INIS)

    Nash, Michael A.; Lai, James J.; Hoffman, Allan S.; Yager, Paul; Stayton, Partick S.

    2010-01-01

    We report a new strategy for synthesizing temperature-responsive γ-Fe 2 O 3 -core/Au-shell nanoparticles (Au-mNPs) from diblock copolymer micelles. The amphiphilic diblock copolymer chains were synthesized using reversible addition-fragmentation chain-transfer (RAFT) with a thermally responsive 'smart' poly(N-isopropylacrylamide) (pNIPAAm) block and an amine-containing poly(N,N-dimethylaminoethylacrylamide) (DMAEAm) block that acted as a reducing agent during gold shell formation. The Au-mNPs reversibly aggregated upon heating the solution above the transition temperature of pNIPAAm, resulting in a red-shifted localized surface plasmon resonance.

  1. Nuclear spins, magnetic moments and quadrupole moments of Cu isotopes from N = 28 to N = 46: probes for core polarization effects

    CERN Document Server

    Vingerhoets, P; Avgoulea, M; Billowes, J; Bissell, M L; Blaum, K; Brown, B A; Cheal, B; De Rydt, M; Forest, D H; Geppert, Ch; Honma, M; Kowalska, M; Kramer, J; Krieger, A; Mane, E; Neugart, R; Neyens, G; Nortershauser, W; Otsuka, T; Schug, M; Stroke, H H; Tungate, G; Yordanov, D T

    2010-01-01

    Measurements of the ground-state nuclear spins, magnetic and quadrupole moments of the copper isotopes from 61Cu up to 75Cu are reported. The experiments were performed at the ISOLDE facility, using the technique of collinear laser spectroscopy. The trend in the magnetic moments between the N=28 and N=50 shell closures is reasonably reproduced by large-scale shell-model calculations starting from a 56Ni core. The quadrupole moments reveal a strong polarization of the underlying Ni core when the neutron shell is opened, which is however strongly reduced at N=40 due to the parity change between the $pf$ and $g$ orbits. No enhanced core polarization is seen beyond N=40. Deviations between measured and calculated moments are attributed to the softness of the 56Ni core and weakening of the Z=28 and N=28 shell gaps.

  2. Jingle-bell-shaped ferrite hollow sphere with a noble metal core: Simple synthesis and their magnetic and antibacterial properties

    Science.gov (United States)

    Li, Siheng; Wang, Enbo; Tian, Chungui; Mao, Baodong; Kang, Zhenhui; Li, Qiuyu; Sun, Guoying

    2008-07-01

    In this paper, a simple strategy is developed for rational fabrication of a class of jingle-bell-shaped hollow structured nanomaterials marked as Ag@ MFe 2O 4 ( M=Ni, Co, Mg, Zn), consisting of ferrite hollow shells and metal nanoparticle cores, using highly uniform colloidal Ag@C microspheres as template. The final composites were obtained by direct adsorption of metal cations Fe 3+ and M 2+ on the surface of the Ag@C spheres followed by calcination process to remove the middle carbon shell and transform the metal ions into pure phase ferrites. The as-prepared composites were characterized by X-ray photoelectron spectroscopy (XPS), energy-dispersive X-ray analysis (EDX), X-ray powder diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV-vis spectroscopy and SQUID magnetometer. The results showed that the composites possess the magnetic property of the ferrite shell and the optical together with antibacterial property of the Ag core.

  3. Towards real-time cardiovascular magnetic resonance guided transarterial CoreValve implantation: in vivo evaluation in swine

    Science.gov (United States)

    2012-01-01

    Background Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media. PMID:22453050

  4. Towards real-time cardiovascular magnetic resonance guided transarterial CoreValve implantation: in vivo evaluation in swine.

    Science.gov (United States)

    Kahlert, Philipp; Parohl, Nina; Albert, Juliane; Schäfer, Lena; Reinhardt, Renate; Kaiser, Gernot M; McDougall, Ian; Decker, Brad; Plicht, Björn; Erbel, Raimund; Eggebrecht, Holger; Ladd, Mark E; Quick, Harald H

    2012-03-27

    Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.

  5. Towards real-time cardiovascular magnetic resonance guided transarterial CoreValve implantation: in vivo evaluation in swine

    Directory of Open Access Journals (Sweden)

    Kahlert Philipp

    2012-03-01

    Full Text Available Abstract Background Real-time cardiovascular magnetic resonance (rtCMR is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2 and transsubclavian (n = 6 TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.

  6. SUBMILLIMETER ARRAY OBSERVATIONS OF MAGNETIC FIELDS IN G240.31+0.07: AN HOURGLASS IN A MASSIVE CLUSTER-FORMING CORE

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, Keping [School of Astronomy and Space Science, Nanjing University, 22 Hankou Road, Nanjing 210093 (China); Zhang, Qizhou [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Menten, Karl M. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Liu, Hauyu B.; Tang, Ya-Wen [Academia Sinica Institute of Astronomy and Astrophysics, P. O. Box 23-141, Taipei 106, Taiwan (China); Girart, Josep M., E-mail: kpqiu@nju.edu.cn [Institut de Ciències de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciències, C5p 2, E-08193 Bellaterra, Catalonia (Spain)

    2014-10-10

    We report the first detection of an hourglass magnetic field aligned with a well-defined outflow rotation system in a high-mass, star-forming region. The observations were performed with the Submillimeter Array toward G240.31+0.07, which harbors a massive, flattened, and fragmenting molecular cloud core and a wide-angle bipolar outflow. The polarized dust emission at 0.88 mm reveals a clear hourglass-shaped magnetic field aligned within 20° of the outflow axis. Maps of high-density tracing spectral lines, e.g., H{sup 13}CO{sup +} (4-3), show that the core is rotating about its minor axis, which is also aligned with the magnetic field axis. Therefore, both the magnetic field and kinematic properties observed in this region are surprisingly consistent with the theoretical predictions of the classic paradigm of isolated low-mass star formation. The strength of the magnetic field in the plane of sky is estimated to be ∼1.1 mG, resulting in a mass-to-magnetic flux ratio of 1.4 times the critical value and a turbulent-to-ordered magnetic energy ratio of 0.4. We also find that the specific angular momentum almost linearly decreases from r ∼ 0.6 pc to 0.03 pc scales, which is most likely attributed to magnetic braking.

  7. SUBMILLIMETER ARRAY OBSERVATIONS OF MAGNETIC FIELDS IN G240.31+0.07: AN HOURGLASS IN A MASSIVE CLUSTER-FORMING CORE

    International Nuclear Information System (INIS)

    Qiu, Keping; Zhang, Qizhou; Menten, Karl M.; Liu, Hauyu B.; Tang, Ya-Wen; Girart, Josep M.

    2014-01-01

    We report the first detection of an hourglass magnetic field aligned with a well-defined outflow rotation system in a high-mass, star-forming region. The observations were performed with the Submillimeter Array toward G240.31+0.07, which harbors a massive, flattened, and fragmenting molecular cloud core and a wide-angle bipolar outflow. The polarized dust emission at 0.88 mm reveals a clear hourglass-shaped magnetic field aligned within 20° of the outflow axis. Maps of high-density tracing spectral lines, e.g., H 13 CO + (4-3), show that the core is rotating about its minor axis, which is also aligned with the magnetic field axis. Therefore, both the magnetic field and kinematic properties observed in this region are surprisingly consistent with the theoretical predictions of the classic paradigm of isolated low-mass star formation. The strength of the magnetic field in the plane of sky is estimated to be ∼1.1 mG, resulting in a mass-to-magnetic flux ratio of 1.4 times the critical value and a turbulent-to-ordered magnetic energy ratio of 0.4. We also find that the specific angular momentum almost linearly decreases from r ∼ 0.6 pc to 0.03 pc scales, which is most likely attributed to magnetic braking

  8. Fabrication of Alkoxyamine-Functionalized Magnetic Core-Shell Microspheres via Reflux Precipitation Polymerization for Glycopeptide Enrichment

    Directory of Open Access Journals (Sweden)

    Meng Yu

    2016-03-01

    Full Text Available As a facile method to prepare hydrophilic polymeric microspheres, reflux precipitation polymerization has been widely used for preparation of polymer nanogels. In this article, we synthesized a phthalamide-protected N-aminooxy methyl acrylamide (NAMAm-p for preparation of alkoxyamine-functionalized polymer composite microspheres via reflux precipitation polymerization. The particle size and functional group density of the composite microspheres could be adjusted by copolymerization with the second monomers, N-isopropyl acrylamide, acrylic acid or 2-hydroxyethyl methacrylate. The resultant microspheres have been characterized by TEM, FT-IR, TGA and DLS. The experimental results showed that the alkoxyamine group density of the microspheres could reach as high as 1.49 mmol/g, and these groups showed a great reactivity with ketone/aldehyde compounds. With the aid of magnetic core, the hybrid microspheres could capture and magnetically isolate glycopeptides from the digested mixture of glycopeptides and non-glycopeptides at a 1:100 molar ratio. After that, we applied the composite microspheres to profile the glycol-proteome of a normal human serum sample, 95 unique glycopeptides and 64 glycoproteins were identified with these enrichment substrates in a 5 μL of serum sample.

  9. Copper Ferrocyanide Functionalized Core-Shell Magnetic Silica Composites for the Selective Removal of Cesium Ions from Radioactive Liquid Waste.

    Science.gov (United States)

    Lee, Hyun Kyu; Yang, Da Som; Oh, Wonzin; Choi, Sang-June

    2016-06-01

    The copper ferrocyanide functionalized core-shell magnetic silica composite (mag@silica-CuFC) was prepared and was found to be easily separated from aqueous solutions by using magnetic field. The synthesized mag@silica-CuFC composite has a high sorption ability of Cs owing to its strong affinity for Cs as well as the high surface area of the supports. Cs sorption on the mag@silica-CuFC composite quickly reached the sorption equilibrium after 2 h of contact time. The effect of the presence of salts with a high concentration of up to 3.5 wt% on the efficiency of Cs sorption onto the composites was also studied. The maximum sorption ability was found to be maintained in the presence of up to 3.5 wt% of NaCl in the solution. Considering these results, the mag@silica-CuFC composite has great potential for use as an effective sorbent for the selective removal of radioactive Cs ions.

  10. Simple and efficient synthesis of copper(II)-modified uniform magnetic Fe3O4@SiO2 core/shell microspheres for immobilization of cellulase

    Science.gov (United States)

    Li, Shi-Kuo; Hou, Xiao-Cheng; Huang, Fang-Zhi; Li, Chuan-Hao; Kang, Wen-Juan; Xie, An-Jian; Shen, Yu-Hua

    2013-11-01

    In this paper, we reported a simple and efficient protocol for preparation of Cu2+-modified magnetic Fe3O4@SiO2 core/shell microspheres for immobilization of cellulase. The uniform magnetic Fe3O4@SiO2 core/shell microspheres with a thin shell of 20 nm were synthesized through a solvothermal method followed by a sol-gel process. An amino-terminated silane coupling agent of (3-aminopropyl)triethoxysilane (APTS) was then grafted on them for capturing Cu2+ ions. The reaction process is very simple, efficient, and economical. Noticeably, the content of Cu2+ ions on the magnetic core/shell microspheres can reach 4.6 Wt%, endowing them possess as high immobilization capacity as 225.5 mg/g for cellulase. And the immobilized cellulase can be retained over 90 % on the magnetic microspheres after six cycles. Meanwhile, the magnetic microspheres decorated with Cu2+ ions show a superparamagnetic character with a high magnetic saturation of 58.5 emu/g at room temperature, suggesting conveniently and rapidly recycle the enzyme from solution. This facile, recyclable, high immobilization capacity and activity strategy may find potential applications in enzyme catalytic reactions with low cost.

  11. Simple and efficient synthesis of copper(II)-modified uniform magnetic Fe3O4@SiO2 core/shell microspheres for immobilization of cellulase

    International Nuclear Information System (INIS)

    Li, Shi-Kuo; Hou, Xiao-Cheng; Huang, Fang-Zhi; Li, Chuan-Hao; Kang, Wen-Juan; Xie, An-Jian; Shen, Yu-Hua

    2013-01-01

    In this paper, we reported a simple and efficient protocol for preparation of Cu 2+ -modified magnetic Fe 3 O 4 @SiO 2 core/shell microspheres for immobilization of cellulase. The uniform magnetic Fe 3 O 4 @SiO 2 core/shell microspheres with a thin shell of 20 nm were synthesized through a solvothermal method followed by a sol–gel process. An amino-terminated silane coupling agent of (3-aminopropyl)triethoxysilane (APTS) was then grafted on them for capturing Cu 2+ ions. The reaction process is very simple, efficient, and economical. Noticeably, the content of Cu 2+ ions on the magnetic core/shell microspheres can reach 4.6 Wt%, endowing them possess as high immobilization capacity as 225.5 mg/g for cellulase. And the immobilized cellulase can be retained over 90 % on the magnetic microspheres after six cycles. Meanwhile, the magnetic microspheres decorated with Cu 2+ ions show a superparamagnetic character with a high magnetic saturation of 58.5 emu/g at room temperature, suggesting conveniently and rapidly recycle the enzyme from solution. This facile, recyclable, high immobilization capacity and activity strategy may find potential applications in enzyme catalytic reactions with low cost

  12. Core density fluctuations in reverse magnetic shear plasmas with internal transport barrier on JT-60U

    International Nuclear Information System (INIS)

    Nazikian, R.; Shinohara, K.; Yoshino, R.; Fujita, T.; Shirai, H.; Kramer, G.T.

    1999-01-01

    First measurements of the radial correlation length of density fluctuations in JT-60U plasmas with internal transport barrier (ITB) is reported. The measurements are obtained using a newly installed correlation reflectometer operating in the upper X-mode. Before transport barrier formation in the low beam power current ramp-up phase of the discharge, reflectometer measurements indicate density fluctuation levels n-tilde/n∼0.1-0.2% and radial correlation lengths 2-3 cm (k r p i ≤0.5) in the central plasma region (r/a r p i ∼3. However, fluctuation levels are considerably higher than measured near the magnetic axis. Reflectometer measurements obtained at the foot of the ITB also indicate high fluctuation levels compared to measurements in the central region of the discharge. (author)

  13. The use of electromyography and magnetic resonance imaging to evaluate a core strengthening exercise programme.

    Science.gov (United States)

    Rutkowska-Kucharska, Alicja; Szpala, Agnieszka

    2018-01-01

    The question that was asked in the study was whether a training routine based on curl-up exercises with a load provided by body mass of the person increases local muscle strength or local muscle endurance. The aim of this study was to evaluate the effect of 4 weeks training based on a small load and low movement velocity on electrical activity (EMG), cross-sectional area (CSA) of core stabilisers. The EMG activity was measured in the rectus abdominis (RA), obliquus abdominis externus and erector spinae (ES) muscles. CSA of the muscles: RA, anterolateral abdominal, psoas major, quadratus lumborum, ES, and multifidus at the level of L3-L4 were measured too. The training increased the CSA and thickness in most of the muscles studied. Statistically significant correlation was found only for the ES circumference (left side) and EMG activity for the right side (r= 0.627, p= 0.022) and left side (r= 0.624, p= 0.023). The training programme resulted in a increase in the number of curl-up repetitions revealing an endurance increase in abdominal muscles. Furthermore, there was a increase in the EMG activity of the RA. An increase of the CSA of all tested muscles showed an increase of muscle active force.

  14. A Key to Improved Ion Core Confinement in the JET Tokamak: Ion Stiffness Mitigation due to Combined Plasma Rotation and Low Magnetic Shear

    DEFF Research Database (Denmark)

    Mantica, P.; Challis, C.; Peeters, A.G.

    2011-01-01

    New transport experiments on JET indicate that ion stiffness mitigation in the core of a rotating plasma, as described by Mantica et al. Phys. Rev. Lett. 102 175002 (2009)] results from the combined effect of high rotational shear and low magnetic shear. The observations have important implicatio...

  15. A key to improved ion core confinement in the JET tokamak : ion stiffness mitigation due to combined plasma rotation and low magnetic Shear

    NARCIS (Netherlands)

    Mantica, P.; Angioni, C.; Challis, C.; Colyer, G.; Frassinetti, L.; Hawkes, N.C.; Johnson, T.; Tsalas, M.; de Vries, P.C.; Weiland, J.; Baiocchi, B.; Beurskens, M.N.A.; Figueiredo, A.C.A.; Giroud, C.; Hobirk, J.; Joffrin, E.; Lerche, E.; Naulin, V.; Peeters, A.G.; Salmi, A.; Sozzi, C.; Strintzi, D.; Staebler, G.; Tala, T.; Van Eester, D.; Versloot, T.W.

    2011-01-01

    New transport experiments on JET indicate that ion stiffness mitigation in the core of a rotating plasma, as described by Mantica et al. Phys. Rev. Lett. 102 175002 (2009)] results from the combined effect of high rotational shear and low magnetic shear. The observations have important implications

  16. Optomagnetic Detection of MicroRNA Based on Duplex-Specific Nuclease-Assisted Target Recycling and Multilayer Core-Satellite Magnetic Superstructures

    DEFF Research Database (Denmark)

    Tian, Bo; Ma, Jing; Qiu, Zhen

    2017-01-01

    -efficiency, and potential for bioresponsive multiplexing. Herein, we demonstrate a sensitive and rapid miRNA detection method based on optomagnetic read-out, duplex-specific nuclease (DSN)-assisted target recycling, and the use of multilayer core-satellite magnetic superstructures. Triggered by the presence of target mi...

  17. Effects of crystalline grain size and packing ratio of self-forming core/shell nanoparticles on magnetic properties at up to GHz bands

    International Nuclear Information System (INIS)

    Suetsuna, Tomohiro; Suenaga, Seiichi; Sakurada, Shinya; Harada, Koichi; Tomimatsu, Maki; Takahashi, Toshihide

    2011-01-01

    Self-forming core/shell nanoparticles of magnetic metal/oxide with crystalline grain size of less than 40 nm were synthesized. The nanoparticles were highly concentrated in an insulating matrix to fabricate a nanocomposite, whose magnetic properties were investigated. The crystalline grain size of the nanoparticles strongly influenced the magnetic anisotropy field, magnetic coercivity, relative permeability, and loss factor (tan δ=μ''/μ') at high frequency. The packing ratio of the magnetic metallic phase in the nanocomposite also influenced those properties. High permeability with low tan δ of less than 1.5% at up to 1 GHz was obtained in the case of the nanoparticles with crystalline grain size of around 15 nm with large packing ratio of the nanoparticles. - Research highlights: → Self-forming core/shell nanoparticles of magnetic metal/oxide were synthesized. → Crystalline grain size of the nanoparticle and its packing ratio were controlled. → Magnetic properties changed according to the size and packing ratio.

  18. Acceleration of gene transfection efficiency in neuroblastoma cells through polyethyleneimine/poly(methyl methacrylate core-shell magnetic nanoparticles

    Directory of Open Access Journals (Sweden)

    Tencomnao T

    2012-06-01

    Full Text Available Tewin Tencomnao,1,* Kewalin Klangthong,2,* Nuttaporn Pimpha,3 Saowaluk Chaleawlert-umpon,3 Somsak Saesoo,3 Noppawan Woramongkolchai,3 Nattika Saengkrit,31Center for Excellence in Omics-Nano Medical Technology Development Project, 2Graduate Program in Clinical Biochemistry and Molecular Medicine, Department of Clinical Chemistry, Faculty of Allied Health Sciences, Chulalongkorn University, Bangkok, 3National Nanotechnology Center, National Science and Technology Development Agency, Pathumthani, Thailand*Both authors contributed equally to this workBackground: The purpose of this study was to demonstrate the potential of magnetic poly(methyl methacrylate (PMMA core/polyethyleneimine (PEI shell (mag-PEI nanoparticles, which possess high saturation magnetization for gene delivery. By using mag-PEI nanoparticles as a gene carrier, this study focused on evaluation of transfection efficiency under magnetic induction. The potential role of this newly synthesized nanosphere for therapeutic delivery of the tryptophan hydroxylase-2 (TPH-2 gene was also investigated in cultured neuronal LAN-5 cells.Methods: The mag-PEI nanoparticles were prepared by one-step emulsifier-free emulsion polymerization, generating highly loaded and monodispersed magnetic polymeric nanoparticles bearing an amine group. The physicochemical properties of the mag-PEI nanoparticles and DNA-bound mag-PEI nanoparticles were investigated using the gel retardation assay, atomic force microscopy, and zeta size measurements. The gene transfection efficiencies of mag-PEI nanoparticles were evaluated at different transfection times. Confocal laser scanning microscopy confirmed intracellular uptake of the magnetoplex. The optimal conditions for transfection of TPH-2 were selected for therapeutic gene transfection. We isolated the TPH-2 gene from the total RNA of the human medulla oblongata and cloned it into an expression vector. The plasmid containing TPH-2 was subsequently bound onto the

  19. Review of core technologies for development of 2G HTS NMR/MRI magnet: A status report of progress in Korea University

    Directory of Open Access Journals (Sweden)

    J.B. Song

    Full Text Available In this paper, we briefly review our recent progress on development of core technologies for 2G HTS NMR/MRI magnets at Korea University. To outperform the current state-of-art NMR/MRI magnet systems, we have developed the following technologies: 1 a REBCO-REBCO superconducting joint for operation of persistent current mode; 2 partial and grease-insulation winding techniques for self-protection of the HTS magnets; 3 pre-shimming to reduce the screening-current-induced-field; and 4 optimization of multi-width winding to minimize conductor consumption and volume of the HTS magnets. The test results demonstrated the feasibility of employing the developed techniques to achieve ultra-high-field and LHe-free 2G NMR/MRI magnets possessing self-protecting feature.

  20. Fabrication of an Fe80.5Si7.5B6Nb5Cu Amorphous-Nanocrystalline Powder Core with Outstanding Soft Magnetic Properties

    Science.gov (United States)

    Zhang, Zongyang; Liu, Xiansong; Feng, Shuangjiu; Rehman, Khalid Mehmood Ur

    2018-03-01

    In this study, the melt spinning method was used to develop Fe80.5Si7.5B6Nb5Cu amorphous ribbons in the first step. Then, the Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline core with a compact microstructure was obtained by multiple processes. The main properties of the magnetic powder core, such as micromorphology, thermal behavior, permeability, power loss and quality factor, have been analyzed. The obtained results show that an Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline duplex core has high permeability (54.8-57), is relatively stable at different frequencies and magnetic fields, and the maximum power loss is only 313 W/kg; furthermore, it has a good quality factor.

  1. Super-paramagnetic core-shell material with tunable magnetic behavior by regulating electron transfer efficiency and structure stability of the shell

    Directory of Open Access Journals (Sweden)

    Wenyan Zhang

    Full Text Available In this work, a spherical nano core-shell material was constructed by encapsulating Fe3O4 microsphere into conductive polymer-metal composite shell. The Fe3O4 microspheres were fabricated by assembling large amounts of Fe3O4 nano-crystals, which endowed the microspheres with super-paramagnetic property and high saturation magnetization. The polymer-metal composite shell was constructed by inserting Pt nano-particles (NPs into the conductive polymer polypyrrole (PPy. As size and dispersion of the Pt NPs has an important influence on their surface area and surface energy, it was effective to enlarge the interface area between PPy and Pt NPs, enhance the electron transfer efficiency of PPy/Pt composite shell, and reinforced the shell’s structural stability just by tuning the size and dispersion of Pt NPs. Moreover, core-shell structure of the materials made it convenient to investigate the PPy/Pt shell’s shielding effect on the Fe3O4 core’s magnetic response to external magnetic fields. It was found that the saturation magnetization of Fe3O4/PPy/Pt core-shell material could be reduced by 20.5% by regulating the conductivity of the PPy/Pt shell. Keywords: Super-paramagnetic, Conductivity, Magnetic shielding, Structural stability

  2. Production of gamma ray bursts from asymmetric core combustion of magnetized young neutron stars

    Science.gov (United States)

    de Gouveia dal Pino, E. M.; Lugones, G.; Horvath, J. E.; Ghezzi, C. R.

    2005-09-01

    Many works in the past have explored the idea that the conversion of hadronic matter into strange quark matter in neutron stars may be an energy source for GRBs (see references in Lugones et al. 2002, Lugones and Horvath 2003). These models addressed essentially spherically symmetric conversions of the whole neutron star rendering isotropic gamma emission. Accumulating observational evidence suggests that at least ''long'' GRBs are strongly asymmetric, jet-like outflows. The ''short'' burst subclass is not obviously asymmetric, and they may actually be spherically symmetric if the sources are close enough. A new potentially important feature recently recognized (Lugones et al. 2002) is that if a conversion to strange quark matter actually begins near the center of a neutron star, the presence of a magnetic field with intensity B ˜ 1013 G (see also Ghezi, de Gouveia Dal Pino & Horvath 2004) will originate a prompt collimated gamma emission, which may be observed as a short, beamed GRB after the recovery of a fraction of the neutrino energy via ν {barν} → e+e- → γγ. The calculations show that the neutrino luminosity is ˜ 1053 erg/sec and that the e+e- luminosity is about two orders of magnitude smaller ( tet{Lugones2002grb}). We find that 90 % of the e+e- pairs are injected inside small cylinders located just above the polar caps (with radius δ and height 0.4 R) in a timescale of τi ≃ 0.2 s almost independently of the initial temperature. This provides an interesting suitable explanation for the inner engine of short gamma ray bursts.

  3. Fluoride adsorption from aqueous solution by magnetic core-shell Fe_3O_4@alginate-La particles fabricated via electro-coextrusion

    International Nuclear Information System (INIS)

    Zhang, Yahui; Lin, Xiaoyan; Zhou, Quisheng; Luo, Xuegang

    2016-01-01

    Graphical abstract: The magnetic core-shell Fe_3O_4@Alg-La particles were fabricated successfully by a simple method of electro-coextrusion, and employed as an adsorbent for separation of fluoride from aqueous solution. - Highlights: • Magnetic core-shell Fe_3O_4@Alg-La particles were prepared by electro-coextrusion. • The maximum adsorption capacity for fluoride at 298.15 K was 45.230 mg/g. • The adsorbent has a good saturation magnetization value. • The adsorbent has a great potential in removing the fluoride. - Abstract: The magnetic core-shell Fe_3O_4@Alg-La particles were fabricated successfully by a simple method of electro-coextrusion, and employed as an adsorbent for separation of fluoride from aqueous solution. Main factors affecting the removal of fluoride, including pH, adsorbent dosage, initial concentration, temperature and contact time were investigated. The adsorption isotherm and adsorption kinetics were studied to understand the adsorption process in detail. The experimental data were fitted well by the non-linear Freundlich isotherm and linear pseudo-second-order model, the maximum fluoride adsorption capacity was 45.230 mg/g at pH 4, 298.15 K. Thermodynamic parameters indicated that the fluoride adsorption process was feasible and spontaneous. The presence of other anions like Cl"−, SO_4"2"−, HCO_3"− and PO_4"3"− had almost no effect on the fluoride adsorption. The adsorbent can be easily separated from the solution by a magnet. The magnetic core-shell Fe_3O_4@Alg-La particles before and after fluoride adsorption were studied by SEM, FTIR, EDX and XPS, which indicated that the adsorption mechanism may be related to electrostatic attraction and Lewis acid-base interaction.

  4. Fluoride adsorption from aqueous solution by magnetic core-shell Fe{sub 3}O{sub 4}@alginate-La particles fabricated via electro-coextrusion

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yahui [School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010, Sichuan (China); Engineering Research Center of Biomass Materials, Ministry of Education, Mianyang 621010, Sichuan (China); Lin, Xiaoyan, E-mail: lxy20100205@163.com [School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010, Sichuan (China); Engineering Research Center of Biomass Materials, Ministry of Education, Mianyang 621010, Sichuan (China); Zhou, Quisheng [A State Key Laboratory of Pulp & Paper Engineering, South China University of Technology, Guangzhou 510640 (China); Luo, Xuegang [Engineering Research Center of Biomass Materials, Ministry of Education, Mianyang 621010, Sichuan (China)

    2016-12-15

    Graphical abstract: The magnetic core-shell Fe{sub 3}O{sub 4}@Alg-La particles were fabricated successfully by a simple method of electro-coextrusion, and employed as an adsorbent for separation of fluoride from aqueous solution. - Highlights: • Magnetic core-shell Fe{sub 3}O{sub 4}@Alg-La particles were prepared by electro-coextrusion. • The maximum adsorption capacity for fluoride at 298.15 K was 45.230 mg/g. • The adsorbent has a good saturation magnetization value. • The adsorbent has a great potential in removing the fluoride. - Abstract: The magnetic core-shell Fe{sub 3}O{sub 4}@Alg-La particles were fabricated successfully by a simple method of electro-coextrusion, and employed as an adsorbent for separation of fluoride from aqueous solution. Main factors affecting the removal of fluoride, including pH, adsorbent dosage, initial concentration, temperature and contact time were investigated. The adsorption isotherm and adsorption kinetics were studied to understand the adsorption process in detail. The experimental data were fitted well by the non-linear Freundlich isotherm and linear pseudo-second-order model, the maximum fluoride adsorption capacity was 45.230 mg/g at pH 4, 298.15 K. Thermodynamic parameters indicated that the fluoride adsorption process was feasible and spontaneous. The presence of other anions like Cl{sup −}, SO{sub 4}{sup 2−}, HCO{sub 3}{sup −} and PO{sub 4}{sup 3−} had almost no effect on the fluoride adsorption. The adsorbent can be easily separated from the solution by a magnet. The magnetic core-shell Fe{sub 3}O{sub 4}@Alg-La particles before and after fluoride adsorption were studied by SEM, FTIR, EDX and XPS, which indicated that the adsorption mechanism may be related to electrostatic attraction and Lewis acid-base interaction.

  5. HER2 Targeted Breast Cancer Therapy with Switchable "Off/On" Multifunctional "Smart" Magnetic Polymer Core-Shell Nanocomposites.

    Science.gov (United States)

    Vivek, Raju; Thangam, Ramar; Kumar, Selvaraj Rajesh; Rejeeth, Chandrababu; Kumar, Gopal Senthil; Sivasubramanian, Srinivasan; Vincent, Savariar; Gopi, Dhanaraj; Kannan, Soundarapandian

    2016-01-27

    Multifunctional magnetic polymer nanocombinations are gaining importance in cancer nanotheranostics due to their safety and their potential in delivering targeted functions. Herein, we report a novel multifunctional core-shell magnetic polymer therapeutic nanocomposites (NCs) exhibiting pH dependent "Off-On" release of drug against breast cancer cells. The NCs are intact in blood circulation ("Off" state), i.e., at physiological pH, whereas activated ("On" state) at intracellular acidic pH environment of the targeted breast cancer cells. The NCs are prepared by coating the cannonball (iron nanocore) with hydrophobic nanopockets of pH-responsive poly(d,l-lactic-co-glycolic acid) (PLGA) polymer nanoshell that allows efficient loading of therapeutics. Further, the nanocore-polymer shell is stabilized by poly(vinylpyrrolidone) (PVP) and functionalized with a targeting HER2 ligand. The prepared Her-Fe3O4@PLGA-PVP nanocomposites facilitate packing of anticancer drug (Tamoxifen) without premature release in the bloodstream, recognizing the target cells through binding of Herceptin antibody to HER2, a cell surface receptor expressed by breast cancer cells to promote HER2 receptor mediated endocytosis and finally releasing the drug at the intracellular site of tumor cells ("On" state) to induce apoptosis. The therapeutic efficiency of hemo/cytocompatible NCs drug delivery system (DDS) in terms of targeted delivery and sustained release of therapeutic agent against breast cancer cells was substantiated by in vitro and in vivo studies. The multifunctional properties of Her-Tam-Fe3O4@PLGA-PVP NCs may open up new avenues in cancer therapy through overcoming the limitations of conventional cancer therapy.

  6. Magnetic core/shell nanoparticle thin films deposited by MAPLE: Investigation by chemical, morphological and in vitro biological assays

    International Nuclear Information System (INIS)

    Cristescu, R.; Popescu, C.; Socol, G.; Iordache, I.; Mihailescu, I.N.; Mihaiescu, D.E.; Grumezescu, A.M.; Balan, A.; Stamatin, I.; Chifiriuc, C.; Bleotu, C.; Saviuc, C.; Popa, M.; Chrisey, D.B.

    2012-01-01

    Highlights: ► We deposit magnetic Fe 3 O 4 /oleic acid/cephalosporin nanoparticle thin films by MAPLE. ► Thin films have a chemical structure similar to the starting material. ► Cephalosporins have an additive effect on the grain size and induce changes in grain shape. ► MAPLE can be used to develop novel strategies for fighting medical biofilms associated with chronic infections. - Abstract: We report on thin film deposition of nanostructured Fe 3 O 4 /oleic acid/ceftriaxone and Fe 3 O 4 /oleic acid/cefepime nanoparticles (core/shell/adsorption-shell) were fabricated by matrix assisted pulsed laser evaporation (MAPLE) onto inert substrates. The thin films were characterized by profilometry, Fourier transform infrared spectroscopy, atomic force microscopy, and investigated by in vitro biological assays. The biological properties tested included the investigation of the microbial viability and the microbial adherence to the glass coverslip nanoparticle film, using Gram-negative and Gram-positive bacterial strains with known antibiotic susceptibility behavior, the microbial adherence to the HeLa cells monolayer grown on the nanoparticle pellicle, and the cytotoxicity on eukaryotic cells. The proposed system, based on MAPLE, could be used for the development of novel anti-microbial materials or strategies for fighting pathogenic biofilms frequently implicated in the etiology of biofilm associated chronic infections.

  7. Magnetic core/shell nanoparticle thin films deposited by MAPLE: Investigation by chemical, morphological and in vitro biological assays

    Energy Technology Data Exchange (ETDEWEB)

    Cristescu, R., E-mail: rodica.cristescu@inflpr.ro [National Institute for Lasers, Plasma and Radiation Physics, Lasers Department, P.O. Box MG-36, Bucharest-Magurele (Romania); Popescu, C.; Socol, G.; Iordache, I.; Mihailescu, I.N. [National Institute for Lasers, Plasma and Radiation Physics, Lasers Department, P.O. Box MG-36, Bucharest-Magurele (Romania); Mihaiescu, D.E.; Grumezescu, A.M. [Faculty of Applied Chemistry and Materials Science, ' Politehnica' University of Bucharest, 1-7 Polizu Street, 011061 Bucharest (Romania); Balan, A.; Stamatin, I. [University of Bucharest, 3Nano-SAE Research Center, PO Box MG-38, Bucharest-Magurele (Romania); Chifiriuc, C. [Faculty of Biology, University of Bucharest, Microbiology Immunology Department, Aleea Portocalilor 1-3, Sector 5, 77206 Bucharest (Romania); Bleotu, C. [Stefan S. Nicolau Institute of Virology, 285 Mihai Bravu, 030304 Bucharest (Romania); Saviuc, C.; Popa, M. [Faculty of Biology, University of Bucharest, Microbiology Immunology Department, Aleea Portocalilor 1-3, Sector 5, 77206 Bucharest (Romania); Chrisey, D.B. [Rensselaer Polytechnic Institute, School of Engineering, Departments of Materials Science and Biomedical Engineering, Troy, 12180-3590, NY (United States)

    2012-09-15

    Highlights: Black-Right-Pointing-Pointer We deposit magnetic Fe{sub 3}O{sub 4}/oleic acid/cephalosporin nanoparticle thin films by MAPLE. Black-Right-Pointing-Pointer Thin films have a chemical structure similar to the starting material. Black-Right-Pointing-Pointer Cephalosporins have an additive effect on the grain size and induce changes in grain shape. Black-Right-Pointing-Pointer MAPLE can be used to develop novel strategies for fighting medical biofilms associated with chronic infections. - Abstract: We report on thin film deposition of nanostructured Fe{sub 3}O{sub 4}/oleic acid/ceftriaxone and Fe{sub 3}O{sub 4}/oleic acid/cefepime nanoparticles (core/shell/adsorption-shell) were fabricated by matrix assisted pulsed laser evaporation (MAPLE) onto inert substrates. The thin films were characterized by profilometry, Fourier transform infrared spectroscopy, atomic force microscopy, and investigated by in vitro biological assays. The biological properties tested included the investigation of the microbial viability and the microbial adherence to the glass coverslip nanoparticle film, using Gram-negative and Gram-positive bacterial strains with known antibiotic susceptibility behavior, the microbial adherence to the HeLa cells monolayer grown on the nanoparticle pellicle, and the cytotoxicity on eukaryotic cells. The proposed system, based on MAPLE, could be used for the development of novel anti-microbial materials or strategies for fighting pathogenic biofilms frequently implicated in the etiology of biofilm associated chronic infections.

  8. Gas phase synthesis of core-shell Fe@FeO{sub x} magnetic nanoparticles into fluids

    Energy Technology Data Exchange (ETDEWEB)

    Aktas, Sitki, E-mail: aksitki61@gmail.com; Thornton, Stuart C.; Binns, Chris [University of Leicester, Department of Physics and Astronomy (United Kingdom); Denby, Phil [Ensol As, Nesttun (Norway)

    2016-12-15

    Sorbitol, short chain molecules, have been used to stabilise of Fe@FeO{sub x} nanoparticles produced in the gas phase under the ultra-high vacuum (UHV) conditions. The sorbitol coated Fe@FeO{sub x} nanoparticles produced by our method have a narrow size distribution with a hydrodynamic diameter of 35 nm after NaOH is added to the solution. Magnetisation measurement shows that the magnetic nanoparticles are superparamagnetic at 100 K and demonstrate hysteresis at 5 K with an anisotropy constant of 5.31 × 10{sup 4} J/m{sup 3} (similar to bulk iron). Also, it is shown that sorbitol is only suitable for stabilising the Fe@FeO{sub x} suspensions, and it does not prevent further oxidation of the metallic Fe core. According to MRI measurement, the nanoparticles have a high transverse relaxation rate of 425 mM{sup −1} s{sup −1}.

  9. Fe{sub 3}O{sub 4} magnetic core coated by silver and functionalized with N-acetyl cysteine as novel nanoparticles in ferritin adsorption

    Energy Technology Data Exchange (ETDEWEB)

    Akduman, Beguem [Faculty of Science and Arts, Adnan Menderes University, Department of Chemistry (Turkey); Uygun, Murat [Kocarl Latin-Small-Letter-Dotless-I Vocational and Training School, Adnan Menderes University (Turkey); Uygun, Deniz Aktas, E-mail: daktas@adu.edu.tr [Faculty of Science and Arts, Adnan Menderes University, Department of Chemistry (Turkey); Antalik, Marian [Institute of Experimental Physics, Slovak Academy of Science, Department of Biophysics (Slovakia)

    2013-04-15

    A novel metal-chelate affinity matrix utilizing N-acetyl cysteine as a metal chelating agent was synthesized. For this, magnetic Fe{sub 3}O{sub 4} core was coated with silver by chemical reduction. Then, these magnetic silver nanoparticles were covered with N-acetyl cysteine, and Fe{sup 3+} was chelated to this modified magnetic silver nanoparticle. These magnetic nanoparticles were characterized by SEM, AFM, EDX, and ESR analysis. Synthesized nanoparticles were spherical and average size is found to be 69 nm. Fe{sup 3+} chelated magnetic silver nanoparticles were used for the adsorption of ferritin from its aqueous solution. Optimum conditions for the ferritin adsorption experiments were performed at pH 6.0 phosphate buffer and 25 Degree-Sign C of medium temperature and the maximum ferritin adsorption capacity is found to be 89.57 mg/g nanoparticle. Ferritin adsorption onto magnetic silver nanoparticles was increased with increasing ferritin concentration while adsorption capacity was decreased with increasing ionic strength. Affinity of the magnetic silver nanoparticles to the ferritin molecule was shown with SPR analysis. It was also observed that the adsorption capacity of the magnetic silver nanoparticles was not significantly changed after the five adsorption/desorption cycles.

  10. Effect of texture and grain size on magnetic flux density and core loss in non-oriented electrical steel containing 3.15% Si

    Energy Technology Data Exchange (ETDEWEB)

    Lee, K.M.; Park, S.Y. [Department of Materials Science and Engineering, Korea University, 5-1, Anam-dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of); Huh, M.Y., E-mail: myhuh@korea.ac.kr [Department of Materials Science and Engineering, Korea University, 5-1, Anam-dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of); Kim, J.S. [Electrical Steel Sheet Research Group, Technical Research Laboratories, POSCO, Goedong-dong, Pohang (Korea, Republic of); Engler, O. [Hydro Aluminium Rolled Products GmbH, R and D Center Bonn, P.O. Box 2468, D-53014 Bonn (Germany)

    2014-03-15

    In an attempt to differentiate the impact of grain size and crystallographic texture on magnetic properties of non-oriented (NO) electrical steel sheets, samples with different grain sizes and textures were produced and analyzed regarding magnetic flux density B and core loss W. The textures of the NO electrical steel samples could be precisely quantified with the help of elliptical Gaussian distributions. In samples with identical textures, small grain sizes resulted in about 15% higher core loss W than larger grains, whereas grain size only moderately affected the magnetic flux density B. In samples having nearly the same grain size, a correlation of the magneto-crystalline anisotropic properties of B and W with texture was obtained via the anisotropy parameter A(h{sup →}). With increasing A(h{sup →}) a linear decrease of B and a linear increase of W were observed. - Highlights: • We produced electrical steel sheets having different grain size and texture. • Magnetic flux density B and core loss W were varied with grain size and texture. • Correlation of B and W with texture was established via anisotropy parameter A(h{sup →}). • With increasing A(h{sup →}) a linear decrease of B and a linear increase of W were observed. • Grain size mainly affected W with only minor impact on B.

  11. A novel magnetic core-shell nanocomposite Fe3O4@chitosan@ZnO for the green synthesis of 2-benzimidazoles

    Science.gov (United States)

    Tian, Fei; Niu, Libo; Chen, Bo; Gao, Xuejia; Lan, Xingwang; Huo, Li; Bai, Guoyi

    2017-10-01

    A novel magnetic core-shell nanocomposite Fe3O4@Chitosan@ZnO was successfully prepared by in situ chemical precipitation method. It has a clear core-shell structure with magnetic Fe3O4 (about 160 nm in diameter) as core, chitosan as the inner shell, and ZnO as the outer shell, as demonstrated by the transmission electron microscopy and the related elemental mapping. Moreover, this nanocomposite has high magnetization (43.6 emu g-1) so that it can be easily separated from the reaction mixture within 4 s by an external magnetic field. The introduction of the natural chitosan shell, instead of the conventional SiO2 shell, and its combination with the active ZnO ensures this novel nanocomposite green character and good catalytic performance in the synthesis of 2-benzimidazoles with moderate to excellent isolated yields at room temperature. Notably, it can be recycled seven times without appreciable loss of its initial catalytic activity, demonstrating its good stability and making it an attractive candidate for the green synthesis of 2-benzimidazoles. [Figure not available: see fulltext.

  12. A key to improved ion core confinement in the JET tokamak: ion stiffness mitigation due to combined plasma rotation and low magnetic shear.

    Science.gov (United States)

    Mantica, P; Angioni, C; Challis, C; Colyer, G; Frassinetti, L; Hawkes, N; Johnson, T; Tsalas, M; deVries, P C; Weiland, J; Baiocchi, B; Beurskens, M N A; Figueiredo, A C A; Giroud, C; Hobirk, J; Joffrin, E; Lerche, E; Naulin, V; Peeters, A G; Salmi, A; Sozzi, C; Strintzi, D; Staebler, G; Tala, T; Van Eester, D; Versloot, T

    2011-09-23

    New transport experiments on JET indicate that ion stiffness mitigation in the core of a rotating plasma, as described by Mantica et al. [Phys. Rev. Lett. 102, 175002 (2009)] results from the combined effect of high rotational shear and low magnetic shear. The observations have important implications for the understanding of improved ion core confinement in advanced tokamak scenarios. Simulations using quasilinear fluid and gyrofluid models show features of stiffness mitigation, while nonlinear gyrokinetic simulations do not. The JET experiments indicate that advanced tokamak scenarios in future devices will require sufficient rotational shear and the capability of q profile manipulation.

  13. A facile method for preparing porous, optically active, magnetic Fe3 O4 @poly(N-acryloyl-leucine) inverse core/shell composite microspheres.

    Science.gov (United States)

    Liu, Dong; Deng, Jianping; Yang, Wantai

    2014-01-01

    The first synthesis of porous, optically active, magnetic Fe3 O4 @poly(N-acryloyl-leucine) inverse core/shell composite microspheres is reported, in which the core is constructed of chiral polymer and the shell is constructed of Fe3 O4 NPs. The microspheres integrate three significant concepts, "porosity", "chirality", and "magneticity", in one single microspheric entity. The microspheres consist of Fe3 O4 nanoparticles and porous optically active microspheres, and thus combine the advantages of both magnetic nanoparticles and porous optically active microspheres. The pore size and specific surface area of the microspheres are characterized by N2 adsorption, from which it is found that the composite microspheres possess a desirable porous structure. Circular dichroism and UV-vis absorption spectroscopy measurements demonstrate that the microspheres exhibit the expected optical activity. The microspheres also have high saturation magnetization of 14.7 emu g(-1) and rapid magnetic responsivity. After further optimization, these novel microspheres may potentially find applications in areas such as asymmetric catalysis, chiral adsorption, etc. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Rock Magnetic Properties, Paleosecular Variation Record and Relative Paleointensity Stack between 11 and 21 14C kyr B.P. From Sediment Cores, Lake Moreno (Argentina)

    Science.gov (United States)

    Gogorza, C. S.; Irurzun, M. A.; Lirio, J. M.; Nunez, H.; Chaparro, M. A.; Sinito, A. M.

    2008-05-01

    We conducted a detailed study of natural remanence and rock magnetic properties on sediments cores from lake Moreno (South-Western Argentina). Based on these measurements, we constructed a paleosecular variation (PSV) record (Irurzun et al., 2008) and a relative paleointensity stack for the period 11-21 14C. The Declination and Inclination logs of the characteristic remanent magnetization for the cores as function of shortened depth are obtained. The data from all cores were combined to obtain a composite record using the Fisher method. Comparison between stacked inclination and declination records of lake Moreno and results obtained in previous works, lake Escondido (Gogorza et al., 1999; Gogorza et al., 2002) and lake El Trébol (Irurzun et al., 2008), shows good agreement. This agreement made possible to transform the stacked curves into time series that spans the interval 11 and 21 14C kyr B.P. Rock magnetic properties of the sediments cores showed uniform magnetic mineralogy and grain size, suggesting that they were suitable for relative paleointensity studies. The remanent magnetization at 20mT (NRM20mT) was normalized using the anhysteric remanent magnetization at 20mT (ARM20mT), the saturation of the isothermal remanent magnetization at 20mT (SIRM20mT) and the low field magnetic susceptibility {k}. Coherence analysis showed that the normalized records were not affected by local environmental conditions. The recorded pseudo-Thellier paleointensity was compared with records obtained from conventional normalizing methods. Comparing the paleointensity curves with others obtained previously in other lakes in the area has allowed us to reach reliable conclusions about centennial-scale features. References: Gogorza, C.S.G., Sinito, A.M., Di Tommaso, I., Vilas, J.F., Creer, K., Núnez, H. Holocene Geomagnetic Secular Variations Recorded by Sediments from Escondido lake (South Argentina). Earth, Planets and Space, V51(2), 93- 106. 1999. Gogorza, C.S.G., Sinito, A

  15. Magnetic core mounting system

    Science.gov (United States)

    Ronning, Jeffrey J.

    2002-01-01

    A mounting apparatus for an electromagnetic device such as a transformer of inductor includes a generally planar metallic plate as a first heat sink, and a metallic mounting cup as a second heat sink. The mounting cup includes a cavity configured to receive the electromagnetic device, the cavity being defined by a base, and an axially-extending annular sidewall extending from the base to a flange portion of the mounting cup. The mounting cup includes first and second passages for allowing the leads of first and second windings of the electromagnetic device to be routed out of the cavity. The cavity is filled with a polyurethane potting resin, and the mounting cup, including the potted electromagnetic device, is mounted to the plate heat sink using fasteners. The mounting cup, which surrounds the electromagnetic device, in combination with the potting resin provides improved thermal transfer to the plate heat sink, as well as providing resistance to vibration and shocks.

  16. Diffusion-weighted magnetic resonance imaging for the detection of lipid-rich necrotic core in carotid atheroma in vivo

    International Nuclear Information System (INIS)

    Young, Victoria Eleanor; Patterson, Andrew J.; Sadat, Umar; Bowden, David J.; Tang, Tjun Y.; Gillard, Jonathan H.; Graves, Martin J.; Priest, Andrew N.; Skepper, Jeremy N.; Kirkpatrick, Peter J.

    2010-01-01

    Research has shown that knowing the morphology of carotid atheroma improves current risk stratification for predicting subsequent thrombo-embolic events. Previous magnetic resonance (MR) ex vivo studies have shown that diffusion-weighted imaging (DWI) can detect lipid-rich necrotic core (LR/NC) and fibrous cap. This study aims to establish if this is achievable in vivo. Twenty-six patients (mean age 73 years, range 54-87 years) with moderate to severe carotid stenosis confirmed on ultrasound were imaged. An echo-planar DWI sequence was performed along with standard high-resolution MR imaging. Apparent diffusion coefficient (ADC) maps were evaluated. Two independent readers reported the mean ADC values from regions of interest defining LR/NCs and fibrous caps. For subjects undergoing carotid endarterectomy (n = 19), carotid specimens were obtained and stained using Nile red. The mean ADC values were 1.0 x 10 -3 mm 2 /s (±SD 0.3 x 10 -3 mm 2 /s) and 0.7 x 10 -3 mm 2 /s (±SD 0.2 x 10 -3 mm 2 /s) for fibrous cap and LR/NC, respectively; the difference was significant (p < 0.0001). The intra-class correlation coefficients summarising the agreement between the two independent readers were 0.84 and 0.60 for fibrous cap and LR/NC, respectively. Comparison of quantitative ADC values and histology (by subjective grading of lipid content) showed a significant correlation: heavier lipid staining matched lower ADC values (r = -0.435, p = 0.005). This study indicates that DWI can be used to distinguish LR/NC and the fibrous cap. The study also suggests that the mean ADC value may be linearly related to subjective graded LR/NC content determined by histology. (orig.)

  17. Diffusion-weighted magnetic resonance imaging for the detection of lipid-rich necrotic core in carotid atheroma in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Young, Victoria Eleanor; Patterson, Andrew J.; Sadat, Umar; Bowden, David J.; Tang, Tjun Y.; Gillard, Jonathan H. [Addenbrooke' s Hospital, University Department of Radiology, Box 218, Cambridge (United Kingdom); Graves, Martin J.; Priest, Andrew N. [Addenbrooke' s Hospital, University Department of Radiology, Box 218, Cambridge (United Kingdom); Addenbrooke' s Hospital, Department of Medical Physics, Cambridge (United Kingdom); Skepper, Jeremy N. [University of Cambridge, Multi-imaging Centre, Cambridge (United Kingdom); Kirkpatrick, Peter J. [Addenbrooke' s Hospital, Department of Neurosurgery, Cambridge (United Kingdom)

    2010-10-15

    Research has shown that knowing the morphology of carotid atheroma improves current risk stratification for predicting subsequent thrombo-embolic events. Previous magnetic resonance (MR) ex vivo studies have shown that diffusion-weighted imaging (DWI) can detect lipid-rich necrotic core (LR/NC) and fibrous cap. This study aims to establish if this is achievable in vivo. Twenty-six patients (mean age 73 years, range 54-87 years) with moderate to severe carotid stenosis confirmed on ultrasound were imaged. An echo-planar DWI sequence was performed along with standard high-resolution MR imaging. Apparent diffusion coefficient (ADC) maps were evaluated. Two independent readers reported the mean ADC values from regions of interest defining LR/NCs and fibrous caps. For subjects undergoing carotid endarterectomy (n = 19), carotid specimens were obtained and stained using Nile red. The mean ADC values were 1.0 x 10{sup -3} mm{sup 2}/s ({+-}SD 0.3 x 10{sup -3} mm{sup 2}/s) and 0.7 x 10{sup -3} mm{sup 2}/s ({+-}SD 0.2 x 10{sup -3} mm{sup 2}/s) for fibrous cap and LR/NC, respectively; the difference was significant (p < 0.0001). The intra-class correlation coefficients summarising the agreement between the two independent readers were 0.84 and 0.60 for fibrous cap and LR/NC, respectively. Comparison of quantitative ADC values and histology (by subjective grading of lipid content) showed a significant correlation: heavier lipid staining matched lower ADC values (r = -0.435, p = 0.005). This study indicates that DWI can be used to distinguish LR/NC and the fibrous cap. The study also suggests that the mean ADC value may be linearly related to subjective graded LR/NC content determined by histology. (orig.)

  18. Magnetic resonance metabolic profiling of breast cancer tissue obtained with core needle biopsy for predicting pathologic response to neoadjuvant chemotherapy.

    Directory of Open Access Journals (Sweden)

    Ji Soo Choi

    Full Text Available The purpose of this study was to determine whether metabolic profiling of core needle biopsy (CNB samples using high-resolution magic angle spinning (HR-MAS magnetic resonance spectroscopy (MRS could be used for predicting pathologic response to neoadjuvant chemotherapy (NAC in patients with locally advanced breast cancer. After institutional review board approval and informed consent were obtained, CNB tissue samples were collected from 37 malignant lesions in 37 patients before NAC treatment. The metabolic profiling of CNB samples were performed by HR-MAS MRS. Metabolic profiles were compared according to pathologic response to NAC using the Mann-Whitney test. Multivariate analysis was performed with orthogonal projections to latent structure-discriminant analysis (OPLS-DA. Various metabolites including choline-containing compounds were identified and quantified by HR-MAS MRS in all 37 breast cancer tissue samples obtained by CNB. In univariate analysis, the metabolite concentrations and metabolic ratios of CNB samples obtained with HR-MAS MRS were not significantly different between different pathologic response groups. However, there was a trend of lower levels of phosphocholine/creatine ratio and choline-containing metabolite concentrations in the pathologic complete response group compared to the non-pathologic complete response group. In multivariate analysis, the OPLS-DA models built with HR-MAS MR metabolic profiles showed visible discrimination between the pathologic response groups. This study showed OPLS-DA multivariate analysis using metabolic profiles of pretreatment CNB samples assessed by HR- MAS MRS may be used to predict pathologic response before NAC, although we did not identify the metabolite showing statistical significance in univariate analysis. Therefore, our preliminary results raise the necessity of further study on HR-MAS MR metabolic profiling of CNB samples for a large number of cancers.

  19. Core-shelled mesoporous CoFe2O4-SiO2 material with good adsorption and high-temperature magnetic recycling capabilities

    Science.gov (United States)

    Li, Zhi'ang; Wang, Jianlin; Liu, Min; Chen, Tong; Chen, Jifang; Ge, Wen; Fu, Zhengping; Peng, Ranran; Zhai, Xiaofang; Lu, Yalin

    2018-04-01

    Residues of organic dye in industrial effluents cause severe water system pollution. Although several methods, such as biodegradation and activated carbon adsorption, are available for treating these effluents before their discharge into waterbodies, secondary pollution by adsorbents and degrading products remains an issue. Therefore, new materials should be identified to solve this problem. In this work, CoFe2O4-SiO2 core-shell structures were synthesized using an improved Stöber method by coating mesoporous silica onto CoFe2O4 nanoparticles. The specific surface areas of the synthesized particles range from 30 m2/g to 150 m2/g and vary according to the dosage amount of tetraethoxysilane. Such core-shelled nanoparticles have the following advantages for treating industrial effluents mixed with dye: good adsorption capability, above-room-temperature magnetic recycling capability, and heat-enduring stability. Through adsorption of methylene blue, a typical dyeing material, the core-shell-structured particles show a good adsorption capability of approximately 33 mg/L. The particles are easily and completely collected by magnets, which is possible due to the magnetic property of core CoFe2O4. Heat treatment can burn out the adsorbed dyes and good adsorption performance is sustained even after several heat-treating loops. This property overcomes the common problem of particles with Fe3O4 as a core, by which Fe3O4 is oxidized to nonmagnetic α-Fe2O3 at the burning temperature. We also designed a miniature of effluent-treating pipeline, which demonstrates the potential of the application.

  20. Folic acid-functionalized magnetic ZnFe2O4 hollow microsphere core/mesoporous silica shell composite particles: synthesis and application in drug release.

    Science.gov (United States)

    Yang, Dandan; Wei, Kaiwei; Liu, Qi; Yang, Yong; Guo, Xue; Rong, Hongren; Cheng, Mei-Ling; Wang, Guoxiu

    2013-07-01

    A drug delivery system was designed by deliberately combining the useful functions into one entity, which was composed of magnetic ZnFe2O4 hollow microsphere as the core, and mesoporous silica with folic acid molecules as the outer shell. Amine groups coated magnetic ZnFe2O4 hollow microsphere core/mesoporous silica shell (MZHM-MSS-NH2) composite particles were first synthesized by a one-pot direct co-condensation method. Subsequently a novel kind of folic acid-functionalized magnetic ZnFe2O4 hollow microsphere core/mesoporous silica shell (MZHM-MSS-NHFA) composite particles were synthesized by conjugating folic acid as targeted molecule to MZHM-MSS-NH2. Ibuprofen, a well-known antiphlogistic drug, was used as a model drug to assess the loading and releasing behavior of the composite microspheres. The results show that the MZHM-MSS-NHFA system has the higher capacity of drug storage and good sustained drug-release property. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Rock Magnetic Study of IODP/ICDP Expedition 364 Site M0077A Drill Cores: Post-Impact Sediments, Impact Breccias, Melt, Granitic Basement and Dikes

    Science.gov (United States)

    Fucugauchi, J. U.; Perez-Cruz, L. L.; Rebolledo-Vieyra, M.; Tikoo, S.; Zylberman, W.; Lofi, J.

    2017-12-01

    Drilling at Site M0077 sampled post-impact sediments overlying a peak ring consisting of impact breccias, melt rock and granitoids. Here we focus on characterizing the peak ring using magnetic properties, which vary widely and depend on mineralogy, depositional and emplacement conditions and secondary alterations. Rock magnetic properties are integrated with Multi-Sensor Core Logger (MSCL) data, vertical seismic profile, physical properties, petrographic and chemical analyses and geophysical models. We measure low-field magnetic susceptibility at low- and high-frequencies, intensity and direction of natural remanent magnetization (NRM) and laboratory-induced isothermal (IRM) and anhysteretic (ARM) magnetizations, alternating-field demagnetization of NRM, IRM and NRM, susceptibility variation with temperature, anisotropy of magnetic susceptibility, hysteresis and IRM back-field demagnetization. Post-impact carbonates show low susceptibilities and NRM intensities, variable frequency-dependent susceptibilities and multivectorial remanences residing in low and high coercivity minerals. Hysteresis loops show low coercivity saturation magnetizations and variable paramagnetic mineral contents. Impact breccias (suevites) and melt rock show higher susceptibilities, low frequency-dependent susceptibilities, high NRM, ARM and IRM intensities and moderate ARM intensity/susceptibility ratios. Magnetic signal is dominated by fine-grained magnetite and titanomagnetites with PSD domain states. Melt rocks at the base of impactite section show the highest susceptibilities and remanence intensities. Basement section is characterized by low susceptibilities in the granites and higher values in the dikes, with NRM and ARM intensities increasing towards the base. The high susceptibilities and remanence intensities correlate with high seismic velocities, density and decreased porosity and electrical resistivity. Fracturing and alteration account for the reduced seismic velocities

  2. Chemical synthesis of Fe/Fe{sub 3}O{sub 4} core-shell composites with enhanced soft magnetic performances

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Bai, E-mail: byang@buaa.edu.cn [Key Laboratory of Aerospace Advanced Materials and Performance, Ministry of Education, School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Li, Xiaopan [Key Laboratory of Aerospace Advanced Materials and Performance, Ministry of Education, School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Yang, Xueying [Hi-tech Industry Standardization Institute, Hubei Standardization and Quality Institution, Wuhan 430061 (China); Yu, Ronghai [Key Laboratory of Aerospace Advanced Materials and Performance, Ministry of Education, School of Materials Science and Engineering, Beihang University, Beijing 100191 (China)

    2017-04-15

    The large-grain Fe/Fe{sub 3}O{sub 4} composite particles with average size of about 1.2 µm have been fabricated by a facile one-step solvothermal method. The formation of high-purity Fe{sub 3}O{sub 4} as the shells (90.14 wt%) and α-Fe as the cores (9.86 wt%) in the Fe/Fe{sub 3}O{sub 4} composites leads to their high saturation magnetization of 119.6 A m{sup 2} Kg{sup -1}. Very low coercivity of 30 Oe is obtained in the composites due to their uniform cubic-shaped morphologies. Compared with Fe-based nanosized particles, these micron-sized magnetic Fe/Fe{sub 3}O{sub 4} composites exhibit high air stability and good compactibility with high compressed density of 5.9 g cm{sup -3}. The fully compacted sample shows good soft magnetic properties including high magnetic induction B{sub 1.2k} {sub (H=1200} {sub A/m)} of 540 mT and good frequency-dependent magnetic properties with operating frequency up to 50 MHz superior to those of the most traditional soft magnetic ferrites, which promotes their potential applications in high-frequency and high-power magnetic devices. - Highlights: • Micron-sized Fe/Fe{sub 3}O{sub 4} composites are prepared by a one-step solvothermal method. • High saturation magnetization and low coercivity are obtained in the composites. • Good air stability and high bulk density occurs in the composites. • High magnetic induction and good frequency-dependent properties are achieved.

  3. Characterization of the electronic and magnetic structure of multifunctional NaREF{sub 4} (RE = rare earth) core-shell nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Lilli; Kuepper, Karsten [Physics Department, University of Osnabrueck (Germany); Rinkel, Thorben; Haase, Markus [Institute of Chemistry, University of Osnabrueck (Germany); Chrobak, Artur [Institute of Physics, University of Silesia (Poland)

    2014-07-01

    Rare earth (RE) based nanoparticles of type NaREF{sub 4} have attracted lot of attention in the last few years due to their upconverting luminescence. Here, we want to concentrate on electronic and magnetic properties of NaREF{sub 4}/NaGdF{sub 4} nanocrystals, since the magnetic behaviour of these fluorescent nanoparticles are of utmost importance from fundamental and applicative point of view as well. Hexagonal β-phase nanocrystals (3-22 nm) were prepared and characterized by X-ray powder diffraction (XRD) and transmission electron microscopy (TEM). A detailed study of the electronic structure and magnetic coupling phenomena of the different core-shell nanoparticles is performed using X-ray photoelectron spectroscopy (XPS), magnetometry (SQUID) and X-ray magnetic circular dichroism (XMCD). First SQUID measurements of NaEuF{sub 4}/NaGdF{sub 4} core-shell nanoparticles show butterfly shaped hysteresis loops at low temperature (2 K) in contrast to superparamagnetic behaviour observed for the corresponding ''pure'' NaEuF{sub 4} and NaGdF{sub 4} nanoparticles.

  4. Electronic state and photoionization cross section of a single dopant in GaN/InGaN core/shell quantum dot under magnetic field and hydrostatic pressure

    Science.gov (United States)

    Aouami, A. El; Feddi, E.; Talbi, A.; Dujardin, F.; Duque, C. A.

    2018-06-01

    In this study, we have investigated the simultaneous influence of magnetic field combined to the hydrostatic pressure and the geometrical confinement on the behavior of a single dopant confined in GaN/InGaN core/shell quantum dots. Within the scheme of the effective-mass approximation, the eigenvalues equation has solved by using the variational method with one-parameter trial wavefunctions. Variation of the ground state binding energy of the single dopant is determined according to the magnetic field and hydrostatic pressure for several dimensions of the heterostructure. The results show that the binding energy is strongly dependent on the core/shell sizes, the magnetic field, and the hydrostatic pressure. The analysis of the photoionization cross section, corresponding to optical transitions associated to the first donor energy level and the conduction band, shows clearly that the reduction of the dot dimensions and/or the simultaneous influences of applied magnetic field, combined to the hydrostatic pressure strength, cause a shift in resonance peaks towards the higher energies with important variations in the magnitude of the resonant peaks.

  5. Structural and magnetic characterization of three tetranuclear Cu(II) complexes with face-sharing-dicubane/double-open-cubane like core framework

    International Nuclear Information System (INIS)

    Paul, Aparup; Bertolasi, Valerio; Figuerola, Albert; Manna, Subal Chandra

    2017-01-01

    Three novel tetranuclear copper(II) complexes namely [Cu 4 (L 1 ) 4 ]∙2(dmf) (1), [Cu 4 (L 1 ) 4 ] (2) and [Cu 4 (L 2 ) 2 (HL 2 ) 2 (H 2 O) 2 ]∙2(ClO 4 )·6(H 2 O) (3) (H 2 L 1 , (E)−2-((1-hydroxybutan-2-ylimino)methyl)phenol; H 2 L 2 , (E)−2-((1-hydroxybutan-2-ylimino)methyl)−6-methoxyphenol)) were synthesized from the self-assembly of copper(II) perchlorate and the tridentate Schiff base ligands. The structural determination reveals that crystallizes in the monoclinic system with space group C2/c, whereas both the and crystallize in the triclinic system with space group P-1. and possess face-sharing dicubane core, on the other hand complex 3 has double open cubane core structure. The copper(II) ions in the cubane core are in distorted square planar geometries, and weak π…π and C–H…π interactions lead to formation of a 2D supramolecular architecture for and . At room temperature and , exhibit fluorescence with a quantum yield (Φ s ) of 0.47, 0.49 and 0.38, respectively. Variable temperature magnetic susceptibility measurements in the range 2–300 K indicate an overall weak antiferromagnetic exchange coupling in all complexes. The PHI program was used to study their magnetic behaviour. In agreement with their face-sharing dicubane structure, a Hamiltonian of the type H =– J 1 (S 1 S 2 +S 1 S 2’ +S 1' S 2 +S 1' S 2’ ) – J 2 S 1 S 1’ , where S 1 = S 1’ = S 2 = S 2’ = S Cu =1/2, was used for studying and . Simulations performed suggest magnetic exchange constants with values close to J 1 =−20 cm −1 and J 2 =0 cm -1 for these complexes. On the other hand, the spin Hamiltonian H =– J 1 (S 1 S 4 +S 2 S 3 ) – J 2 (S 1 S 3 +S 2 S 4 ) – J 3 S 1 S 2 , where S 1 = S 2 = S 3 = S 4 = S Cu =1/2, was used to study the magnetic behaviour of the double open cubane core of and a good agreement between the experimental and simulated results was found by using the parameters g 1 = g 2 =2.20, g 3 = g 4 =2.18, J 1 =−36 cm -1 , J 2

  6. Huge Inverse Magnetization Generated by Faraday Induction in Nano-Sized Au@Ni Core@Shell Nanoparticles.

    Science.gov (United States)

    Kuo, Chen-Chen; Li, Chi-Yen; Lee, Chi-Hung; Li, Hsiao-Chi; Li, Wen-Hsien

    2015-08-25

    We report on the design and observation of huge inverse magnetizations pointing in the direction opposite to the applied magnetic field, induced in nano-sized amorphous Ni shells deposited on crystalline Au nanoparticles by turning the applied magnetic field off. The magnitude of the induced inverse magnetization is very sensitive to the field reduction rate as well as to the thermal and field processes before turning the magnetic field off, and can be as high as 54% of the magnetization prior to cutting off the applied magnetic field. Memory effect of the induced inverse magnetization is clearly revealed in the relaxation measurements. The relaxation of the inverse magnetization can be described by an exponential decay profile, with a critical exponent that can be effectively tuned by the wait time right after reaching the designated temperature and before the applied magnetic field is turned off. The key to these effects is to have the induced eddy current running beneath the amorphous Ni shells through Faraday induction.

  7. Huge Inverse Magnetization Generated by Faraday Induction in Nano-Sized Au@Ni Core@Shell Nanoparticles

    Directory of Open Access Journals (Sweden)

    Chen-Chen Kuo

    2015-08-01

    Full Text Available We report on the design and observation of huge inverse magnetizations pointing in the direction opposite to the applied magnetic field, induced in nano-sized amorphous Ni shells deposited on crystalline Au nanoparticles by turning the applied magnetic field off. The magnitude of the induced inverse magnetization is very sensitive to the field reduction rate as well as to the thermal and field processes before turning the magnetic field off, and can be as high as 54% of the magnetization prior to cutting off the applied magnetic field. Memory effect of the induced inverse magnetization is clearly revealed in the relaxation measurements. The relaxation of the inverse magnetization can be described by an exponential decay profile, with a critical exponent that can be effectively tuned by the wait time right after reaching the designated temperature and before the applied magnetic field is turned off. The key to these effects is to have the induced eddy current running beneath the amorphous Ni shells through Faraday induction.

  8. Huge Inverse Magnetization Generated by Faraday Induction in Nano-Sized Au@Ni Core@Shell Nanoparticles

    Science.gov (United States)

    Kuo, Chen-Chen; Li, Chi-Yen; Lee, Chi-Hung; Li, Hsiao-Chi; Li, Wen-Hsien

    2015-01-01

    We report on the design and observation of huge inverse magnetizations pointing in the direction opposite to the applied magnetic field, induced in nano-sized amorphous Ni shells deposited on crystalline Au nanoparticles by turning the applied magnetic field off. The magnitude of the induced inverse magnetization is very sensitive to the field reduction rate as well as to the thermal and field processes before turning the magnetic field off, and can be as high as 54% of the magnetization prior to cutting off the applied magnetic field. Memory effect of the induced inverse magnetization is clearly revealed in the relaxation measurements. The relaxation of the inverse magnetization can be described by an exponential decay profile, with a critical exponent that can be effectively tuned by the wait time right after reaching the designated temperature and before the applied magnetic field is turned off. The key to these effects is to have the induced eddy current running beneath the amorphous Ni shells through Faraday induction. PMID:26307983

  9. Interchange core/shell assembly of diluted magnetic semiconductor CeO2 and ferromagnetic ferrite Fe3O4 for microwave absorption

    Directory of Open Access Journals (Sweden)

    Jiaheng Wang

    2017-05-01

    Full Text Available Core/shell-structured CeO2/Fe3O4 and Fe3O4/CeO2 nanocapsules are prepared by interchange assembly of diluted magnetic semiconductor CeO2 and ferromagnetic ferrite Fe3O4 as the core and the shell, and vice versa, using a facile two-step polar solvothermal method in order to utilize the room-temperature ferromagnetism and abundant O-vacancies in CeO2, the large natural resonance in Fe3O4, and the O-vacancy-enhanced interfacial polarization between CeO2 and Fe3O4 for new generation microwave absorbers. Comparing to Fe3O4/CeO2 nanocapsules, the CeO2/Fe3O4 nanocapsules show an improved real permittivity of 3–10% and an enhanced dielectric resonance of 1.5 times at 15.3 GHz due to the increased O-vacancy concentration in the CeO2 cores of larger grains as well as the O-vacancy-induced enhancement in interfacial polarization between the CeO2 cores and the Fe3O4 shells, respectively. Both nanocapsules exhibit relatively high permeability in the low-frequency S and C microwave bands as a result of the bi-magnetic core/shell combination of CeO2 and Fe3O4. The CeO2/Fe3O4 nanocapsules effectively enhance permittivity and permeability in the high-frequency Ku band with interfacial polarization and natural resonance at ∼15 GHz, thereby improving absorption with a large reflection loss of -28.9 dB at 15.3 GHz. Experimental and theoretical comparisons with CeO2 and Fe3O4 nanoparticles are also made.

  10. Self-assembly of multiferroic core-shell particulate nanocomposites through DNA-DNA hybridization and magnetic field directed assembly of superstructures

    Energy Technology Data Exchange (ETDEWEB)

    Sreenivasulu, Gollapudi; Srinivasan, Gopalan, E-mail: srinivas@oakland.edu, E-mail: chavez@oakland.edu [Department of Physics, Oakland University, Rochester, MI 48309-4401 (United States); Lochbiler, Thomas A.; Panda, Manashi; Chavez, Ferman A., E-mail: srinivas@oakland.edu, E-mail: chavez@oakland.edu [Department of Chemistry, Oakland University, Rochester, MI 48309-4401 (United States)

    2016-04-15

    Multiferroic composites of ferromagnetic and ferroelectric phases are of importance for studies on mechanical strain mediated coupling between the magnetic and electric subsystems. This work is on DNA-assisted self-assembly of superstructures of such composites with nanometer periodicity. The synthesis involved oligomeric DNA-functionalized ferroelectric and ferromagnetic nanoparticles, 600 nm BaTiO{sub 3} (BTO) and 200 nm NiFe{sub 2}O{sub 4} (NFO), respectively. Mixing BTO and NFO particles, possessing complementary DNA sequences, resulted in the formation of ordered core-shell heteronanocomposites held together by DNA hybridization. The composites were imaged by scanning electron microscopy and scanning microwave microscopy. The presence of heteroassemblies along with core-shell architecture is clearly observed. The reversible nature of the DNA hybridization allows for restructuring the composites into mm-long linear chains and 2D-arrays in the presence of a static magnetic field and ring-like structures in a rotating-magnetic field. Strong magneto-electric (ME) coupling in as-assembled composites is evident from static magnetic field H induced polarization and low-frequency magnetoelectric voltage coefficient measurements. Upon annealing the nanocomposites at high temperatures, evidence for the formation of bulk composites with excellent cross-coupling between the electric and magnetic subsystems is obtained by H-induced polarization and low-frequency ME voltage coefficient. The ME coupling strength in the self-assembled composites is measured to be much stronger than in bulk composites with randomly distributed NFO and BTO prepared by direct mixing and sintering.

  11. A code for the correction of field imperfections in iron-core superconducting magnets by shimming of iron

    International Nuclear Information System (INIS)

    Pradhan, J.; Bhunia, U.; Dey, M.K.; Mallik, C.; Bhandari, R.K.

    2005-01-01

    The magnetic field measurement of the median plane of K500 superconducting cyclotron at VECC have been carried out. A code has been developed using the mathematical software to calculate the magnetic field distribution for an arbitrary shaped saturated iron piece, and the various harmonics therein

  12. Magnetic properties of iron/graphite core-shell nanoparticles prepared by annealing of Fe-C-N-based nanocomposite

    Czech Academy of Sciences Publication Activity Database

    David, Bohumil; Pizúrová, Naděžda; Schneeweiss, Oldřich; Bezdička, Petr; Alexandrescu, R.; Morjan, I.; Cruneteanu, A.; Voicu, I.

    290-291, - (2005), s. 179-182 ISSN 0304-8853 R&D Projects: GA ČR(CZ) GA202/04/0221; GA AV ČR(CZ) KSK1010104 Institutional research plan: CEZ:AV0Z20410507 Keywords : magnetism * iron * nanoparticle Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.985, year: 2005

  13. Losses analysis of soft magnetic ring core under sinusoidal pulse width modulation (SPWM) and space vector pulse width modulation (SVPWM) excitations

    Science.gov (United States)

    Gao, Hezhe; Li, Yongjian; Wang, Shanming; Zhu, Jianguo; Yang, Qingxin; Zhang, Changgeng; Li, Jingsong

    2018-05-01

    Practical core losses in electrical machines differ significantly from those experimental results using the standardized measurement method, i.e. Epstein Frame method. In order to obtain a better approximation of the losses in an electrical machine, a simulation method considering sinusoidal pulse width modulation (SPWM) and space vector pulse width modulation (SVPWM) waveforms is proposed. The influence of the pulse width modulation (PWM) parameters on the harmonic components in SPWM and SVPWM is discussed by fast Fourier transform (FFT). Three-level SPWM and SVPWM are analyzed and compared both by simulation and experiment. The core losses of several ring samples magnetized by SPWM, SVPWM and sinusoidal alternating current (AC) are obtained. In addition, the temperature rise of the samples under SPWM, sinusoidal excitation are analyzed and compared.

  14. Structural and magnetic properties of CoFe{sub 2}O{sub 4}/NiFe{sub 2}O{sub 4} core/shell nanocomposite prepared by the hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Sattar, A.A. [Department of Physics, Faculty of Science, Ain Shams University, 11566 Abbasia, Cairo (Egypt); EL-Sayed, H.M., E-mail: h_m_elsaid@hotmail.com [Department of Physics, Faculty of Science, Ain Shams University, 11566 Abbasia, Cairo (Egypt); ALsuqia, Ibrahim [Department of Physics, Faculty of Education and Applied Science, Hajjah University, Alshahli, Hajjah (Yemen)

    2015-12-01

    CoFe{sub 2}O{sub 4}/NiFe{sub 2}O{sub 4} core/shell magnetic nanocomposite was synthesized by using hydrothermal method.The analysis of XRD indicated the coexistence of CoFe{sub 2}O{sub 4}, NiFe{sub 2}O{sub 4}as core/shell composite. The core/shell structure of the composite sample has been confirmed by HR-TEM images, EDX and FT-IR measurements. The size of obtained core/shell nanoparticles was 17 nm in core diameter and about 3 nm in shell thickness. The magnetization measurements showed that both the coercive field and the saturation magnetization of the resulting core/shell nanocomposite were slightly decreased compared to those of the CoFe{sub 2}O{sub 4} core but the thermal stability is of the magnetization parameter was enhanced. Furthermore, superparamagnetic phase is established at temperatures higher than the room temperature. The results were discussed in terms of the surface pinning and the magnetic interaction at the interface between the core and shell. - Highlights: • CoFe{sub 2}O{sub 4}/NiFe{sub 2}O{sub 4} core/shell could be prepared by hydrothermal method. • The structural analysis proved the formation of NiFe{sub 2}O{sub 4} shell with thickness 3 nm. • The thermal stability of M{sub s} and H{sub c} is enhanced due to the presence of NiFe{sub 2}O{sub 4} as a shell. • Super paramagnetic transition is confirmed and the effective magnetic anisotropy was calculated.

  15. Structural and magnetic characterization of three tetranuclear Cu(II) complexes with face-sharing-dicubane/double-open-cubane like core framework

    Science.gov (United States)

    Paul, Aparup; Bertolasi, Valerio; Figuerola, Albert; Manna, Subal Chandra

    2017-05-01

    Three novel tetranuclear copper(II) complexes namely [Cu4(L1)4]•2(dmf) (1), [Cu4(L1)4] (2) and [Cu4(L2)2(HL2)2(H2O)2]•2(ClO4)·6(H2O) (3) (H2L1, (E)-2-((1-hydroxybutan-2-ylimino)methyl)phenol; H2L2, (E)-2-((1-hydroxybutan-2-ylimino)methyl)-6-methoxyphenol)) were synthesized from the self-assembly of copper(II) perchlorate and the tridentate Schiff base ligands. The structural determination reveals that complex 1 crystallizes in the monoclinic system with space group C2/c, whereas both the complexes 2 and 3 crystallize in the triclinic system with space group P-1. Complexes 1 and 2 possess face-sharing dicubane core, on the other hand complex 3 has double open cubane core structure. The copper(II) ions in the cubane core are in distorted square planar geometries, and weak π…π and C-H…π interactions lead to formation of a 2D supramolecular architecture for complexes 1 and 2. At room temperature complexes 1, 2 and 3, exhibit fluorescence with a quantum yield (Φs) of 0.47, 0.49 and 0.38, respectively. Variable temperature magnetic susceptibility measurements in the range 2-300 K indicate an overall weak antiferromagnetic exchange coupling in all complexes. The PHI program was used to study their magnetic behaviour. In agreement with their face-sharing dicubane structure, a Hamiltonian of the type H =- J1(S1S2+S1S2'+S1'S2+S1'S2') - J2S1S1', where S1 = S1' = S2 = S2' = SCu =1/2, was used for studying complexes 1 and 2. Simulations performed suggest magnetic exchange constants with values close to J1 =-20 cm-1 and J2 =0 cm-1 for these complexes. On the other hand, the spin Hamiltonian H =- J1(S1S4+S2S3) - J2(S1S3+S2S4) - J3S1S2, where S1 = S2 = S3 = S4 = SCu =1/2, was used to study the magnetic behaviour of the double open cubane core of complex 3 and a good agreement between the experimental and simulated results was found by using the parameters g1 = g2 =2.20, g3 = g4 =2.18, J1 =-36 cm-1, J2 =-44 cm-1 and J3 =0 cm-1.

  16. Design and analysis of a 3D-flux flux-switching permanent magnet machine with SMC cores and ferrite magnets

    Directory of Open Access Journals (Sweden)

    Chengcheng Liu

    2017-05-01

    Full Text Available Since permanent magnets (PM are stacked between the adjacent stator teeth and there are no windings or PMs on the rotor, flux-switching permanent magnet machine (FSPMM owns the merits of good flux concentrating and robust rotor structure. Compared with the traditional PM machines, FSPMM can provide higher torque density and better thermal dissipation ability. Combined with the soft magnetic composite (SMC material and ferrite magnets, this paper proposes a new 3D-flux FSPMM (3DFFSPMM. The topology and operation principle are introduced. It can be found that the designed new 3DFFSPMM has many merits over than the traditional FSPMM for it can utilize the advantages of SMC material. Moreover, the PM flux of this new motor can be regulated by using the mechanical method. 3D finite element method (FEM is used to calculate the magnetic field and parameters of the motor, such as flux density, inductance, PM flux linkage and efficiency map. The demagnetization analysis of the ferrite magnet is also addressed to ensure the safety operation of the proposed motor.

  17. Controllable synthesis of a novel magnetic core-shell nanoparticle for dual-modal imaging and pH-responsive drug delivery

    Science.gov (United States)

    Xu, Chen; Zhang, Cheng; Wang, Yingxi; Li, Liu; Li, Ling; Whittaker, Andrew K.

    2017-12-01

    In this study, novel magnetic core-shell nanoparticles Fe3O4@La-BTC/GO have been synthesized by the layer-by-layer self-assembly (LBL) method and further modified by attachment of amino-modified PEG chains. The nanoparticles were thoroughly characterized by x-ray diffraction, FTIR, scanning electron microscopy and transmission electron microscopy. The core-shell structure was shown to be controlled by the LBL method. The drug loading of doxorubicin (DOX) within the Fe3O4@La-BTC/GO-PEG nanoparticles with different numbers of deposited layers was investigated. It was found that DOX loading increased with increasing number of metal organic framework coating layers, indicating that the drug loading can be controlled through the controllable LBL method. Cytotoxicity assays indicated that the Fe3O4@La-BTC/GO-PEG nanoparticles were biocompatible. The DOX was released rapidly at pH 3.8 and pH 5.8, but at pH 7.4 the rate and extent of release was greatly attenuated. The nanoparticles therefore demonstrate an excellent pH-triggered drug release. In addition, the particles could be tracked by magnetic resonance imaging (MRI) and fluorescence optical imaging (FOI). A clear dose-dependent contrast enhancement in T 2-weighted MR images and fluorescence images indicate the potential of these nanoparticles as dual-mode MRI/FOI contrast agents.

  18. Synthesis of magnetic core-shell structure Fe3O4@MCM-41 nanoparticle by vesicles in aqueous solutions☆

    Institute of Scientific and Technical Information of China (English)

    Weiming Song; Xuesong Liu; Ying Yang; Xuejia Han; Qigang Deng

    2015-01-01

    In this study, magnetic core–shel structure Fe3O4@MCM-41 nanoparticles were synthesized with vesicles as soft templates. In the preparation, FeCl2 and tetraethy orthosilicate (TEOS) were selected as Fe processor and Si pre-cursor, respectively. Stable vesicles first formed in 0.03 mol·L−1 1:2 mixture of anionic surfactant sodium dode-cyl sulfate and cationic surfactant cetyltrimethyl ammonium bromide. Then, TEOS was added in the vesicle aqueous solution, leading to a highly dispersed solution. After high-temperature calcination, Fe3O4@MCM-41 nanoparticles were obtained. Their structure and morphology were characterized by Saturn Digisizer, transmis-sion electron microscope and vibrating sample magneto-meter. The results indicate that the vesicles are spherical and their size could be tuned between 20 and 50 nm. The average grain diameter of synthesize magnetic core–shel Fe3O4@MCM-41 particles is 100–150 nm and most of them are in el iptical shape. The dispersion of magnet-ic particles is very good and magnetization values are up to 33.44 emu·g−1, which are superior to that of other Fe3O4 materials reported.

  19. Amperometric glucose sensor based on enhanced catalytic reduction of oxygen using glucose oxidase adsorbed onto core-shell Fe3O4-silica-Au magnetic nanoparticles

    International Nuclear Information System (INIS)

    Wang Aijun; Li Yongfang; Li Zhonghua; Feng Jiuju; Sun Yanli; Chen Jianrong

    2012-01-01

    Monodisperse Fe 3 O 4 magnetic nanoparticles (NPs) were prepared under facile solvothermal conditions and successively functionalized with silica and Au to form core/shell Fe 3 O 4 -silica-Au NPs. Furthermore, the samples were used as matrix to construct a glucose sensor based on glucose oxidase (GOD). The immobilized GOD retained its bioactivity with high protein load of 3.92 × 10 −9 mol·cm −2 , and exhibited a surface-controlled quasi-reversible redox reaction, with a fast heterogeneous electron transfer rate of 7.98 ± 0.6 s −1 . The glucose biosensor showed a broad linear range up to 3.97 mM with high sensitivity of 62.45 μA·mM −1 cm −2 and fast response (less than 5 s). - Graphical abstract: Core-shell structured Fe 3 O 4 -silica-Au nanoparticles were prepared and used as matrix to construct an amperometric glucose sensor based on glucose oxidase, which showed broad linear range, high sensitivity, and fast response. Highlights: ► Synthesis of monodispersed Fe 3 O 4 nanoparticles. ► Fabrication of core/shell Fe 3 O 4 -silica-Au nanoparticles. ► Construction of a novel glucose sensor with wide linear range, high sensitivity and fast response.

  20. Fabrication of core-shell Fe{sub 3}O{sub 4}@MIL-100(Fe) magnetic microspheres for the removal of Cr(VI) in aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Qingxiang, E-mail: qxyangzz@163.com; Zhao, Qianqian; Ren, ShuangShuang; Lu, Qiongqiong; Guo, Xinmeng; Chen, Zhijun, E-mail: chenzj@zzuli.edu.cn

    2016-12-15

    Facile regeneration of an adsorbent is very important for commercial feasibility. One typical highly porous metal-organic framework (MOF) materials based on MIL-100(Fe) and magnetic iron oxide particles (denoted as MMCs) with diameter about of 350 nm were successfully synthesized. The growth of MIL-100(Fe) shell on the surface of Fe{sub 3}O{sub 4} was utilized precursor as crystal seed via in-situ step hydrothermal reaction. It is a simple way to obtain well organized core-shell MOF composites, compared to the step-by-step method. MMCs were firstly used to uptake of Cr(VI) anions in aqueous solution. Adsorption experiments were carried out in batch sorption mode investigating with the factors of contact time (0–1000 min), pH (from 2 to 12), dose of adsorbent (4–25 mg), and initial Cr(VI) concentration (range from 10 to 100 ppm). - Graphical abstract: One typical highly porous metal-organic framework (MOF) materials based on MIL-100(Fe) and magnetic iron oxide particles (denoted as MMCs) were successfully synthesized. Utilizing Fe{sub 3}O{sub 4} precursor as crystal seed to grow MIL-100(Fe) shell by in-situ step hydrothermal reaction. It is a simple way to obtain core-shell MOF composites. MMCs could effectively uptake of Cr(VI) anions in aqueous solution. - Highlights: • Fe{sub 3}O{sub 4}@MIL-100(Fe) composites with core-shell structure were successfully prepared through a simple method. • The influence factors on Cr(VI) adsorption by Fe{sub 3}O{sub 4}@MIL-100(Fe) were investigated. • Cr(VI) can efficiently adsorbed by Fe{sub 3}O{sub 4}@MIL-100(Fe) composites from aqueous solution.

  1. Performance Improvement of a Magnetized Coaxial Plasma Gun by adopting Iron-core Bias Coil and New Pre-Ionization System

    Science.gov (United States)

    Edo, Takahiro; Asai, T.; Tanaka, F.; Yamada, S.; Hosozawa, A.; Gota, H.; Roche, T.; Allfrey, I.; Matsumoto, T.

    2017-10-01

    A magnetized coaxial plasma gun (MCPG) is a device used to generate a compact toroid (CT), which has a spheromak-like configuration. A typical MCPG consists of a set of axisymmetric cylindrical electrodes, bias coil, and gas-puff valves. In order to expand the CT operating range, the distributions of the bias magnetic field and neutral gas have been investigated. We have developed a new means of generating stuffing flux. By inserting an iron core into the bias coil, the magnetic field increases dramatically; even a small current of a few Amps produces a sufficient bias field. According to a simulation result, it was also suggested that the radial distribution of the bias field is easily controlled. The ejected CT and the target FRC are cooled by excess neutral gas that typical MCPGs require to initiate a breakdown; therefore, we have adopted a miniature gun as a new pre-ionization (PI) system. By introducing this PI system, the breakdown occurs at lower neutral gas density so that the amount of excess neutral gas can be reduced.

  2. Synthesis, photophysical analysis, and in vitro cytotoxicity assessment of the multifunctional (magnetic and luminescent) core@shell nanomaterial based on lanthanide-doped orthovanadates

    International Nuclear Information System (INIS)

    Szczeszak, Agata; Ekner-Grzyb, Anna; Runowski, Marcin; Mrówczyńska, Lucyna; Grzyb, Tomasz; Lis, Stefan

    2015-01-01

    Rare earths orthovanadates (REVO 4 ) doped with luminescent lanthanide ions (Ln 3+ ) play an important role as promising light-emitting materials. Gadolinium orthovanadate exhibits strong absorption of ultraviolet radiation and as a matrix doped with Eu 3+ ions is well known for its efficient and intense red emission, induced by energy transfer from the VO 4 3− groups to Eu 3+ ions. In the presented study, Fe 3 O 4 @SiO 2 @GdVO 4 :Eu 3+ 5 % nanomaterial was investigated. The core@shell structures demonstrate attractive properties, such as higher thermal stability, enhanced water solubility, increased optical response, higher luminescence, longer decay times, and magnetic properties. Silica coating may protect nanocrystals from the surrounding environment. Therefore, such silica-covered nanoparticles (NPs) are successfully utilized in biomedical research. Multifunctional magnetic nanophosphors are very interesting due to their potential biomedical applications such as magnetic resonance imaging, hyperthermic treatment, and drug delivery. Therefore, the aim of our study was to investigate photophysical, chemical, and biological properties of multifunctional REVO 4 doped with Ln 3+ . Moreover, the studied NPs did not affect erythrocyte sedimentation rate, cell membrane permeability, and morphology of human red blood cells

  3. Synthesis, photophysical analysis, and in vitro cytotoxicity assessment of the multifunctional (magnetic and luminescent) core@shell nanomaterial based on lanthanide-doped orthovanadates

    Energy Technology Data Exchange (ETDEWEB)

    Szczeszak, Agata [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland); Ekner-Grzyb, Anna [Adam Mickiewicz University, Department of Behavioural Ecology, Faculty of Biology (Poland); Runowski, Marcin [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland); Mrówczyńska, Lucyna [Adam Mickiewicz University, Department of Cell Biology, Faculty of Biology (Poland); Grzyb, Tomasz; Lis, Stefan, E-mail: blis@amu.edu.pl [Adam Mickiewicz University, Department of Rare Earths, Faculty of Chemistry (Poland)

    2015-03-15

    Rare earths orthovanadates (REVO{sub 4}) doped with luminescent lanthanide ions (Ln{sup 3+}) play an important role as promising light-emitting materials. Gadolinium orthovanadate exhibits strong absorption of ultraviolet radiation and as a matrix doped with Eu{sup 3+} ions is well known for its efficient and intense red emission, induced by energy transfer from the VO{sub 4}{sup 3−} groups to Eu{sup 3+} ions. In the presented study, Fe{sub 3}O{sub 4}@SiO{sub 2}@GdVO{sub 4}:Eu{sup 3+} 5 % nanomaterial was investigated. The core@shell structures demonstrate attractive properties, such as higher thermal stability, enhanced water solubility, increased optical response, higher luminescence, longer decay times, and magnetic properties. Silica coating may protect nanocrystals from the surrounding environment. Therefore, such silica-covered nanoparticles (NPs) are successfully utilized in biomedical research. Multifunctional magnetic nanophosphors are very interesting due to their potential biomedical applications such as magnetic resonance imaging, hyperthermic treatment, and drug delivery. Therefore, the aim of our study was to investigate photophysical, chemical, and biological properties of multifunctional REVO{sub 4} doped with Ln{sup 3+}. Moreover, the studied NPs did not affect erythrocyte sedimentation rate, cell membrane permeability, and morphology of human red blood cells.

  4. Synthesis, photophysical analysis, and in vitro cytotoxicity assessment of the multifunctional (magnetic and luminescent) core@shell nanomaterial based on lanthanide-doped orthovanadates

    Science.gov (United States)

    Szczeszak, Agata; Ekner-Grzyb, Anna; Runowski, Marcin; Mrówczyńska, Lucyna; Grzyb, Tomasz; Lis, Stefan

    2015-03-01

    Rare earths orthovanadates (REVO4) doped with luminescent lanthanide ions (Ln3+) play an important role as promising light-emitting materials. Gadolinium orthovanadate exhibits strong absorption of ultraviolet radiation and as a matrix doped with Eu3+ ions is well known for its efficient and intense red emission, induced by energy transfer from the VO4 3- groups to Eu3+ ions. In the presented study, Fe3O4@SiO2@GdVO4:Eu3+ 5 % nanomaterial was investigated. The core@shell structures demonstrate attractive properties, such as higher thermal stability, enhanced water solubility, increased optical response, higher luminescence, longer decay times, and magnetic properties. Silica coating may protect nanocrystals from the surrounding environment. Therefore, such silica-covered nanoparticles (NPs) are successfully utilized in biomedical research. Multifunctional magnetic nanophosphors are very interesting due to their potential biomedical applications such as magnetic resonance imaging, hyperthermic treatment, and drug delivery. Therefore, the aim of our study was to investigate photophysical, chemical, and biological properties of multifunctional REVO4 doped with Ln3+. Moreover, the studied NPs did not affect erythrocyte sedimentation rate, cell membrane permeability, and morphology of human red blood cells.

  5. Core-shell Fe3O4 polydopamine nanoparticles as sorbent for magnetic dispersive solid-phase extraction of copper from food samples.

    Science.gov (United States)

    Yavuz, Emre; Tokalıoğlu, Şerife; Patat, Şaban

    2018-10-15

    In the present study, core-shell Fe 3 O 4 polydopamine nanoparticles were synthesized and used for the first time as an adsorbent for the vortex assisted magnetic dispersive solid phase extraction of copper from food samples. After elution, copper in the solutions was determined by FAAS. The adsorbent was characterized using X-ray diffraction, scanning electron microscopy, energy dispersive X-ray spectroscopy, Fourier transform infrared spectroscopy, Brunauer-Emmett-Teller surface area, and zeta potential measurements. Various parameters affecting the magnetic dispersive solid-phase extraction were evaluated. The optimum pH and magnetic adsorbent amount were found to be 5 and 40 mg, respectively. Elution was made by 3 mL of 2 mol L -1 HNO 3 .The major advantage of the method is the fast equilibration during adsorption without the need for vortexing or shaking. The preconcentration factor and detection limit of the method were found to be 150 and 0.22 mg L -1 , respectively. The precision (as RSD%) and adsorption capacity of the method were 3.7% and 28 mg g -1 , respectively. The method was successfully verified by analyzing four certified reference materials (SPS-WW1 Batch 114 Wastewater, TMDA-53.3 Lake water, BCR-482 Lichen and 1573a Tomato Leaves) and by addition/recovery tests of copper standard solution in organic baby food, muesli, macaroni, honey, and milk samples. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. One-pot synthesis of porous Fe{sub 3}O{sub 4} shell/silver core nanocomposites used as recyclable magnetic antibacterial agents

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Weijun, E-mail: wjfang81@gmail.com [College of Basic Medicine, Anhui Medical University, Hefei 230032, Anhui (China); Zheng, Jun; Chen, Cheng [Center of Modern Experimental Technology, Anhui University, Hefei 230039, Anhui (China); Zhang, Huabing; Lu, Yunxia [College of Basic Medicine, Anhui Medical University, Hefei 230032, Anhui (China); Ma, Ling [Department of Chemistry, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005, Fujian (China); Chen, Guangjun [College of Basic Medicine, Anhui Medical University, Hefei 230032, Anhui (China)

    2014-05-01

    Porous Fe{sub 3}O{sub 4} shell/silver core nanocomposites featuring sustainable and recyclable antibacterial activity have been successfully prepared via a facile one-pot hydrothermal method. The unique structural feature of the Ag@Fe{sub 3}O{sub 4} nanocomposites with Ag embedded in porous Fe{sub 3}O{sub 4} shell endows them with the ability of sustained-release of silver ions. Their antimicrobial activity studies were investigated on both Gram negative Escherichia coli and Gram positive Bacillus subtilis, which demonstrate that the nanocomposites are highly toxic to microorganisms and exhibit sustainable antibacterial activity. Besides, the Ag@Fe{sub 3}O{sub 4} nanocomposites can be separated easily from the medium by a small magnet, which provided an effective way to eliminate the residual nanosilver from the surroundings. We finally demonstrate that the recovered nanocomposites exhibit recyclable antibacterial activity, acting as an ideal long-acting antibacterial agent. - Highlights: • The porous Fe{sub 3}O{sub 4} shell/silver core nanocomposites have been successfully prepared via a simple one-pot hydrothermal method. • The as-prepared Ag@Fe{sub 3}O{sub 4} nanocomposites exhibit high antibacterial activity against both Gram-positive and Gram-negative bacteria. • The porous Fe{sub 3}O{sub 4} shell/silver core nanocomposites show a stronger antibacterial ability than the solid Fe{sub 3}O{sub 4} shell/silver core nanocomposites. • The recovery nanocomposites still have antibacterial activity and can be reused.

  7. Structural and magnetic characterization of three tetranuclear Cu(II) complexes with face-sharing-dicubane/double-open-cubane like core framework

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Aparup [Department of Chemistry and Chemical Technology, Vidyasagar University, Midnapore 721102, West Bengal (India); Bertolasi, Valerio [Dipartimento di Scienze Chimiche e Farmaceutiche, Centro di Strutturistica Diffrattometrica, Università di Ferrara, Via L. Borsari, 46, 44100 Ferrara (Italy); Figuerola, Albert [Departament de Química Inorgànica i Orgànica (Secció de Química Inorgànica) and Institut de Nanociència i Nanotecnologia (IN2UB), Universitat de Barcelona, Martí i Franquès 1-11, 08028 Barcelona (Spain); Manna, Subal Chandra, E-mail: scmanna@mail.vidyasagar.ac.in [Department of Chemistry and Chemical Technology, Vidyasagar University, Midnapore 721102, West Bengal (India)

    2017-05-15

    Three novel tetranuclear copper(II) complexes namely [Cu{sub 4}(L{sup 1}){sub 4}]∙2(dmf) (1), [Cu{sub 4}(L{sup 1}){sub 4}] (2) and [Cu{sub 4}(L{sup 2}){sub 2}(HL{sup 2}){sub 2}(H{sub 2}O){sub 2}]∙2(ClO{sub 4})·6(H{sub 2}O) (3) (H{sub 2}L{sup 1}, (E)−2-((1-hydroxybutan-2-ylimino)methyl)phenol; H{sub 2}L{sup 2}, (E)−2-((1-hydroxybutan-2-ylimino)methyl)−6-methoxyphenol)) were synthesized from the self-assembly of copper(II) perchlorate and the tridentate Schiff base ligands. The structural determination reveals that crystallizes in the monoclinic system with space group C2/c, whereas both the and crystallize in the triclinic system with space group P-1. and possess face-sharing dicubane core, on the other hand complex 3 has double open cubane core structure. The copper(II) ions in the cubane core are in distorted square planar geometries, and weak π…π and C–H…π interactions lead to formation of a 2D supramolecular architecture for and . At room temperature and , exhibit fluorescence with a quantum yield (Φ{sub s}) of 0.47, 0.49 and 0.38, respectively. Variable temperature magnetic susceptibility measurements in the range 2–300 K indicate an overall weak antiferromagnetic exchange coupling in all complexes. The PHI program was used to study their magnetic behaviour. In agreement with their face-sharing dicubane structure, a Hamiltonian of the type H =– J{sub 1}(S{sub 1}S{sub 2}+S{sub 1}S{sub 2’}+S{sub 1'}S{sub 2}+S{sub 1'}S{sub 2’}) – J{sub 2}S{sub 1}S{sub 1’}, where S{sub 1} = S{sub 1’} = S{sub 2} = S{sub 2’} = S{sub Cu} =1/2, was used for studying and . Simulations performed suggest magnetic exchange constants with values close to J{sub 1} =−20 cm{sup −1} and J{sub 2} =0 cm{sup -1} for these complexes. On the other hand, the spin Hamiltonian H =– J{sub 1}(S{sub 1}S{sub 4}+S{sub 2}S{sub 3}) – J{sub 2}(S{sub 1}S{sub 3}+S{sub 2}S{sub 4}) – J{sub 3}S{sub 1}S{sub 2}, where S{sub 1} = S{sub 2} = S{sub 3} = S{sub 4

  8. Removal of Congo Red by magnetic mesoporous titanium dioxide-graphene oxide core-shell microspheres for water purification.

    Science.gov (United States)

    Li, Leilei; Li, Xiangjun; Duan, Huimin; Wang, Xiaojiao; Luo, Chuannan

    2014-06-14

    Magnetic mesoporous titanium dioxide-graphene oxide (Fe3O4@mTiO2@GO) with a large surface area and a good magnetic responsiveness was synthesized by immobilizing a mesoporous titanium dioxide (mTiO2) shell on the surface of magnetic Fe3O4 nanoparticles prior to binding with graphene oxide (GO). It showed a tunable pore structure and surface properties, and was mechanically strong. The characteristic results of a Fourier transform infrared spectrometer (FTIR), a scanning electron microscope (SEM), a vibrating sample magnetometer (VSM) and X-ray diffraction (XRD) indicated that Fe3O4@mTiO2@GO has been prepared. Fe3O4@mTiO2@GO was used as an adsorbent for the removal of Congo Red (CR) from simulated wastewater with a fast solid-liquid separation in the presence of an external magnetic field. Batch adsorption experiments were performed to evaluate the adsorption conditions and reusability. The results showed that the maximum adsorption capacity was 89.95 mg g(-1), which is much higher than the previously reported values of other absorbent materials. Moreover, the Fe3O4@mTiO2@GO could be repeatedly used via simple treatment without any obvious structure and performance degradation. The adsorption kinetic data were best described by a pseudo-second-order model and the equilibrium adsorptions were well-described by the Freundlich isotherm model. The Fe3O4@mTiO2@GO may be suitable materials for use in CR pollution cleanup if synthesized on a large scale and at a low price in the near future.

  9. MAGNET

    CERN Multimedia

    by B. Curé

    2011-01-01

    The magnet operation was very satisfactory till the technical stop at the end of the year 2010. The field was ramped down on 5th December 2010, following the successful regeneration test of the turbine filters at full field on 3rd December 2010. This will limit in the future the quantity of magnet cycles, as it is no longer necessary to ramp down the magnet for this type of intervention. This is made possible by the use of the spare liquid Helium volume to cool the magnet while turbines 1 and 2 are stopped, leaving only the third turbine in operation. This obviously requires full availability of the operators to supervise the operation, as it is not automated. The cryogenics was stopped on 6th December 2010 and the magnet was left without cooling until 18th January 2011, when the cryoplant operation resumed. The magnet temperature reached 93 K. The maintenance of the vacuum pumping was done immediately after the magnet stop, when the magnet was still at very low temperature. Only the vacuum pumping of the ma...

  10. Proceedings of JSPS-CAS Core University Program seminar on production and steady state confinement of high performance plasmas in magnetic confinement systems

    International Nuclear Information System (INIS)

    Wan Baonian; Toi, Kazuo

    2005-09-01

    The JSPS-CAS Core University Program (CUP) seminar on 'Production and steady-state confinement of high performance plasmas in magnetic confinement systems' was held from 27 July to 29 July 2005 in Institute of Plasma Physics, the Chinese Academy of Sciences, Hefei, China. This seminar was organized in the framework of CUP in the field of plasma and nuclear fusion. About 50 persons including 20 Japanese attendees attended this seminar. Long time sustainment of high confinement and high beta plasmas is crucial for realization of an advanced nuclear fusion reactor. This seminar was motivated to summarize the results of CUP obtained in four years activities of CUP, and to extract crucial issues to be resolved near future, which must drive near and mid- term collaborations in the framework of CUP. The 32 of presented papers are indexed individually. (J.P.N.)

  11. Adsorption process of fluoride from drinking water with magnetic core-shell Ce-Ti@Fe3O4 and Ce-Ti oxide nanoparticles.

    Science.gov (United States)

    Abo Markeb, Ahmad; Alonso, Amanda; Sánchez, Antoni; Font, Xavier

    2017-11-15

    Synthesized magnetic core-shell Ce-Ti@Fe 3 O 4 nanoparticles were tested, as an adsorbent, for fluoride removal and the adsorption studies were optimized. Adsorption capacity was compared with the synthesized Ce-Ti oxide nanoparticles. The adsorption equilibrium for the Ce-Ti@Fe 3 O 4 adsorbent was found to occur in cycles of adsorption-desorption. Although the nanoparticles suffer slight structure modifications after their reusability, they keep their adsorption capacity. Likewise, the efficiency of the Ce-Ti@Fe 3 O 4 was demonstrated when applied to real water to obtain a residual concentration of F - below the maximum contaminated level, 1.5mg/L (WHO, 2006). Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Comparison between measured and computed magnetic flux density distribution of simulated transformer core joints assembled from grain-oriented and non-oriented electrical steel

    Directory of Open Access Journals (Sweden)

    Hamid Shahrouzi

    2018-04-01

    Full Text Available The flux distribution in an overlapped linear joint constructed in the central region of an Epstein Square was studied experimentally and results compared with those obtained using a computational magnetic field solver. High permeability grain-oriented (GO and low permeability non-oriented (NO electrical steels were compared at a nominal core flux density of 1.60 T at 50 Hz. It was found that the experimental results only agreed well at flux densities at which the reluctance of different paths of the flux are similar. Also it was revealed that the flux becomes more uniform when the working point of the electrical steel is close to the knee point of the B-H curve of the steel.

  13. The role of interfacial metal silicates on the magnetism in FeCo/SiO{sub 2} and Fe{sub 49%}Co{sub 49%}V{sub 2%}/SiO{sub 2} core/shell nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Desautels, R. D., E-mail: rddesautels@physics.umanitoba.ca [Department of Physics and Astronomy, University of Manitoba, Winnipeg, Manitoba R3T 2N2 (Canada); Toyota Research Institute of North America, Ann Arbor, Michigan 48169 (United States); Freeland, J. W. [Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Rowe, M. P. [Toyota Research Institute of North America, Ann Arbor, Michigan 48169 (United States); Lierop, J. van [Department of Physics and Astronomy, University of Manitoba, Winnipeg, Manitoba R3T 2N2 (Canada)

    2015-05-07

    We have investigated the role of spontaneously formed interfacial metal silicates on the magnetism of FeCo/SiO{sub 2} and Fe{sub 49%}Co{sub 49%}V{sub 2%}/SiO{sub 2} core/shell nanoparticles. Element specific x-ray absorption and photoelectron spectroscopy experiments have identified the characteristic spectral features of metallic iron and cobalt from within the nanoparticle core. In addition, metal silicates of iron, cobalt, and vanadium were found to have formed spontaneously at the interface between the nanoparticle core and silica shell. X-ray magnetic circular dichroism experiments indicated that the elemental magnetism was a result of metallic iron and cobalt with small components from the iron, cobalt, and vanadium silicates. Magnetometry experiments have shown that there was no exchange bias loop shift in the FeCo nanoparticles; however, exchange bias from antiferromagnetic vanadium oxide was measured in the V-doped nanoparticles. These results showed clearly that the interfacial metal silicates played a significant role in the magnetism of these core/shell nanoparticles, and that the vanadium percolated from the FeCo-cores into the SiO{sub 2}-based interfacial shell.

  14. Detection of temperature rise at 4.2K by using a dual-core optical fiber-an optical method to detect a quench of a superconducting magnet

    International Nuclear Information System (INIS)

    Tsukamoto, O.; Kokubun, Y.; Toyama, T.

    1986-01-01

    We performed an experiment to detect a temperature rise at cryogenic temperature using a dual-core optical fiber. This fiber has two single-mode optical cores in one fiber. We demonstrated that a temperature rise of 4 K was detectable at 4.2 K. The sensitivity of this method can be improved using a longer fiber. This method may be applicable as a quench detector for superconducting magnets. A quench detector using this optical method is immune from electromagnetic noise, free from troubles caused by break-down of electrical insulator, and has many advantages over a conventional quench detector measuring voltages of a magnet

  15. A novel synthesis method for TiO2 particles with magnetic Fe3O4 cores.

    Science.gov (United States)

    Dong, Qi; Zhang, Keqiang; An, Yi

    2014-01-01

    TiO2@(AC/Fe3O4) (AC is activated carbon) was prepared by using AC and Fe3O4 as joint support. The morphological features, crystal structure, and magnetism of the final product were characterized. The results indicate that TiO2 particles formed on the surface of AC and Fe3O4; the sizes of TiO2 and Fe3O4 were 0.5 and 0.7 μm respectively, and that of AC fell within a wide range. The highly crystalline cubic structures of the TiO2 particles was in accord with the standard X-ray diffractometry spectrum of magnetite and anatase. The maximum saturation magnetization of TiO2@(AC/Fe3O4) was 75 emu g(-1), which was enough to support magnetic recovery. The rate of methylene blue (MB) removal photocatalyzed by TiO2@(AC/Fe3O4) was higher by 50% than that achieved with AC/Fe3O4 photocatalysis, and similar to that achieved with TiO2@AC. The removal rate (kobs) decreased drastically from 1.77 × 10(-2) to 9.36 × 10(-3)min(-1) when the initial concentration of MB solution increased from 2.0 to 5.0 mg L(-1). The kobs value increased from 9.41 × 10(-3) to 1.34 × 10(-2)min(-1) with increasing photocatalyst dosage from 0.2 to 1.0 g, then slightly decreased to 1.33 × 10(-2)min(-1) at 2.0 g dosage.

  16. Geological Development of the Izu-Bonin Forearc Since the Eocene Based on Biostratigraphic, Rock Magnetic, and Sediment Provenance Observations from IODP Expedition 352 Drill Cores

    Science.gov (United States)

    Petronotis, K. E.; Robertson, A.; Kutterolf, S.; Avery, A.; Baxter, A.; Schindlbeck, J. C.; Wang, K. L.; Acton, G.

    2016-12-01

    International Ocean Discovery Program (IODP) Expedition 352 recovered early Oligocene to recent sediments above Eocene igneous basement at 4 sites in the Izu-Bonin Forearc. The sites were selected to investigate the forearc region since subduction initiation in the Eocene, with Sites U1439 and U1442 being cored into the upper trench slope and Sites U1440 and U1441 into the lower trench slope. Postcruise studies of biostratigraphy, sediment chemistry, tephra composition and chronology and magnetic properties, along with observations from prior coring help constrain the regional geological development. Volcanic activity in the area, as inferred from its influence on sediment composition, has varied between long periods of activity and quiescence. Combined whole-rock sediment chemistry and tephra compositions suggest that during the Oligocene to earliest Miocene ( 30-22 Ma) tuffaceous input of predominantly dacitic composition was mainly derived from the intra-oceanic Izu-Bonin Arc. The early Miocene interval ( 22-15 Ma) lacks tuffaceous input, as supported by rock magnetic data. During this period, the forearc subsided beneath the carbonate compensation depth (CCD), as evidenced by radiolarian-bearing mud and metal-rich silty clay. This was followed by input of tephra with bimodal felsic and mafic compositions from the Izu-Bonin Arc from 15 to 5 Ma. Middle Miocene to Quaternary time was characterized by increased carbonate preservation, coupled with abundant, predominantly felsic tephra input, which is chemically indicative of a Japan continental arc source (Honshu), with additional chemically distinctive input from the Izu-Bonin Arc. Extending back to 32 Ma, tephra layers can be correlated between the upper-slope sites, extrapolated to the less well-dated lower-slope sites, and further correlated with onland Japanese tephra (Kutterolf et al., 2016; Goldschmidt Conference). Overall, the new results provide an improved understanding of the regional tectonic evolution.

  17. [Removal and Recycle of Phosphor from Water Using Magnetic Core/Shell Structured Fe₃O₄ @ SiO₂Nanoparticles Functionalized with Hydrous Aluminum Oxide].

    Science.gov (United States)

    Lai, Li; Xie, Qiang; Fang, Wen-kan; Xing, Ming-chao; Wu, De-yi

    2016-04-15

    A novel magnetic core/shell structured nano-particle Fe₃O₄@ SiO₂phosphor-removal ahsorbent functionalized with hydrous aluminum oxides (Fe₃O₄@ SiO₂@ Al₂O₃· nH₂O) was synthesized. Fe₃O₄@ SiO₂@ Al₂O₃· nH₂O was characterized by XRD, TEM, VSM and BET nitrogen adsorption experiment. The XRD and TEM results demonstrated the presence of the core/shell structure, with saturated magnetization and specific surface area of 56.00 emu · g⁻¹ and 47.27 m² · g⁻¹, respectively. In batch phosphor adsorption experiment, the Langmuir adsorption maximum capacity was 12.90 mg · g⁻¹ and nearly 96% phosphor could be rapidly removed within a contact time of 40 mm. Adsorption of phosphor on Fe₃O₄@ SiO₂@ Al₂O₃ · nH₂O was highly dependent on pH condition, and the favored pH range was 5-9 in which the phosphor removal rate was above 90%. In the treatment of sewage water, the recommended dosage was 1.25 kg · t⁻¹. In 5 cycles of adsorption-regeneration-desorption experiment, over 90% of the adsorbed phosphor could be desorbed with 1 mol · L⁻¹ NaOH, and Fe₃O₄@ SiO₂@ Al₂O₃· nH₂O could be reused after regeneration by pH adjustment with slightly decreased phosphor removal rate with increasing recycling number, which proved the recyclability of Fe₃O₄@ SiO₂@ Al₂O₃· nH₂O and thereby its potential in recycling of phosphor resources.

  18. The core paradox.

    Science.gov (United States)

    Kennedy, G. C.; Higgins, G. H.

    1973-01-01

    Rebuttal of suggestions from various critics attempting to provide an escape from the seeming paradox originated by Higgins and Kennedy's (1971) proposed possibility that the liquid in the outer core was thermally stably stratified and that this stratification might prove a powerful inhibitor to circulation of the outer core fluid of the kind postulated for the generation of the earth's magnetic field. These suggestions are examined and shown to provide no reasonable escape from the core paradox.

  19. Synthesis of core-shell magnetic molecularly imprinted polymers and detection of sildenafil and vardenafil in herbal dietary supplements

    International Nuclear Information System (INIS)

    Ding Meijuan; Wu Xiaoli; Yuan Lihua; Wang Shu; Li Yun; Wang Ruoyu; Wen Tingting; Du Shuhu; Zhou, Xuemin

    2011-01-01

    An analytical procedure for selective extraction of sildenafil and vardenafil in herbal dietary supplements (HDSs) has been set up by using the magnetic molecularly imprinted polymers (MMIPs) as the extraction and clean-up materials, followed by high performance liquid chromatography-ultraviolet (HPLC-UV). The MMIPs were prepared by a surface molecular imprinting technique, using Fe 3 O 4 magnetite as a magnetically susceptible component, sildenafil as template molecule, 2-(trifluoromethyl) acrylic acid (TFMAA) as functional monomer, ethylene glycol dimethacrylate (EGDMA) as polymeric matrix components. The MMIPs were characterized by transmission electron microscope (TEM), Fourier transform infrared spectrometer (FT-IR), X-ray diffraction (XRD) and vibrating sample magnetometer (VSM), respectively. The heterogeneity of the MMIPs was modeled with the Freundlich isotherm equation. The resulting MMIPs had high recognition ability and fast binding kinetics for sildenafil. The MMIPs were used as dispersive solid-phase extraction (DSPE) materials to selectively extract sildenafil and vardenafil from HDSs, the contents of sildenafil and vardenafil were found to be 8.05 and 3.86 μg g -1 , respectively, and the average recoveries in spiked HDSs were 70.91-91.75% with a relative standard deviation (R.S.D.) below 7%. The MMIPs were successfully used to selectively enrich and determine sildenafil and vardenafil from HDSs.

  20. Magnetic moments, E3 transitions and the structure of high spin core excited states in 211Rn

    International Nuclear Information System (INIS)

    Poletti, A.R.; Dracoulis, G.D.; Byrne, A.P.; Stuchbery, A.E.; Poletti, S.J.; Gerl, J.; Lewis, P.M.

    1985-03-01

    The results of g-factor measurements of high spin states in 211 Rn are: Esub(x)=8856+Δsup(') keV (Jsup(π)=63/2 - ), g=0.626(7); 6101+Δsup(') keV (49/2 + ), 0.766(8); 5247+Δsup(') keV (43/2 - ), 0.74(2); 3927+Δsup(') keV (35/2 + ), 1/017(12); 1578+Δsup(') keV (17/2 - ), 0.912(9). These results together with measured E3 transition strengths and shell model calculations are used to assign configurations to the core excited states in 211 Rn. Mixed configurations are required to explain the g-factors and enhanced E3 strengths simultaneously

  1. Magnetic moments, E3 transitions and the structure of high-spin core excited states in 211Rn

    International Nuclear Information System (INIS)

    Poletti, A.R.; Dracoulis, G.D.; Byrne, A.P.; Stuchbery, A.E.; Poletti, S.J.; Gerl, J.; Lewis, P.M.

    1985-01-01

    The results of g-factor measurements of high-spin states in 211 Rn are: Esub(x)=8856+Δ' keV (Jsup(π)=63/2 - ), g=0.626(7); 6101+Δ' keV (49/2 + ), 0.766(8); 5347+Δ' keV (43/2 - ), 0.74(2); 3927+Δ keV (35/2 + ), 1.017(12); 1578+Δ keV (17/2 - ), 0.912(9). These results together with measured E3 transition strengths and shell model calculations are used to assign configurations to the core excited states in 211 Rn. Mixed configurations are required to explain the g-factors and enhanced E3 strengths simultaneously. (orig.)

  2. Method of magnetic susceptibility mapping of drilled cores. Experimental measurements for geologic structures determination; Methode de cartographie de susceptibilite magnetique sur carottes de forage. Mesures experimentales pour la determination de structures geologiques

    Energy Technology Data Exchange (ETDEWEB)

    Delrive, C

    1993-11-08

    The evaluation of the safety of a deep geologic repository for dangerous materials requires the knowledge of the interstitial system of the surrounding host rock. A method is proposed for the determination of geologic structures (in particular fractures) from the magnetic susceptibility mapping of drilled cores. The feasibility of the method has been demonstrated using a SQUID magneto-gradient meter. A measurement tool using a new magnetic susceptibility captor and a testing bench have been developed. This tool allows the measurement of rocks with a magnetic susceptibility greater than 10{sup -5} SI units and can generate magnetic susceptibility maps with 4 x 4 mm{sup 2} pixels. A magnetic visibility criterion has been defined which allows to foresee if a structure is visible or not. According to the measurements done, it is shown that any centimeter-scale structure with a sufficient magnetic contrast (20%) with respect to the matrix is visible. Therefore, the dip and the orientation of such structure can be determined with a 3 degree and a 5 degree precision, respectively. The position of the structure along the core axis is known with a 4 mm precision. On the other hand, about half of the magnetic contrasts observed do not correspond to the visual analyses and can be explained by very small variations of the mineralogic composition. This last point offers some interesting ways for future research using magnetic susceptibility mapping. (J.S.). 31 refs., 90 figs., 18 tabs., 2 photos., 6 appends.

  3. MAGNET

    CERN Multimedia

    Benoit Curé

    2010-01-01

    Operation of the magnet has gone quite smoothly during the first half of this year. The magnet has been at 4.5K for the full period since January. There was an unplanned short stop due to the CERN-wide power outage on May 28th, which caused a slow dump of the magnet. Since this occurred just before a planned technical stop of the LHC, during which access in the experimental cavern was authorized, it was decided to leave the magnet OFF until 2nd June, when magnet was ramped up again to 3.8T. The magnet system experienced a fault also resulting in a slow dump on April 14th. This was triggered by a thermostat on a filter choke in the 20kA DC power converter. The threshold of this thermostat is 65°C. However, no variation in the water-cooling flow rate or temperature was observed. Vibration may have been the root cause of the fault. All the thermostats have been checked, together with the cables, connectors and the read out card. The tightening of the inductance fixations has also been checked. More tem...

  4. MAGNET

    CERN Multimedia

    B. Curé

    2012-01-01

      The magnet was energised at the beginning of March 2012 at a low current to check all the MSS safety chains. Then the magnet was ramped up to 3.8 T on 6 March 2012. Unfortunately two days later an unintentional switch OFF of the power converter caused a slow dump. This was due to a misunderstanding of the CCC (CERN Control Centre) concerning the procedure to apply for the CMS converter control according to the beam-mode status at that time. Following this event, the third one since 2009, a discussion was initiated to define possible improvement, not only on software and procedures in the CCC, but also to evaluate the possibility to upgrade the CMS hardware to prevent such discharge from occurring because of incorrect procedure implementations. The magnet operation itself was smooth, and no power cuts took place. As a result, the number of magnetic cycles was reduced to the minimum, with only two full magnetic cycles from 0 T to 3.8 T. Nevertheless the magnet suffered four stops of the cryogeni...

  5. MAGNET

    CERN Multimedia

    B. Curé

    2012-01-01

      Following the unexpected magnet stops last August due to sequences of unfortunate events on the services and cryogenics [see CMS internal report], a few more events and initiatives again disrupted the magnet operation. All the magnet parameters stayed at their nominal values during this period without any fault or alarm on the magnet control and safety systems. The magnet was stopped for the September technical stop to allow interventions in the experimental cavern on the detector services. On 1 October, to prepare the transfer of the liquid nitrogen tank on its new location, several control cables had to be removed. One cable was cut mistakenly, causing a digital input card to switch off, resulting in a cold-box (CB) stop. This tank is used for the pre-cooling of the magnet from room temperature down to 80 K, and for this reason it is controlled through the cryogenics control system. Since the connection of the CB was only allowed for a field below 2 T to avoid the risk of triggering a fast d...

  6. Investigating the Role of Shell Thickness and Field Cooling on Saturation Magnetization and Its Temperature Dependence in Fe3O4/γ-Fe2O3 Core/Shell Nanoparticles

    Directory of Open Access Journals (Sweden)

    Ihab M. Obaidat

    2017-12-01

    Full Text Available Understanding saturation magnetization and its behavior with particle size and temperature are essential for medical applications such magnetic hyperthermia. We report the effect of shell thickness and field cooling on the saturation magnetization and its behavior with temperature in Fe3O4/γ-Fe2O3 core/shell nanoparticles of fixed core diameter (8 nm and several shell thicknesses. X-ray diffraction (XRD analysis and transmission electron microscopy (TEM, high-resolution transmission electron microscopy (HRTEM were used to investigate the phase and the morphology of the samples. Selected area electron diffraction (SAED confirmed the core/shell structure and phases. Using a SQUID (San Diego, CA, USA, magnetic measurements were conducted in the temperature range of 2 to 300 K both under zero field-cooling (ZFC and field-cooling (FC protocols at several field-cooling values. In the ZFC state, considerable enhancement of saturation magnetization was obtained with the increase of shell thickness. After field cooling, we observed a drastic enhancement of the saturation magnetization in one sample up to 120 emu/g (50% larger than the bulk value. In both the FC and ZFC states, considerable deviations from the original Bloch’s law were observed. These results are discussed and attributed to the existence of interface spin-glass clusters which are modified by the changes in the shell thickness and the field-cooling.

  7. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  8. Enhancing the magnetic properties of magnetic nanoparticles

    DEFF Research Database (Denmark)

    Ahlburg, Jakob; Saura-Múzquiz, Matilde; Stingaciu, Marian

    with a similar magnetic performance. There are several different ways of enhancing magnetic properties of 3d magnetic compounds. This includes, size control, core-shell particles or mixing hard and soft magnetic materials together to achieve an exchange coupling between the compounds and enhancing the magnetic...... energy product. In order to control the particle size, a hydrothermal synthesis is preferred. This followed by reduction or the oxides into either core shell particles, or a mixture of magnetic oxides and a metallic phase....

  9. Preparation of magnetic core mesoporous shell microspheres with C18-modified interior pore-walls for fast extraction and analysis of phthalates in water samples.

    Science.gov (United States)

    Li, Zhongbo; Huang, Danni; Fu, Chinfai; Wei, Biwen; Yu, Wenjia; Deng, Chunhui; Zhang, Xiangmin

    2011-09-16

    In this study, core-shell magnetic mesoporous microspheres with C18-functionalized interior pore-walls were synthesized through coating Fe(3)O(4) microspheres with a mesoporous inorganic-organic hybrid layer with a n-octadecyltriethoxysilane (C18TES) and tetraethyl orthosilicate (TEOS) as the silica source and cetyltrimethylammonia bromide (CTAB) as a template. The obtained C18-functionalized Fe(3)O(4)@mSiO(2) microspheres possess numerous C18 groups anchored in the interior pore-walls, large surface area (274.7 m(2)/g, high magnetization (40.8 emu/g) and superparamagnetism, uniform mesopores (4.1 nm), which makes them ideal absorbents for simple, fast, and efficient extraction and enrichment of hydrophobic organic compounds in water samples. Several kinds of phthalates were used as the model hydrophobic organic compounds to systematically evaluate the performance of the C18-functionalized Fe(3)O(4)@mSiO(2) microspheres in extracting hydrophobic molecules by using a gas chromatography-mass spectrometry. Various parameters, including eluting solvent, the amounts of absorbents, extraction time and elution time were optimized. Hydrophobic extraction was performed in the interior pore of magnetic mesoporous microspheres, and the materials had the anti-interference ability to macromolecular proteins, which was also investigated in the work. Under the optimized conditions, C18-functionalized Fe(3)O(4)@mSiO(2) microspheres were successfully used to analyze the real water samples. The results indicated that this novel method was fast, convenient and efficient for the target compounds and could avoid being interfered by macromolecules. Copyright © 2011 Elsevier B.V. All rights reserved.

  10. Iron-oxide Magnetic, Morphologic, and Compositional Tracers of Sediment Provenance and Ice Sheet Extent in the ANDRILL AND-1B Drill Core, Ross Sea, Antarctica (Invited)

    Science.gov (United States)

    Brachfeld, S. A.; Pinzon, J.; Darley, J. S.; Sagnotti, L.; Kuhn, G.; Florindo, F.; Wilson, G. S.; Ohneiser, C.; Monien, D.; Joseph, L. H.

    2013-12-01

    The first drilling season of the Antarctic Drilling Program (ANDRILL) recovered a 13.57 million year Miocene through Pleistocene record of paleoclimate change (core AND-1B) within the Ross Sea. The magnetic mineral assemblage records the varying contributions of biological productivity, changing sediment sources, the emergence of volcanic centers, and post-depositional diagenesis. Characterization of bedrock samples from the McMurdo Volcanic Group (MVG) and Transantarctic Mountain (TAM) lithologic units allows us to construct fingerprints for the major source rocks bordering the Ross Sea, and identify their signatures within the AND-1B sediment. Key parameters that can be traced from source rock to sediment for the MVG-derived sediment include a 100-200 C order-disorder transition, titanomaghemite grains with homogenous textures but with substantial Al and Mg content, Fe-spinels with substantial Al, Cr, Mg, and Ti content, and titanomagnetite host grains with 1-3 swarms of ilmenite lamellae (both with variable amounts of oxidation). Distinctive signatures in TAM lithologies include low S-ratios in Koettlitz Group gneisses and Fe-sulfides with magnetite intergrowths in Byrd Glacier basement samples. The Cambrian Granite Harbor Intrusive Complex is characterized by coarse, homogeneous Mn-bearing ilmenite and nearly pure magnetite. The Jurassic dolerites and basalts of the Ferrar Group contain pseudo single domain to stable single domain-sized Fe-oxides with low-Ti content and homogeneous textures. Cu-Fe sulfides are also present in the Ferrar Group. Diamictites in the Pliocene-Pleistocene section of the AND-1B drill core contains Fe-oxide assemblages with MVG-type rock magnetic and textural characteristics, while the Miocene diamictites contain TAM-type signatures. These observations can be explained by increased ice flow from the west during the Miocene and/or the absence of MVG volcanic centers, which had not yet reached a significant size. During the Pliocene and

  11. Application of Fe3O4@MIL-100 (Fe) core-shell magnetic microspheres for evaluating the sorption of organophosphate esters to dissolved organic matter (DOM).

    Science.gov (United States)

    Pang, Long; Yang, Peijie; Yang, Huiqiang; Ge, Liming; Xiao, Jingwen; Zhou, Yifan

    2018-06-01

    Organophosphate esters (OPEs) are widely used as flame retardants and plasticizers in many products and materials. Because of the potential biologic toxicity on human beings, OPEs are regarded as a class of emerging pollutants. Dissolved organic matters (DOM) have significant effects on the bioavailability and toxicity of the pollutants in the environment. Negligible-depletion solid-phase microextraction (nd-SPME) is an efficient way for measuring the freely dissolved pollutants but suffers from long equilibrium time. Metal-organic frameworks (MOFs) are a class of porous crystalline materials with unique properties such as high pore volume, regular porosity, and tunable pore size, being widely used for the extraction of various organic compounds. Here we developed a novel method for quick determination the sorption coefficients of OPEs to DOM in aquatic phase using Fe 3 O 4 @MIL-100 (Fe) core-shell magnetic microspheres. The mesoporous structures of the as-synthesized microspheres hindered the extraction of OPEs which associated with humic acid due to the volume exclusion effect. However, the freely dissolved OPEs can access into the mesoporous and then were extracted by MIL-100 (Fe). Due to the small pore size (4.81 nm), large surface area (141 m 2  g -1 ), high pore volume (0.17 g 3  g -1 ), and ultra-thin MOFs layers, Fe 3 O 4 @MIL-100 (Fe) core-shell magnetic microspheres have large contact area for the analytes in aqueous phase and therefore the diffusion distance was largely shortened. Besides, the microspheres can be collected conveniently after the extraction process by applying a magnetic field. Compared to the nd-SPME method with 35 h equilibration time (t 90% ), the proposed method for these studied OPEs only need 24 min to achieve equilibration. The sorption coefficients (logK DOC ) of the OPEs to humic acid were ranged from 3.84-5.28, which were highly consistent with the results by using polyacrylate-coated fiber and polydimethylsiloxane

  12. Synthesis route and three different core-shell impacts on magnetic characterization of gadolinium oxide-based nanoparticles as new contrast agents for molecular magnetic resonance imaging

    Science.gov (United States)

    Azizian, Gholamreza; Riyahi-Alam, Nader; Haghgoo, Soheila; Moghimi, Hamid Reza; Zohdiaghdam, Reza; Rafiei, Behrooz; Gorji, Ensieh

    2012-10-01

    Despite its good resolution, magnetic resonance imaging intrinsically has low sensitivity. Recently, contrast agent nanoparticles have been used as sensitivity and contrast enhancer. The aim of this study was to investigate a new controlled synthesis method for gadolinium oxide-based nanoparticle preparation. For this purpose, diethyleneglycol coating of gadolinium oxide (Gd2O3-DEG) was performed using new supervised polyol route, and small particulate gadolinium oxide (SPGO) PEGylation was obtained with methoxy-polyethylene-glycol-silane (550 and 2,000 Da) coatings as SPGO-mPEG-silane550 and 2,000, respectively. Physicochemical characterization and magnetic properties of these three contrast agents in comparison with conventional Gd-DTPA were verified by dynamic light scattering transmission electron microscopy, Fourier transform infrared spectroscopy, inductively coupled plasma, X-ray diffraction, vibrating sample magnetometer, and the signal intensity and relaxivity measurements were performed using 1.5-T MRI scanner. As a result, the nanoparticle sizes of Gd2O3-DEG, SPGO-mPEG-silane550, and SPGO-mPEG-silane2000 could be reached to 5.9, 51.3, 194.2 nm, respectively. The image signal intensity and longitudinal ( r 1) and transverse relaxivity ( r 2) measurements in different concentrations (0.3 to approximately 2.5 mM), revealed the r 2/ r 1 ratios of 1.13, 0.89, 33.34, and 33.72 for Gd-DTPA, Gd2O3-DEG, SPGO-mPEG-silane550, and SPGO-mPEG-silane2000, respectively. The achievement of new synthesis route of Gd2O3-DEG resulted in lower r 2/ r 1 ratio for Gd2O3-DEG than Gd-DTPA and other previous synthesized methods by this and other groups. The smaller r 2/ r 1 ratios of two PEGylated-SPGO contrast agents in our study in comparison with r 2/ r 1 ratio of previous PEGylation ( r 2/ r 1 = 81.9 for mPEG-silane 6,000 MW) showed that these new three introduced contrast agents could potentially be proper contrast enhancers for cellular and molecular MR imaging.

  13. MAGNET

    CERN Multimedia

    B. Curé

    2012-01-01

      The magnet and its sub-systems were stopped at the beginning of the winter shutdown on 8th December 2011. The magnet was left without cooling during the cryogenics maintenance until 17th January 2012, when the cryoplant operation resumed. The magnet temperature reached 93 K. The vacuum pumping was maintained during this period. During this shutdown, the yearly maintenance was performed on the cryogenics, the vacuum pumps, the magnet control and safety systems, and the power converter and discharge lines. Several preventive actions led to the replacement of the electrovalve command coils, and the 20A DC power supplies of the magnet control system. The filters were cleaned on the demineralised water circuits. The oil of the diffusion pumps was changed. On the cryogenics, warm nitrogen at 343 K was circulated in the cold box to regenerate the filters and the heat exchangers. The coalescing filters have been replaced at the inlet of both the turbines and the lubricant trapping unit. The active cha...

  14. MAGNET

    CERN Multimedia

    B. Curé

    2013-01-01

      The magnet was operated without any problem until the end of the LHC run in February 2013, apart from a CERN-wide power glitch on 10 January 2013 that affected the CMS refrigerator, causing a ramp down to 2 T in order to reconnect the coldbox. Another CERN-wide power glitch on 15 January 2013 didn’t affect the magnet subsystems, the cryoplant or the power converter. At the end of the magnet run, the reconnection of the coldbox at 2.5 T was tested. The process will be updated, in particular the parameters of some PID valve controllers. The helium flow of the current leads was reduced but only for a few seconds. The exercise will be repeated with the revised parameters to validate the automatic reconnection process of the coldbox. During LS1, the water-cooling services will be reduced and many interventions are planned on the electrical services. Therefore, the magnet cryogenics and subsystems will be stopped for several months, and the magnet cannot be kept cold. In order to avoid unc...

  15. MAGNET

    CERN Multimedia

    Benoit Curé

    2010-01-01

    The magnet was successfully operated at the end of the year 2009 despite some technical problems on the cryogenics. The magnet was ramped up to 3.8 T at the end of November until December 16th when the shutdown started. The magnet operation met a few unexpected stops. The field was reduced to 3.5 T for about 5 hours on December 3rd due to a faulty pressure sensor on the helium compressor. The following day the CERN CCC stopped unintentionally the power converters of the LHC and the experiments, triggering a ramp down that was stopped at 2.7 T. The magnet was back at 3.8 T about 6 hours after CCC sent the CERN-wide command. Three days later, a slow dump was triggered due to a stop of the pump feeding the power converter water-cooling circuit, during an intervention on the water-cooling plant done after several disturbances on the electrical distribution network. The magnet was back at 3.8 T in the evening the same day. On December 10th a break occurred in one turbine of the cold box producing the liquid ...

  16. MAGNET

    CERN Multimedia

    B. Curé

    2011-01-01

    The CMS magnet has been running steadily and smoothly since the summer, with no detected flaw. The magnet instrumentation is entirely operational and all the parameters are at their nominal values. Three power cuts on the electrical network affected the magnet run in the past five months, with no impact on the data-taking as the accelerator was also affected at the same time. On 22nd June, a thunderstorm caused a power glitch on the service electrical network. The primary water cooling at Point 5 was stopped. Despite a quick restart of the water cooling, the inlet temperature of the demineralised water on the busbar cooling circuit increased by 5 °C, up to 23.3 °C. It was kept below the threshold of 27 °C by switching off other cooling circuits to avoid the trigger of a slow dump of the magnet. The cold box of the cryogenics also stopped. Part of the spare liquid helium volume was used to maintain the cooling of the magnet at 4.5 K. The operators of the cryogenics quickly restarted ...

  17. Ultraefficient separation and sensing of mercury and methylmercury ions in drinking water by using aminonaphthalimide-functionalized Fe(3)O(4)@SiO(2) core/shell magnetic nanoparticles.

    Science.gov (United States)

    Park, Minsung; Seo, Sungmin; Lee, In Su; Jung, Jong Hwa

    2010-07-07

    A new fluorogenic based aminonaphthalimide-functionalized Fe(3)O(4)@SiO(2) core/shell magnetic nanoparticles 1 has been prepared, and its abilities to sense and separate metal ions were evaluated by fluorophotometry. The nanoparticles 1 exhibited a high affinity and selectivity for Hg(2+) and CH(3)Hg(+) ions over competing metal ions.

  18. Aspects of postoperative magnetic resonance imaging of patients with avascular necrosis of the femoral head, treated by advanced core decompression

    Energy Technology Data Exchange (ETDEWEB)

    Lazik, Andrea; Lauenstein, Thomas C.; Theysohn, Jens M. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Landgraeber, Stefan; Classen, Tim [University Hospital Essen, Department of Orthopedics, Essen (Germany); Kraff, Oliver [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany)

    2015-10-15

    To analyze remodeling processes after advanced core decompression (ACD) in patients with avascular femoral head necrosis by means of 3T MRI and to identify indicators for clinical outcome considering the defect size and characteristics of the bone graft and of the neighboring regeneration tissue. Thirty-four hips, with preexisting preoperative MRIs in 21 cases, were examined 1-34 months (mean 12.7) postoperatively by 3T MRI. The volume of necrosis was measured manually pre- and postoperatively to calculate absolute as well as percentage necrosis reduction. The signal intensity of the bone graft was quantified using a 4-point scale. Border phenomena between the bone graft and bone were described and classified into groups. Wilcoxon sign-rank test was used to identify correlations between the analyzed items and clinical signs of femoral head collapse after a mean follow-up time of 28.6 months (10.4-46.8). Mean percentage reduction of necrosis was significantly higher in asymptomatic patients (59.36 %) compared to patients with signs of femoral head collapse (28.78 %, p = 0.008). Signal intensity of the bone graft increased in T1w and T2w TIRM sequences over time after surgery and was significantly higher in asymptomatic patients. Five border phenomena between the bone graft and healthy bone were identified. Among them, the so-called ''rail sign'' representing three layers of remodeling tissue correlated with the histological observations. A variety of border phenomena representing remodeling processes have been described using 3T MRI. Beneath the percentage amount of necrosis reduction, we identified the signal intensity of the bone graft as an indicator for clinical outcome. (orig.)

  19. Aspects of postoperative magnetic resonance imaging of patients with avascular necrosis of the femoral head, treated by advanced core decompression.

    Science.gov (United States)

    Lazik, Andrea; Landgraeber, Stefan; Claßen, Tim; Kraff, Oliver; Lauenstein, Thomas C; Theysohn, Jens M

    2015-10-01

    To analyze remodeling processes after advanced core decompression (ACD) in patients with avascular femoral head necrosis by means of 3T MRI and to identify indicators for clinical outcome considering the defect size and characteristics of the bone graft and of the neighboring regeneration tissue. Thirty-four hips, with preexisting preoperative MRIs in 21 cases, were examined 1-34 months (mean 12.7) postoperatively by 3T MRI. The volume of necrosis was measured manually pre- and postoperatively to calculate absolute as well as percentage necrosis reduction. The signal intensity of the bone graft was quantified using a 4-point scale. Border phenomena between the bone graft and bone were described and classified into groups. Wilcoxon sign-rank test was used to identify correlations between the analyzed items and clinical signs of femoral head collapse after a mean follow-up time of 28.6 months (10.4-46.8). Mean percentage reduction of necrosis was significantly higher in asymptomatic patients (59.36%) compared to patients with signs of femoral head collapse (28.78%, p = 0.008). Signal intensity of the bone graft increased in T1w and T2w TIRM sequences over time after surgery and was significantly higher in asymptomatic patients. Five border phenomena between the bone graft and healthy bone were identified. Among them, the so-called "rail sign" representing three layers of remodeling tissue correlated with the histological observations. A variety of border phenomena representing remodeling processes have been described using 3T MRI. Beneath the percentage amount of necrosis reduction, we identified the signal intensity of the bone graft as an indicator for clinical outcome.

  20. Aspects of postoperative magnetic resonance imaging of patients with avascular necrosis of the femoral head, treated by advanced core decompression

    International Nuclear Information System (INIS)

    Lazik, Andrea; Lauenstein, Thomas C.; Theysohn, Jens M.; Landgraeber, Stefan; Classen, Tim; Kraff, Oliver

    2015-01-01

    To analyze remodeling processes after advanced core decompression (ACD) in patients with avascular femoral head necrosis by means of 3T MRI and to identify indicators for clinical outcome considering the defect size and characteristics of the bone graft and of the neighboring regeneration tissue. Thirty-four hips, with preexisting preoperative MRIs in 21 cases, were examined 1-34 months (mean 12.7) postoperatively by 3T MRI. The volume of necrosis was measured manually pre- and postoperatively to calculate absolute as well as percentage necrosis reduction. The signal intensity of the bone graft was quantified using a 4-point scale. Border phenomena between the bone graft and bone were described and classified into groups. Wilcoxon sign-rank test was used to identify correlations between the analyzed items and clinical signs of femoral head collapse after a mean follow-up time of 28.6 months (10.4-46.8). Mean percentage reduction of necrosis was significantly higher in asymptomatic patients (59.36 %) compared to patients with signs of femoral head collapse (28.78 %, p = 0.008). Signal intensity of the bone graft increased in T1w and T2w TIRM sequences over time after surgery and was significantly higher in asymptomatic patients. Five border phenomena between the bone graft and healthy bone were identified. Among them, the so-called ''rail sign'' representing three layers of remodeling tissue correlated with the histological observations. A variety of border phenomena representing remodeling processes have been described using 3T MRI. Beneath the percentage amount of necrosis reduction, we identified the signal intensity of the bone graft as an indicator for clinical outcome. (orig.)

  1. MAGNET

    CERN Multimedia

    B. Curé

    2011-01-01

    The magnet ran smoothly in the last few months until a fast dump occurred on 9th May 2011. Fortunately, this occurred in the afternoon of the first day of the technical stop. The fast dump was due to a valve position controller that caused the sudden closure of a valve. This valve is used to regulate the helium flow on one of the two current leads, which electrically connects the coil at 4.5 K to the busbars at room temperature. With no helium flow on the lead, the voltage drop and the temperatures across the leads increase up to the defined thresholds, triggering a fast dump through the Magnet Safety System (MSS). The automatic reaction triggered by the MSS worked properly. The helium release was limited as the pressure rise was just at the limit of the safety valve opening pressure. The average temperature of the magnet reached 72 K. It took four days to recover the temperature and refill the helium volumes. The faulty valve controller was replaced by a spare one before the magnet ramp-up resumed....

  2. Interparticle interactions of FePt core and Fe{sub 3}O{sub 4} shell in FePt/Fe{sub 3}O{sub 4} magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Akbari, Hossein, E-mail: Akbari.ph@iauardabil.ac.ir [Department of Physics, Ardabil Branch, Islamic Azad University, Ardabil (Iran, Islamic Republic of); Zeynali, Hossein [Department of Physics, Kashan Branch, Islamic Azad University, Kashan (Iran, Islamic Republic of); Bakhshayeshi, Ali [Department of Physics, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of)

    2016-02-22

    Monodisperse FePt nanoparticles were successfully synthesized using simple wet chemical method. Fe{sub 3}O{sub 4} was used as a magnetic shell around each FePt nanoparticles. In FePt/Fe{sub 3}O{sub 4} core/shell system, core thickness is 2 nm and shell thickness varies from zero to 2.5 nm. A theoretical model presented to calculate the shell thickness dependence of Coercivity. Presented model is compared with the results from Stoner–Wohlfarth model to interpret the shell thickness dependence of Coercivity in FePt/Fe{sub 3}O{sub 4} core/shell nanoparticles. There is a difference between the results from Stoner–Wohlfarth model and experimental data when the shell thickness increases. In the presented model, the effects of interparticle exchange and random magneto crystalline anisotropy are added to the previous models of magnetization reversal for core/shell nanostructures in order to achieve a better agreement with experimental data. For magnetic shells in FePt/Fe{sub 3}O{sub 4} core/shell, effective coupling between particles increases with increasing shell thickness which leads to Coercivity destruction for stronger couplings. According to the boundary conditions, in the harder regions with higher exchange stiffness, there is small variation in magnetization and so the magnetization modes become more localized. We discussed both localized and non-localized magnetization modes. For non-zero shell thickness, non-localized modes propagate in the soft phase which effects the quality of particle exchange interactions. - Highlights: • Monodisperse FePt nanoparticles were successfully synthesized using simple wet chemical method. • Fe{sub 3}O{sub 4} was used as a magnetic shell around each FePt nanoparticles. • A theoretical model presented to calculate the shell thickness dependence of Coercivity. • Magnetic shells increase effective coupling between particles with increasing shell thickness. • Magnetization modes are more localized in the regions with

  3. The influence of ligand charge and length on the assembly of Brome mosaic virus derived virus-like particles with magnetic core

    Science.gov (United States)

    Mieloch, Adam A.; Krecisz, Monika; Rybka, Jakub D.; Strugała, Aleksander; Krupiński, Michał; Urbanowicz, Anna; Kozak, Maciej; Skalski, Bohdan; Figlerowicz, Marek; Giersig, Michael

    2018-03-01

    Virus-like particles (VLPs) have sparked a great interest in the field of nanobiotechnology and nanomedicine. The introduction of superparamagnetic nanoparticles (SPIONs) as a core, provides potential use of VLPs in the hyperthermia therapy, MRI contrast agents and magnetically-powered delivery agents. Magnetite NPs also provide a significant improvement in terms of VLPs stability. Moreover employing viral structural proteins as self-assembling units has opened a new paths for targeted therapy, drug delivery systems, vaccines design, and many more. In many cases, the self-assembly of a virus strongly depends on electrostatic interactions between positively charged groups of the capsid proteins and negatively charged nucleic acid. This phenomenon imposes the negative net charge as a key requirement for the core nanoparticle. In our experiments, Brome mosaic virus (BMV) capsid proteins isolated from infected plants Hordeum vulgare were used. Superparamagnetic iron oxide nanoparticles (Fe3O4) with 15 nm in diameter were synthesized by thermal decomposition and functionalized with COOH-PEG-PL polymer or dihexadecylphosphate (DHP) in order to provide water solubility and negative charge required for the assembly. Nanoparticles were characterized by Transmission Electron Microscopy (TEM), Dynamic Light Scattering (DLS), Zeta Potential, Fourier Transformed Infrared Spectroscopy (FTIR) and Superconducting Quantum Interference Device (SQUID) magnetometry. TEM and DLS study were conducted to verify VLPs creation. This study demonstrates that the increase of negative surface charge is not a sufficient factor determining successful assembly. Additional steric interactions provided by longer ligands are crucial for the assembly of BMV SPION VLPs and may enhance the colloidal stability.

  4. The influence of ligand charge and length on the assembly of Brome mosaic virus derived virus-like particles with magnetic core

    Directory of Open Access Journals (Sweden)

    Adam A. Mieloch

    2018-03-01

    Full Text Available Virus-like particles (VLPs have sparked a great interest in the field of nanobiotechnology and nanomedicine. The introduction of superparamagnetic nanoparticles (SPIONs as a core, provides potential use of VLPs in the hyperthermia therapy, MRI contrast agents and magnetically-powered delivery agents. Magnetite NPs also provide a significant improvement in terms of VLPs stability. Moreover employing viral structural proteins as self-assembling units has opened a new paths for targeted therapy, drug delivery systems, vaccines design, and many more. In many cases, the self-assembly of a virus strongly depends on electrostatic interactions between positively charged groups of the capsid proteins and negatively charged nucleic acid. This phenomenon imposes the negative net charge as a key requirement for the core nanoparticle. In our experiments, Brome mosaic virus (BMV capsid proteins isolated from infected plants Hordeum vulgare were used. Superparamagnetic iron oxide nanoparticles (Fe3O4 with 15 nm in diameter were synthesized by thermal decomposition and functionalized with COOH-PEG-PL polymer or dihexadecylphosphate (DHP in order to provide water solubility and negative charge required for the assembly. Nanoparticles were characterized by Transmission Electron Microscopy (TEM, Dynamic Light Scattering (DLS, Zeta Potential, Fourier Transformed Infrared Spectroscopy (FTIR and Superconducting Quantum Interference Device (SQUID magnetometry. TEM and DLS study were conducted to verify VLPs creation. This study demonstrates that the increase of negative surface charge is not a sufficient factor determining successful assembly. Additional steric interactions provided by longer ligands are crucial for the assembly of BMV SPION VLPs and may enhance the colloidal stability.

  5. Possible magnetism in vortex cores of superconducting TmNi{sub 2}B{sub 2}C studied by small angle neutron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Abrahamsen, Asger Bech

    2003-11-01

    The compound TmNi{sub 2}B{sub 2}C has previously been studied by Small Angle Neutron Scattering(SANS) with the applied field along the crystalline c-axis and a very rich phase diagram in terms of flux line lattices(FLL) with different symmetries have been observed. One of the FLL transitions is coincident with a magnetic phase transition between two spin density waves. In this thesis additional SANS studies of the FLL phases in TmNi{sub 2}B{sub 2}C are reported and an interpretation of the phase diagram in the paramagnetic region is presented. It is suggested that the square FLL observed is stable in between two transition lines determined by two different length scales. The lower transition field is reached when the distance between the flux lines becomes comparable to the non-locality radius resulting from non-local electrodynamics, whereas the upper transition field is determined from the crossover from intermediate to high flux line density where the vortex cores start to overlap and the superconducting order parameter is suppressed in between the flux lines. A detailed examination of the intensity of the neutron diffraction spots caused by scattering on the flux line lattice in TmNi{sub 2}B{sub 2}C is presented and analyzed on the basis of the form factor of an isolated flux line. This analysis can not provide a good explanation for the observed scattering and it is suggested that the scattering from the Tm ions must be considered. One can argue that the moments of the Tm ions are modulated by the flux line lattice, because the Ruderman-Kittel- Kasuya-Yosida(RKKY) interaction between the Tm ions might be different inside the vortex cores than outside in the superconducting phase. A calculation of the neutron scattering cross section of such a magnetic flux line lattice has been performed and compared to the SANS data. This offers a qualitative explanation of some of the observations, but future work is needed to perform a more quantitative comparison. (au)

  6. Octadecyl functionalized core-shell magnetic silica nanoparticle as a powerful nanocomposite sorbent to extract urinary volatile organic metabolites.

    Science.gov (United States)

    Qiao, Zheng; Perestrelo, Rosa; Reyes-Gallardo, Emilia M; Lucena, R; Cárdenas, S; Rodrigues, João; Câmara, José S

    2015-05-08

    In this present study, magnetic Fe3O4@SiO2 nanoparticles (MNPs) functionalized with octadecyl groups (Fe3O4@SiO2-C18 NPs) were synthesized, characterized and employed, for the first time, as powerful nanosorbent to extract endogenous volatile organic metabolites (EVOMs) namely, hexanal, heptanal, decanal, benzaldehyde, 4-heptanone, 5-methyl-2-furfural and phenol, described as potential biomarkers of cancer, from human urine. By using co-precipitation, surface modification methods, the carbon-ferromagnetic nanocomposite was synthesized and characterized by infrared spectrum (IR) and transmission electron microscopy (TEM). By coupling with gas chromatography-mass spectrometry (GC-qMS), a reliable, sensitive and cost-effective method was validated. To test the extraction efficiency of the carbon-ferromagnetic nanocomposite toward urinary EVOMs experimental variables affecting the extraction performance, including nanosorbent amount, adsorption time, elution time, and nature of elution solvent, were investigated in detail. The extraction process was performed by dispersing Fe3O4@SiO2-C18 NPs into working solution containing targeted VOMs, and into urine samples, and then eluted with an adequate organic solvent. The eluate was collected, concentrated and analyzed by GC-qMS. Under the optimized conditions, the LODs and LOQs achieved were in the range of 9.7-57.3 and 32.4-190.9ng/mL, respectively. Calibration curves were linear (r(2)≥0. 988) over the concentration ranges from 0.25 to 250ng/mL. In addition, a satisfying reproducibility was achieved by evaluating the intra- and inter-day precisions with relative standard deviations (RSDs) less than 3 and 11%, respectively. The method also afforded satisfactory results in terms of the matrix effect (72.8-96.1%) and recoveries (accuracy) higher than 75.1% for most of the studied EVOMs. The Fe3O4@SiO2-C18 NPs-based sorbent extraction combined with GC-qMS revealed that the new nanosorbent had a strong ability to retain the

  7. MAGNET

    CERN Multimedia

    Benoit Curé

    2010-01-01

    The magnet worked very well at 3.8 T as expected, despite a technical issue that manifested twice in the cryogenics since June. All the other magnet sub-systems worked without flaw. The issue in the cryogenics was with the cold box: it could be observed that the cold box was getting progressively blocked, due to some residual humidity and air accumulating in the first thermal exchanger and in the adsorber at 65 K. This was later confirmed by the analysis during the regeneration phases. An increase in the temperature difference between the helium inlet and outlet across the heat exchanger and a pressure drop increase on the filter of the adsorber were observed. The consequence was a reduction of the helium flow, first compensated by the automatic opening of the regulation valves. But once they were fully opened, the flow and refrigeration power reduced as a consequence. In such a situation, the liquid helium level in the helium Dewar decreased, eventually causing a ramp down of the magnet current and a field...

  8. MAGNET

    CERN Multimedia

    B. Curé

    MAGNET During the winter shutdown, the magnet subsystems went through a full maintenance. The magnet was successfully warmed up to room temperature beginning of December 2008. The vacuum was broken later on by injecting nitrogen at a pressure just above one atmosphere inside the vacuum tank. This was necessary both to prevent any accidental humidity ingress, and to allow for a modification of the vacuum gauges on the vacuum tank and maintenance of the diffusion pumps. The vacuum gauges had to be changed, because of erratic variations on the measurements, causing spurious alarms. The new type of vacuum gauges has been used in similar conditions on the other LHC experiments and without problems. They are shielded against the stray field. The lubricants of the primary and diffusion pumps have been changed. Several minor modifications were also carried out on the equipment in the service cavern, with the aim to ease the maintenance and to allow possible intervention during operation. Spare sensors have been bough...

  9. MAGNET

    CERN Multimedia

    Benoit Curé.

    The magnet operation restarted end of June this year. Quick routine checks of the magnet sub-systems were performed at low current before starting the ramps up to higher field. It appeared clearly that the end of the field ramp down to zero was too long to be compatible with the detector commissioning and operations plans. It was decided to perform an upgrade to keep the ramp down from 3.8T to zero within 4 hours. On July 10th, when a field of 1.5T was reached, small movements were observed in the forward region support table and it was decided to fix this problem before going to higher field. At the end of July the ramps could be resumed. On July 28th, the field was at 3.8T and the summer CRAFT exercise could start. This run in August went smoothly until a general CERN wide power cut took place on August 3rd, due to an insulation fault on the high voltage network outside point 5. It affected the magnet powering electrical circuit, as it caused the opening of the main circuit breakers, resulting in a fast du...

  10. MAGNET

    CERN Multimedia

    B. Curé

    2013-01-01

    The magnet is fully stopped and at room temperature. The maintenance works and consolidation activities on the magnet sub-systems are progressing. To consolidate the cryogenic installation, two redundant helium compressors will be installed as ‘hot spares’, to avoid the risk of a magnet downtime in case of a major failure of a compressor unit during operation. The screw compressors, their motors, the mechanical couplings and the concrete blocks are already available and stored at P5. The metallic structure used to access the existing compressors in SH5 will be modified to allow the installation of the two redundant ones. The plan is to finish the installation and commissioning of the hot spare compressors before the summer 2014. In the meantime, a bypass on the high-pressure helium piping will be installed for the connection of a helium drier unit later during the Long Shutdown 1, keeping this installation out of the schedule critical path. A proposal is now being prepared for the con...

  11. Synthesis and characterization of the core-shell magnetic molecularly imprinted polymers (Fe₃O₄@MIPs) adsorbents for effective extraction and determination of sulfonamides in the poultry feed.

    Science.gov (United States)

    Kong, Xuan; Gao, Ruixia; He, Xiwen; Chen, Langxing; Zhang, Yukui

    2012-07-06

    In this study, we present a general method to prepare the core-shell magnetic molecularly imprinted polymers (MIPs) nanoparticles (NPs) for sulfamethazine (SMZ). The resulting Fe₃O₄@MIPs NPs possess a highly improved imprinting effect, fast adsorption kinetics and high adsorption capacity, and can be applied to extract sulfonamide in the poultry feed. In this protocol, the magnetite NPs were synthesized by co-precipitating Fe²⁺ and Fe³⁺ in an ammonia solution first. Silica was then coated on the Fe₃O₄ NPs using a sol-gel method to obtain silica shell magnetic NPs. Subsequently, the vinyl groups were grated onto silica-modified Fe₃O₄ surface by 3-methacryloyloxypropyltrimethoxysilane. Finally, the MIPs films were formed on the surface of Fe₃O₄@SiO₂ by the copolymerization of vinyl end groups with functional monomer, methacrylic acid, cross-linking agent, ethylene glycol dimethacrylate, the initiator azo-bis-isobutyronitrile and template molecule, sulfamethazine. The morphology, magnetic, adsorption and recognition properties of Fe₃O₄@MIPs NPs were characterized using transmission electron microscope (TEM), scanning electron microscope (SEM), Fourier transform infrared (FT-IR) spectrometer, vibrating sample magnetometer (VSM) and re-binding experiments. The results showed that the binding sites of Fe₃O₄@MIPs were good accessibility, fast adsorption rate and the maximum adsorption capacity of Fe₃O₄@MIPs to SMZ was 344.8 μg g⁻¹. The selectivity of the obtained Fe₃O₄@MIPs NPs were elucidated by the different rebinding capability of SMZ and structural related sulfonamides in the mixed solution. The results indicated that the Fe₃O₄@MIPs had high imprinting factor 9.5 and significant selectivity. A method was developed for enrichment and determination of SMZ in the poultry feed samples with recoveries of duck and chicken feed ranging from 63.3 to 76.5% and 68.7 to 74.7%, respectively and the relative standard deviations (RSD

  12. Selective fishing and analysis of xanthine oxidase binders from two Fabaceae species by coupling enzyme functionalized core-shell magnetic nanoparticles with HPLC-MS.

    Science.gov (United States)

    Liu, Liangliang; Shi, Shuyun; Zhao, Huading; Yu, Jingang; Jiang, Xinyu; Chen, Xiaoqing

    2014-01-15

    Xanthine oxidase (XOD) immobilized core-shell magnetic silica (Fe3O4@SiO2-XOD) nanoparticles coupled with high performance liquid chromatography-mass spectrometry (HPLC-MS) was developed to fish out and analyze XOD binders from two Fabaceae species, Puerariae lobata flower and Glycyrrhiza uralensis root. The prepared Fe3O4@SiO2-XOD nanoparticles exhibited good specificity for XOD binders, better dispersion in aqueous solution and reusability than those of Fe3O4-XOD nanoparticles. The amount of XOD immobilized onto Fe3O4@SiO2 nanoparticles was 339.9μg/mg and the activity of Fe3O4@SiO2-XOD nanoparticles remained 95% after ten times usage. The optimum conditions of selective fishing were optimized, and finally incubating pH was set at 7, incubating temperature at 25°C and adsorption time at 30min. Twelve XOD binders were successfully identified from ethyl acetate extract of P. lobata flower and G. uralensis root. The developed method provides a rapid, purposeful and effective way to identify active compounds from natural complex mixtures. Copyright © 2013 Elsevier B.V. All rights reserved.

  13. Synthesis and characterization of core-shell magnetic molecularly imprinted polymers for solid-phase extraction and determination of Rhodamine B in food.

    Science.gov (United States)

    Su, Xiaomeng; Li, Xiaoyan; Li, Junjie; Liu, Min; Lei, Fuhou; Tan, Xuecai; Li, Pengfei; Luo, Weiqiang

    2015-03-15

    Core-shell magnetic molecularly imprinted polymers (MIPs) nanoparticles (NPs), in which a Rhodamine B-imprinted layer was coated on Fe3O4 NPs. were synthesized. First, Fe3O4 NPs were prepared by a coprecipitation method. Then, amino-modified Fe3O4 NPs (Fe3O4@SiO2-NH2) was prepared. Finally, the MIPs were coated on the Fe3O4@SiO2-NH2 surface by the copolymerization with functional monomer, acrylamide, using a cross-linking agent, ethylene glycol dimethacrylate; an initiator, azobisisobutyronitrile and a template molecule, Rhodamine B. The Fe3O4@MIPs were characterized using a scanning electron microscope, Fourier transform infrared spectrometer, vibrating sample magnetometer, and re-binding experiments. The Fe3O4@MIPs showed a fast adsorption equilibrium, a highly improved imprinting capacity, and significant selectivity; they could be used as a solid-phase extraction material and detect illegal addition Rhodamine B in food. A method was developed for the selective isolation and enrichment of Rhodamine B in food samples with recoveries in the range 78.47-101.6% and the relative standard deviation was <2%. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Preparation of Fe(3)O(4)@C@CNC multifunctional magnetic core/shell nanoparticles and their application in a signal-type flow-injection photoluminescence immunosensor.

    Science.gov (United States)

    Chu, Chengchao; Li, Meng; Li, Long; Ge, Shenguang; Ge, Lei; Yu, Jinghua; Yan, Mei; Song, Xianrang

    2013-11-01

    We describe here the preparation of carbon-coated Fe3O4 magnetic nanoparticles that were further fabricated into multifunctional core/shell nanoparticles (Fe3O4@C@CNCs) through a layer-by-layer self-assembly process of carbon nanocrystals (CNCs). The nanoparticles were applied in a photoluminescence (PL) immunosensor to detect the carcinoembryonic antigen (CEA), and CEA primary antibody was immobilized onto the surface of the nanoparticles. In addition, CEA secondary antibody and glucose oxidase were covalently bonded to silica nanoparticles. After stepwise immunoreactions, the immunoreagent was injected into the PL cell using a flow-injection PL system. When glucose was injected, hydrogen peroxide was obtained because of glucose oxidase catalysis and quenched the PL of the Fe3O4@C@CNC nanoparticles. The here proposed PL immunosensor allowed us to determine CEA concentrations in the 0.005–50 ng·mL-1 concentration range, with a detection limit of 1.8 pg·mL-1.

  15. Rapidly changing flows in the Earth's core

    DEFF Research Database (Denmark)

    Olsen, Nils; Mandea, M.

    2008-01-01

    A large part of the Earth's magnetic field is generated by fluid motion in the molten outer core(1). As a result of continuous satellite measurements since 1999, the core magnetic field and its recent variations can now be described with a high resolution in space and time(2). These data have...... field occurring over only a few months, indicative of fluid flow at the top of the core, can in fact be resolved. Using nine years of magnetic field data obtained by satellites as well as Earth-based observatories, we determine the temporal changes in the core magnetic field and flow in the core. We...

  16. Waves in the core and mechanical core-mantle interactions

    DEFF Research Database (Denmark)

    Jault, D.; Finlay, Chris

    2015-01-01

    This Chapter focuses on time-dependent uid motions in the core interior, which can beconstrained by observations of the Earth's magnetic eld, on timescales which are shortcompared to the magnetic diusion time. This dynamics is strongly inuenced by the Earth's rapid rotation, which rigidies...... the motions in the direction parallel to the Earth'srotation axis. This property accounts for the signicance of the core-mantle topography.In addition, the stiening of the uid in the direction parallel to the rotation axis gives riseto a magnetic diusion layer attached to the core-mantle boundary, which would...... otherwisebe dispersed by Alfven waves. This Chapter complements the descriptions of large-scaleow in the core (8.04), of turbulence in the core (8.06) and of core-mantle interactions(8.12), which can all be found in this volume. We rely on basic magnetohydrodynamictheory, including the derivation...

  17. MAGNET

    CERN Multimedia

    Benoit Curé

    The magnet subsystems resumed operation early this spring. The vacuum pumping was restarted mid March, and the cryogenic power plant was restarted on March 30th. Three and a half weeks later, the magnet was at 4.5 K. The vacuum pumping system is performing well. One of the newly installed vacuum gauges had to be replaced at the end of the cool-down phase, as the values indicated were not coherent with the other pressure measurements. The correction had to be implemented quickly to be sure no helium leak could be at the origin of this anomaly. The pressure measurements have been stable and coherent since the change. The cryogenics worked well, and the cool-down went quite smoothly, without any particular difficulty. The automated start of the turbines had to be fine-tuned to get a smooth transition, as it was observed that the cooling power delivered by the turbines was slightly higher than needed, causing the cold box to stop automatically. This had no consequence as the cold box safety system acts to keep ...

  18. MAGNET

    CERN Multimedia

    B. Curé

    During the winter shutdown, the magnet subsystems went through a full maintenance. The magnet was successfully warmed up to room temperature beginning of December 2008. The vacuum was broken later on by injecting nitrogen at a pressure just above one atmosphere inside the vacuum tank. This was necessary both to prevent any accidental humidity ingress, and to allow for a modification of the vacuum gauges on the vacuum tank and maintenance of the diffusion pumps. The vacuum gauges had to be changed, because of erratic variations on the measurements, causing spurious alarms. The new type of vacuum gauges has been used in similar conditions on the other LHC experiments and without problems. They are shielded against the stray field. The lubricants of the primary and diffusion pumps have been changed. Several minor modifications were also carried out on the equipment in the service cavern, with the aim to ease the maintenance and to allow possible intervention during operation. Spare sensors have been bought. Th...

  19. Proteomics Core

    Data.gov (United States)

    Federal Laboratory Consortium — Proteomics Core is the central resource for mass spectrometry based proteomics within the NHLBI. The Core staff help collaborators design proteomics experiments in a...

  20. Integrated magnetic transformer assembly

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to an integrated magnetics transformer assembly comprising a first magnetically permeable core forming a first substantially closed magnetic flux path and a second magnetically permeable core forming a second substantially closed magnetic flux path. A first input...... inductor winding is wound around a first predetermined segment of the first magnetically permeable core and a second input inductor winding is wound around a first predetermined segment of the second magnetically permeable core. The integrated magnetics transformer assembly further comprises a first output......-winding of the first output inductor winding and the first half-winding of the second output inductor winding are configured to produce aligned, i.e. in the same direction, magnetic fluxes through the first substantially closed magnetic flux path. The integrated magnetics transformer assembly is well- suited for use...

  1. Ground Penetrating Radar, Magnetic and Compositional Analysis of Sediment Cores and Surface Samples: The Relationships Between Lacustrine Sediments and Holocene Lake- Level and Climate Change at Deming Lake, Minnesota, USA

    Science.gov (United States)

    Murray, R.; Lascu, I.; Plank, C.

    2007-12-01

    Deming Lake is a small (Deming. Cores were sampled continuously at a 1-2 cm resolution and sediment composition (in terms of percent organic matter, carbonate material, and minerogenic residue) was determined via loss on ignition (LOI). Isothermal remanent magnetization (IRM) and anhysteretic remanent magnetization (ARM) were used as proxies of magnetic mineral concentration and grain size. Four lithostratigraphic units were identified and correlated between cores based on these analyses. Changes in GPR facies corroborate the correlation between the two shallow cores. In order to inform our interpretation of down-core variations in magnetic properties and LOI values in terms of variations in lake depth, a suite of over 70 modern sediment samples were collected from the basin and analyzed. LOI compositional variability across the basin was high, with no clear trends related to depth or distance from shore. A sharp decrease in minerogenic content was observed at depths consistent with a predicted wave-base of 0.5 m, but aside from this trend it appears the steep slopes of much of the basin promote gravity driven slumping and mixing of sediments at depth. In the profundal sediments IRM values are routinely 5% higher than in the slope and littoral environments, while ARM/IRM ratios indicate an increase in magnetic grain size with water depth. We infer that an increase in coarse organic material in the shallow-water cores of Deming records a period of aridity (associated with a decrease lake-level less than 2m based on GPR profiles) and/or increased water clarity during the regionally expansive mid-Holocene dry period. We do not see clear evidence of late-Holocene lake level change of a significant magnitude (i.e. >1m). While remanence measurements (especially IRM) often correlate with the LOI residue, interference in the IRM resulting from the dissolution of magnetic minerals casts uncertainty into the reliability of our magnetic measurements as a signal of climate

  2. Magnetic solid phase extraction using ionic liquid-coated core-shell magnetic nanoparticles followed by high-performance liquid chromatography for determination of Rhodamine B in food samples.

    Science.gov (United States)

    Chen, Jieping; Zhu, Xiashi

    2016-06-01

    Three hydrophobic ionic liquids (ILs) (1-butyl-3-methylimidazole hexafluorophosphate ([BMIM]PF6), 1-hexyl-3-methyl-imidazole hexafluoro-phosphate ([HMIM]PF6), and 1-octyl-3-methylimidazole hexafluorophosphate ([OMIM]PF6)) were used to coat Fe3O4@SiO2 nanoparticles (NPs) with core-shell structures to prepare magnetic solid phase extraction (MSPE) agents (Fe3O4@SiO2@IL). A novel method of MSPE coupled with high-performance liquid chromatography for the separation/analysis of Rhodamine B was then established. The results showed that Rhodamine B was adsorbed rapidly on Fe3O4@SiO2@[OMIM]PF6 and was released using ethanol. Under optimal conditions, the pre-concentration factor for the proposed method was 25. The linear range, limit of detection (LOD), correlation coefficient (R), and relative standard deviation (RSD) were found to be 0.50-150.00 μgL(-1), 0.08 μgL(-1), 0.9999, and 0.51% (n=3, c=10.00 μgL(-1)), respectively. The Fe3O4@SiO2 NPs could be re-used up to 10 times. The method was successfully applied to the determination of Rhodamine B in food samples. Copyright © 2016. Published by Elsevier Ltd.

  3. Magnetic Field

    DEFF Research Database (Denmark)

    Olsen, Nils

    2015-01-01

    he Earth has a large and complicated magnetic field, the major part of which is produced by a self-sustaining dynamo operating in the fluid outer core. Magnetic field observations provide one of the few tools for remote sensing the Earth’s deep interior, especially regarding the dynamics...... of the fluid flow at the top of the core. However, what is measured at or near the surface of the Earth is the superposition of the core field and fields caused by magnetized rocks in the Earth’s crust, by electric currents flowing in the ionosphere, magnetosphere, and oceans, and by currents induced...... in the Earth by time-varying external fields. These sources have their specific characteristics in terms of spatial and temporal variations, and their proper separation, based on magnetic measurements, is a major challenge. Such a separation is a prerequisite for remote sensing by means of magnetic field...

  4. In vitro toxicity of FemOn, FemOn-SiO2 composite, and SiO2-FemOn core-shell magnetic nanoparticles

    Directory of Open Access Journals (Sweden)

    Toropova YG

    2017-01-01

    Full Text Available Yana G Toropova,1 Alexey S Golovkin,2 Anna B Malashicheva,3,4 Dmitry V Korolev,5,6 Andrey N Gorshkov,7 Kamil G Gareev,8 Michael V Afonin,9 Michael M Galagudza10,11 1Laboratory of Cardioprotection, Institute of Experimental Medicine, Federal Almazov North-West Medical Research Centre, Saint Petersburg, Russian Federation; 2Gene and Cell Engineering Group, Institute of Molecular Biology and Genetics, Federal Almazov North-West Medical Research Centre, Saint Petersburg, Russian Federation; 3Laboratory of Molecular Cardiology, Institute of Molecular Biology and Genetics, Federal Almazov North-West Medical Research Centre, Saint Petersburg, Russian Federation; 4Department of Embryology, Faculty of Biology, Saint Petersburg State University, Saint Petersburg, Russian Federation; 5Laboratory of Nanotechnology, Institute of Experimental Medicine, Federal Almazov North-West Medical Research Centre, Saint Petersburg, Russian Federation; 6Department of Photonics and Optical Information Technology ITMO University, Saint Petersburg, Russian Federation; 7Laboratory of Intracellular Signaling and Transport Research Institute of Influenza, Saint Petersburg, Russian Federation; 8Department of Micro and Nanoelectronics, Faculty of Electronics, Saint Petersburg Electrotechnical University LETI, Saint Petersburg, Russian Federation; 9Department of Inorganic Chemistry Saint Petersburg State Technological Institute (Technical University, Saint Petersburg, Russian Federation; 10Institute of Experimental Medicine, Federal Almazov North-West Medical Research Centre, Saint Petersburg, Russian Federation; 11Departament of Pathophysiology, First Pavlov State Medical University of Saint Petersburg, Saint Petersburg, Russian Federation Abstract: Over the last decade, magnetic iron oxide nanoparticles (IONPs have drawn much attention for their potential biomedical applications. However, serious in vitro and in vivo safety concerns continue to exist. In this study, the effects

  5. Sonochemical synthesis of magnetic core-shell Fe{sub 3}O{sub 4}-ZrO{sub 2} nanoparticles and their application to the highly effective immobilization of myoglobin for direct electrochemistry

    Energy Technology Data Exchange (ETDEWEB)

    Peng Huaping; Liang Ruping; Zhang Li [Department of Chemistry, Nanchang University, Nanchang 330031 (China); Qiu Jianding, E-mail: jdqiu@ncu.edu.c [Department of Chemistry, Nanchang University, Nanchang 330031 (China)

    2011-04-15

    Graphical abstract: Display Omitted Highlights: Magnetic core-shell Fe{sub 3}O{sub 4}-ZrO{sub 2} nanoparticle was synthesized by sonochemical approach. Fe{sub 3}O{sub 4}-ZrO{sub 2} NPs provided high capacity for trapping Mb on magnetic glassy carbon electrode surface. The constructed Mb/Fe{sub 3}O{sub 4}-ZrO{sub 2} film exhibited excellent electrocatalytic ability for the reduction of H{sub 2}O{sub 2}. The proposed method simplifies the immobilization methodology of proteins. - Abstract: In this study, bifunctional Fe{sub 3}O{sub 4}-ZrO{sub 2} magnetic core-shell nanoparticles (NPs), synthesized by a simple and effective sonochemical approach, were attached to the surface of a magnetic glassy carbon electrode (MGCE) and successfully applied to the immobilization/adsorption of myoglobin (Mb) for constructing a novel biosensor platform. With the advantages of the magnetism and the excellent biocompatibility of the Fe{sub 3}O{sub 4}-ZrO{sub 2} NPs, Mb could be easily immobilized on the surface of the electrode in the present of external magnetic field and well retained its bioactivity, hence dramatically facilitated direct electron transfer of Mb was demonstrated. The proposed Mb/Fe{sub 3}O{sub 4}-ZrO{sub 2} biofilm electrode exhibited excellent electrocatalytic behaviors towards the reduction of H{sub 2}O{sub 2} with a linear range from 0.64 {mu}M to 148 {mu}M. This presented system avoids the complex synthesis for protecting Fe{sub 3}O{sub 4} NPs, supplies a simple, effective and inexpensive way to immobilize protein, and is promising for construction of third-generation biosensors and other bio-magnetic induction devices.

  6. Magnetic

    Science.gov (United States)

    Aboud, Essam; El-Masry, Nabil; Qaddah, Atef; Alqahtani, Faisal; Moufti, Mohammed R. H.

    2015-06-01

    The Rahat volcanic field represents one of the widely distributed Cenozoic volcanic fields across the western regions of the Arabian Peninsula. Its human significance stems from the fact that its northern fringes, where the historical eruption of 1256 A.D. took place, are very close to the holy city of Al-Madinah Al-Monawarah. In the present work, we analyzed aeromagnetic data from the northern part of Rahat volcanic field as well as carried out a ground gravity survey. A joint interpretation and inversion of gravity and magnetic data were used to estimate the thickness of the lava flows, delineate the subsurface structures of the study area, and estimate the depth to basement using various geophysical methods, such as Tilt Derivative, Euler Deconvolution and 2D modeling inversion. Results indicated that the thickness of the lava flows in the study area ranges between 100 m (above Sea Level) at the eastern and western boundaries of Rahat Volcanic field and getting deeper at the middle as 300-500 m. It also showed that, major structural trend is in the NW direction (Red Sea trend) with some minor trends in EW direction.

  7. MAGNET

    CERN Multimedia

    Benoit Curé

    The cooling down to the nominal temperature of 4.5 K was achieved at the beginning of August, in conjunction with the completion of the installation work of the connection between the power lines and the coil current leads. The temperature gradient on the first exchanger of the cold box is now kept within the nominal range. A leak of lubricant on a gasket of the helium compressor station installed at the surface was observed and several corrective actions were necessary to bring the situation back to normal. The compressor had to be refilled with lubricant and a regeneration of the filters and adsorbers was necessary. The coil cool down was resumed successfully, and the cryogenics is running since then with all parameters being nominal. Preliminary tests of the 20kA coil power supply were done earlier at full current through the discharge lines into the dump resistors, and with the powering busbars from USC5 to UXC5 without the magnet connected. On Monday evening August 25th, at 8pm, the final commissionin...

  8. MAGNET

    CERN Document Server

    B. Curé

    The first phase of the commissioning ended in August by a triggered fast dump at 3T. All parameters were nominal, and the temperature recovery down to 4.5K was carried out in two days by the cryogenics. In September, series of ramps were achieved up to 3 and finally 3.8T, while checking thoroughly the detectors in the forward region, measuring any movement of and around the HF. After the incident of the LHC accelerator on September 19th, corrective actions could be undertaken in the forward region. When all these displacements were fully characterized and repetitive, with no sign of increments in displacement at each field ramp, it was possible to start the CRAFT, Cosmic Run at Four Tesla (which was in fact at 3.8T). The magnet was ramped up to 18.16kA and the 3 week run went smoothly, with only 4 interruptions: due to the VIP visits on 21st October during the LHC inauguration day; a water leak on the cooling demineralized water circuit, about 1 l/min, that triggered a stop of the cooling pumps, and resulte...

  9. MAGNET

    CERN Multimedia

    Benoit Curé

    2013-01-01

    Maintenance work and consolidation activities on the magnet cryogenics and its power distribution are progressing according to the schedules. The manufacturing of the two new helium compressor frame units has started. The frame units support the valves, all the sensors and the compressors with their motors. This activity is subcontracted. The final installation and the commissioning at CERN are scheduled for March–April 2014. The overhauls of existing cryogenics equipment (compressors, motors) are in progress. The reassembly of the components shall start in early 2014. The helium drier, to be installed on the high-pressure helium piping, has been ordered and will be delivered in the first trimester of 2014. The power distribution for the helium compressors in SH5 on the 3.3kV network is progressing. The 3.3kV switches, between each compressor and its hot spare compressor, are being installed, together with the power cables for the new compressors. The 3.3kV electrical switchboards in SE5 will ...

  10. Core–shell structured FeSiAl/SiO{sub 2} particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} soft magnetic composite cores with tunable insulating layer thicknesses

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Xi’an, E-mail: groupfxa@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Wang, Jian, E-mail: snove418562@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Wu, Zhaoyang, E-mail: wustwuzhaoyang@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Li, Guangqiang, E-mail: ligq-wust@mail.wust.edu.cn [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China)

    2015-11-15

    Graphical abstract: - Highlights: • FeSiAl/SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} composite cores were prepared. • SiO{sub 2} surrounding FeSiAl were replaced by Al{sub 2}O{sub 3} during sintering process. • Fe{sub 3}Si particles were separated by Al{sub 2}O{sub 3} with tunable thickness in composite cores. • Fe{sub 3}Si/Al{sub 2}O{sub 3} had lower core loss and better frequency stability than FeSiAl core. • The insulating layer between ferromagnetic particles can reduce core loss. - Abstract: FeSiAl/SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} composite cores with tunable insulating layer thicknesses have been synthesized via a modified Stöber method combined with following high temperature sintering process. Most of the conductive FeSiAl particles could be coated by insulating SiO{sub 2} using the modified Stöber method. During the sintering process, the reaction 4Al + 3SiO{sub 2} ≣ 2α-Al{sub 2}O{sub 3} + 3Si took place and the new Fe{sub 3}Si/Al{sub 2}O{sub 3} composite was formed. The Fe{sub 3}Si/Al{sub 2}O{sub 3} composite cores displayed more excellent soft magnetic properties, better frequency stability at high frequencies, much higher resistivity and lower core loss than the raw FeSiAl core. Based on this, several types of FeSiAl/SiO{sub 2} particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} composite cores with tunable insulating layer thicknesses were selectively prepared by simply varying TEOS contents. The thickness of Al{sub 2}O{sub 3} insulating layer and resistivity of Fe{sub 3}Si/Al{sub 2}O{sub 3} composite cores increased with increasing the TEOS contents, while the permeability and core loss changed in the opposite direction.

  11. Synthesis, surface modification/decoration of luminescent–magnetic core/shell nanomaterials, based on the lanthanide doped fluorides (Fe3O4/SiO2/NH2/PAA/LnF3)

    International Nuclear Information System (INIS)

    Runowski, Marcin; Lis, Stefan

    2016-01-01

    The synthesized magnetite nanoparticles (10–15 nm) were successfully coated with amine modified silica nanoshell, which led to the formation of core/shell type nanostructures (30–50 nm). The as-prepared nanoparticles were surface modified with polyacrylic acid (PAA) via electrostatic interactions of –NH 2 and –COOH groups. Afterwards, the surface PAA molecules acted as complexing agents of the introduced lanthanide (Ln 3+ ) ions. Subsequently, the as-prepared nanostructures were surface decorated with luminescent LnF 3 nanoparticles, forming Eu 3+ or Tb 3+ doped Fe 3 O 4 /SiO 2 /NH 2 /PAA/LnF 3 nanomaterials (50–100 nm). The obtained luminescent–magnetic products exhibited simultaneously bright red or green emission under UV lamp irradiation (λ ex =254 nm), and a response for the applied magnetic field (strong magnet attracts the colloidal particles, dispersed in aqueous medium). After the synthesis, properties of the nanomaterials were investigated by powder X-ray diffraction (XRD) technique, transmission electron microscopy (TEM), infrared spectroscopy (IR) and spectrofluorometry (analysis of excitation/emission spectra and luminescence decay curves). Such advanced nanomaterials can be potentially used in multimodal imaging, targeted therapies and as multifunctional contrast agents, novel luminescent–magnetic tracers, protection of documents, etc. - Highlights: • Luminescent–magnetic nanomaterials Fe 3 O 4 /SiO 2 /NH 2 /PAA/LnF 3 were synthesized. • Core/shell nanostructures were obtained by surface modification of nanoparticles. • Luminescent lanthanide fluoride nanoparticles doped with Eu 3+ and Tb 3+ ions. • Multifunctional core/shell nanostructures exhibited red or green emission. • Nanomaterials formed stable aqueous colloids.

  12. Hybrid Magnetics and Power Applications

    DEFF Research Database (Denmark)

    Mo, Wai Keung; Paasch, Kasper

    2017-01-01

    A hybrid magnetic approach, merging two different magnetic core properites such as ferrite and iron powder cores, is an effective solution for power converter applications. It can offer similar magnetic properties to that of magnetic powder cores but showing less copper loss than powder cores....... In order to prevent ferrite core saturation, placing an effective air gap within the ferrite core is a key method to obtain optimum hybrid magnetic performance. Furthermore, a relatively large inductance at low loading current is an excellent way to minimze power loss in order to achieve high efficiency...

  13. Improving the SMM and luminescence properties of lanthanide complexes with LnO9 cores in the presence of ZnII: an emissive Zn2Dy single ion magnet.

    Science.gov (United States)

    Fondo, Matilde; Corredoira-Vázquez, Julio; Herrera-Lanzós, Antía; García-Deibe, Ana M; Sanmartín-Matalobos, Jesús; Herrera, Juan Manuel; Colacio, Enrique; Nuñez, Cristina

    2017-12-12

    Mononuclear complexes of stoichiometry [Ln(H 3 L)(H 2 O)(NO 3 )](NO 3 ) 2 (Ln = Tb, 1; Dy, 2, Er, 3), which crystallise with different solvates, and the heterotrinuclear compound [Zn 2 Dy(L)(NO 3 ) 3 (OH)] (4) can be obtained with the same H 3 L compartmental ligand. The single X-ray crystal structure of the mononuclear complexes shows a LnO 9 core with a muffin-like disposition while the geometry of the DyO 9 core in 4 seems to be closer to spherical capped square antiprism. The analysis of the magnetic properties of all the complexes demonstrates that the mononuclear lanthanide compounds do not show slow relaxation of the magnetization, even when the samples are diluted with a diamagnetic matrix and subjected to a dc applied field of 1000 Oe. Nevertheless, the heterotrinuclear dysprosium complex 4·3H 2 O is a field-induced single ion magnet, with an estimated U eff barrier of 59 K. The luminescence characterisation of all the metal complexes in methanol solution at 298 K also shows a notable increase in the fluorescence emission of the heterotrinuclear complex with respect to the mononuclear ones, in such a way that 4 can be defined as a fluorescent single ion magnet.

  14. Method for orienting a borehole core

    International Nuclear Information System (INIS)

    Henry, W.

    1980-01-01

    A method is described for longitudinally orienting a borehold core with respect to the longitudinal axis of the drill string which drilled said borehold core in such a manner that the original longitudinal attitude of said borehold core within the earth may be determined. At least a portion of said borehold core is partialy demagnetized in steps to thereby at least partially remove in steps the artificial remanent magnetism imparted to said borehole core by said drill string. The artifical remanent magnetism is oriented substantially parallel to the longitudinal axis of said drill string. The direction and intensity of the total magnetism of said borehold core is measured at desired intervals during the partial demagnetizing procedure. An artificial remanent magnetism vector is established which extends from the final measurement of the direction and intensity of the total magnetism of said borehole core taken during said partial demagnetizing procedure towards the initial measurement of the direction and intensity of the total magnetism of said borehold core taken during said partial demagnetizing procedure. The borehold core is oriented in such a manner that said artificial remanent magnetism vector points at least substantially downwardly towards the bottom of said borehold core for a borehold in the northern hemisphere and points at least substantailly upwardly towards the top of said borehole core for a borehole in the southern hemisphere

  15. Lunar magnetism

    Science.gov (United States)

    Hood, L. L.; Sonett, C. P.; Srnka, L. J.

    1984-01-01

    Aspects of lunar paleomagnetic and electromagnetic sounding results which appear inconsistent with the hypothesis that an ancient core dynamo was the dominant source of the observed crustal magnetism are discussed. Evidence is summarized involving a correlation between observed magnetic anomalies and ejecta blankets from impact events which indicates the possible importance of local mechanisms involving meteoroid impact processes in generating strong magnetic fields at the lunar surface. A reply is given to the latter argument which also presents recent evidence of a lunar iron core.

  16. In-situ magnetization of NdFeB magnets for permanent magnet machines

    International Nuclear Information System (INIS)

    Chang, L.; Eastham, T.R.; Dawson, G.E.

    1991-01-01

    In-situ magnetizers are needed to facilitate the assembly of permanent magnet machines and to remagnetize the magnets after weakening due to a fault condition. The air-core magnetizer in association with the silicon steel lamination structure of the rotor has advantages over its iron-core counterpart. This novel method has been used to magnetize the NdFeB magnets in a 30-hp permanent magnet synchronous motor. The magnetizing capability for different magnetizer geometries was investigated for the magnetization of NdFeB material. The design, testing, and operation of this magnetizer are reported in this paper

  17. Synthesis, microstructure and magnetic properties of Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} soft magnetic composite core

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jian, E-mail: snove418562@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Fan, Xi’an, E-mail: groupfxa@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Wu, Zhaoyang, E-mail: wustwuzhaoyang@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Li, Guangqiang [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China)

    2015-11-15

    Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} soft magnetic composite core have been synthesized via a modified stöber method combined with following high temperature sintering process. Most of conductive Fe{sub 3}Si{sub 0.7}Al{sub 0.3} particles could be uniformly coated by insulating SiO{sub 2} using the modified stöber method. The Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles exhibited good soft magnetic properties with low coercivity and high saturation magnetization. The reaction 4Al+3SiO{sub 2}=2α-Al{sub 2}O{sub 3}+3Si took place during the sintering process. As a result the new Fe{sub 3}Si/Al{sub 2}O{sub 3} composite was formed. The Fe{sub 3}Si/Al{sub 2}O{sub 3} composite core displayed more excellent soft magnetic properties, better frequency stability at high frequencies, much higher electrical resistivity and lower core loss than the pure Fe{sub 3}Si{sub 0.7}Al{sub 0.3} core. The method of introducing insulating layers surrounding magnetic particles provides a promising route to develop new and high compact soft magnetic materials with good magnetic and electric properties. - Graphical abstract: In Fe{sub 3}Si/Al{sub 2}O{sub 3} composite, Fe{sub 3}Si phases are separated by Al{sub 2}O{sub 3} layers and the eddy currents are confined in Fe{sub 3}Si phases, thus increasing resistivity and reducing core loss. - Highlights: • Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} cores were prepared. • Fe{sub 3}Si{sub 0.7}Al{sub 0.3} particles could be uniformly coated by nano-sized SiO{sub 2} clusters. • Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} cores showed good soft magnetic properties. • Fe{sub 3}Si/Al{sub 2}O{sub 3} had lower core loss and better frequency stability than Fe{sub 3}Si{sub 0.7}Al{sub 0.3} cores.

  18. Effects of size reduction on the structure and magnetic properties of core-shell Ni3Si/silica nanoparticles prepared by electrochemical synthesis

    Czech Academy of Sciences Publication Activity Database

    Pigozzi, G.; Mukherji, D.; Elerman, Y.; Strunz, Pavel; Gilles, R.; Hoelzel, M.; Barbier, B.; Schmutz, P.

    2014-01-01

    Roč. 584, JAN (2014), s. 119-127 ISSN 0925-8388 Institutional support: RVO:61389005 Keywords : intermetallics * nanostructured materials * transition metal alloys and compounds * electrochemical synthesis * crystal structure * magnetic measurements Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.999, year: 2014

  19. Orbital studies of lunar magnetism

    Science.gov (United States)

    Mcleod, M. G.; Coleman, P. J., Jr.

    1982-01-01

    Limitations of present lunar magnetic maps are considered. Optimal processing of satellite derived magnetic anomaly data is also considered. Studies of coastal and core geomagnetism are discussed. Lunar remanent and induced lunar magnetization are included.

  20. A combined vector potential-scalar potential method for FE computation of 3D magnetic fields in electrical devices with iron cores

    Science.gov (United States)

    Wang, R.; Demerdash, N. A.

    1991-01-01

    A method of combined use of magnetic vector potential based finite-element (FE) formulations and magnetic scalar potential (MSP) based formulations for computation of three-dimensional magnetostatic fields is introduced. In this method, the curl-component of the magnetic field intensity is computed by a reduced magnetic vector potential. This field intensity forms the basic of a forcing function for a global magnetic scalar potential solution over the entire volume of the region. This method allows one to include iron portions sandwiched in between conductors within partitioned current-carrying subregions. The method is most suited for large-scale global-type 3-D magnetostatic field computations in electrical devices, and in particular rotating electric machinery.

  1. Models of the earth's core

    Science.gov (United States)

    Stevenson, D. J.

    1981-01-01

    Combined inferences from seismology, high-pressure experiment and theory, geomagnetism, fluid dynamics, and current views of terrestrial planetary evolution lead to models of the earth's core with five basic properties. These are that core formation was contemporaneous with earth accretion; the core is not in chemical equilibrium with the mantle; the outer core is a fluid iron alloy containing significant quantities of lighter elements and is probably almost adiabatic and compositionally uniform; the more iron-rich inner solid core is a consequence of partial freezing of the outer core, and the energy release from this process sustains the earth's magnetic field; and the thermodynamic properties of the core are well constrained by the application of liquid-state theory to seismic and labroatory data.

  2. Evaluation of structural, morphological and magnetic properties of CuZnNi (Cu_xZn_0_._5_−_xNi_0_._5Fe_2O_4) nanocrystalline ferrites for core, switching and MLCI’s applications

    International Nuclear Information System (INIS)

    Akhtar, Majid Niaz; Khan, Muhammad Azhar; Ahmad, Mukhtar; Nazir, M.S.; Imran, M.; Ali, A.; Sattar, A.; Murtaza, G.

    2017-01-01

    The influence of Cu substitution on the structural and morphological characteristics of Ni–Zn nanocrystalline ferrites have been discussed in this work. The detailed and systematic magnetic characterizations were also done for Cu substituted Ni–Zn nanoferrites. The nanocrystalline ferrites of Cu substituted Cu_xZn_0_._5_−_xNi_0_._5Fe_2O_4 ferrites (x=0, 0.1, 0.2, 0.3, 0.4 and 0.5) were synthesized using sol gel self-combustion hybrid method. X-ray diffraction (XRD), Field emission scanning electron microscopy (FESEM), Transmission electron microscope (TEM) and Vibrating sample magnetometer (VSM) were used to investigate the properties of Cu substituted nanocrystalline ferrites. Single phase structure of Cu substituted in Ni–Zn nanocrystalline ferrites were investigated for all the samples. Crystallite size, lattice constant and volume of the cell were found to increase by increasing Cu contents in spinel structure. The better morphology with well-organized nanocrystals of Cu–Zn–Ni ferrites at x=0 and 0.5 were observed from both FESEM and TEM analysis. The average grain size was 35–46 nm for all prepared nanocrystalline samples. Magnetic properties such as coercivity, saturation, remanence, magnetic squareness, magneto crystalline anisotropy constant (K) and Bohr magneton were measured from the recorded M–H loops. The magnetic saturation and remanence were increased by the incorporation of Cu contents. However, coercivity follow the Stoner-Wolforth model except for x=0.3 which may be due to the site occupancy and replacement of Cu contents from octahedral site. The squareness ratio confirmed the super paramgnetic behaviour of the Cu substituted in Ni–Zn nanocrystalline ferrites. Furthermore, Cu substituted Ni–Zn nanocrystalline ferrites may be suitable for many industrial and domestic applications such as components of transformers, core, switching, and MLCI’s due to variety of the soft magnetic characteristics. - Highlights: • Cu substituted

  3. VCAM-1-targeted core/shell nanoparticles for selective adhesion and delivery to endothelial cells with lipopolysaccharide-induced inflammation under shear flow and cellular magnetic resonance imaging in vitro.

    Science.gov (United States)

    Yang, Hong; Zhao, Fenglong; Li, Ying; Xu, Mingming; Li, Li; Wu, Chunhui; Miyoshi, Hirokazu; Liu, Yiyao

    2013-01-01

    Multifunctional nanomaterials with unique magnetic and luminescent properties have broad potential in biological applications. Because of the overexpression of vascular cell adhesion molecule-1 (VCAM-1) receptors in inflammatory endothelial cells as compared with normal endothelial cells, an anti-VCAM-1 monoclonal antibody can be used as a targeting ligand. Herein we describe the development of multifunctional core-shell Fe(3)O(4)@SiO2 nanoparticles with the ability to target inflammatory endothelial cells via VCAM-1, magnetism, and fluorescence imaging, with efficient magnetic resonance imaging contrast characteristics. Superparamagnetic iron oxide and fluorescein isothiocyanate (FITC) were loaded successfully inside the nanoparticle core and the silica shell, respectively, creating VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles that were characterized by scanning electron microscopy, transmission electron microscopy, fluorescence spectrometry, zeta potential assay, and fluorescence microscopy. The VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles typically had a diameter of 355 ± 37 nm, showed superparamagnetic behavior at room temperature, and cumulative and targeted adhesion to an inflammatory subline of human umbilical vein endothelial cells (HUVEC-CS) activated by lipopolysaccharide. Further, our data show that adhesion of VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles to inflammatory HUVEC-CS depended on both shear stress and duration of exposure to stress. Analysis of internalization into HUVEC-CS showed that the efficiency of delivery of VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles was also significantly greater than that of nontargeted Fe(3)O(4)@SiO2(FITC)-NH2 nanoparticles. Magnetic resonance images showed that the superparamagnetic iron oxide cores of the VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles could also act as a contrast agent for magnetic resonance imaging. Taken together, the cumulative adhesion and uptake potential of

  4. Core-shell magnetic structure of La.sub.1-x./sub.Sr.sub.x./sub.MnO.sub.3+δ./sub. nanocrystallites

    Czech Academy of Sciences Publication Activity Database

    Belozerova, N.M.; Kichanov, S.E.; Kozlenko, D. P.; Kaman, Ondřej; Jirák, Zdeněk

    2017-01-01

    Roč. 53, č. 11 (2017), s. 1-5, č. článku 2300905. ISSN 0018-9464 R&D Projects: GA ČR GA15-10088S Institutional support: RVO:68378271 Keywords : magnetic nanoparticles * neutron diffraction * perovskite manganite * phase separation Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.243, year: 2016

  5. Core-shell La.sub.1-x./sub.Sr.sub.x./sub.MnO.sub.3./sub. nanoparticles as colloidal mediators for magnetic fluid hyperthermia

    Czech Academy of Sciences Publication Activity Database

    Pollert, Emil; Kaman, Ondřej; Veverka, Pavel; Veverka, Miroslav; Maryško, Miroslav; Závěta, Karel; Kačenka, M.; Lukeš, I.; Jendelová, Pavla; Kašpar, P.; Burián, M.; Herynek, V.

    2010-01-01

    Roč. 368, č. 1927 (2010), s. 4389-4405 ISSN 1364-503X R&D Projects: GA AV ČR KAN200200651; GA AV ČR KAN201110651 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z50390512 Keywords : magnetic fluid hyperthermia * manganese perovskites * nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.457, year: 2010

  6. The earths innermost core

    International Nuclear Information System (INIS)

    Nanda, J.N.

    1989-01-01

    A new earth model is advanced with a solid innermost core at the centre of the Earth where elements heavier than iron, over and above what can be retained in solution in the iron core, are collected. The innermost core is separated from the solid iron-nickel core by a shell of liquid copper. The innermost core has a natural vibration measured on the earth's surface as the long period 26 seconds microseisms. The earth was formed initially as a liquid sphere with a relatively thin solid crust above the Byerly discontinuity. The trace elements that entered the innermost core amounted to only 0.925 ppm of the molten mass. Gravitational differentiation must have led to the separation of an explosive thickness of pure 235 U causing a fission explosion that could expel beyond the Roche limit a crustal scab which would form the centre piece of the moon. A reservoir of helium floats on the liquid copper. A small proportion of helium-3, a relic of the ancient fission explosion present there will spell the exciting magnetic field. The field is stable for thousands of years because of the presence of large quantity of helium-4 which accounts for most of the gaseous collisions that will not disturb the atomic spin of helium-3 atoms. This field is prone to sudden reversals after long periods of stability. (author). 14 refs

  7. Enhancing the magnetic properties of magnetic nanoparticles

    DEFF Research Database (Denmark)

    Ahlburg, Jakob; Saura-Múzquiz, Matilde; Stingaciu, Marian

    with a similar magnetic performance. There are several different ways of enhancing magnetic properties of 3d magnetic compounds. This includes, size control, core-shell particles or mixing hard and soft magnetic materials together to achieve an exchange coupling between the compounds and enhancing the magnetic...... energy product. In order to control the particle size, a hydrothermal synthesis is preferred. This followed by reduction or the oxides into either core shell particles, or a mixture of magnetic oxides and a metallic phase.......Strong magnets with a high energy product are vital when optimizing the efficiency in the electric industry. But since the rare earth metals, normally used for making strong permanent magnets, are both expensive and difficult to mine, a great demand has come to cheaper types of magnets...

  8. Study of the role of the ligands coordinated at the surface of pure Wuestite nanoparticles prepared following a room temperature organometallic method: Evidence of ferromagnetic - in shell- and antiferromagnetic - in core magnetic behaviors

    Energy Technology Data Exchange (ETDEWEB)

    Glaria, Arnaud [CNRS, LCC (Laboratoire de Chimie de Coordination), 205, route de Narbonne, F-31077 Toulouse (France); Universite de Toulouse, UPS, INPT, LCC, F-31077 Toulouse (France); Kahn, Myrtil L., E-mail: myrtil.kahn@lcc-toulouse.fr [CNRS, LCC (Laboratoire de Chimie de Coordination), 205, route de Narbonne, F-31077 Toulouse (France); Universite de Toulouse, UPS, INPT, LCC, F-31077 Toulouse (France); Chaudret, Bruno [CNRS, LCC (Laboratoire de Chimie de Coordination), 205, route de Narbonne, F-31077 Toulouse (France); Universite de Toulouse, UPS, INPT, LCC, F-31077 Toulouse (France); Lecante, Pierre; Casanove, Marie-Jose [CNRS, CEMES (Centre d' Elaboration des Materiaux et d' Etudes Structurales), 29 rue Jeanne Marvig, BP 4347, 31055 Toulouse Cedex (France); Barbara, Bernard, E-mail: bernard.barbara@grenoble.cnrs.fr [Institut Louis Neel, CNRS, 25 Av. des martyrs, BP 166, 38042 Grenoble Cedex 09 (France)

    2011-09-15

    Highlights: {yields} Pure Wuestite (Fe{sub 1-y}O) nanoparticles synthesized by organometallic chemistry. {yields} The influence of the surface ligands on the magnetic properties. {yields} Ferromagnetic core-antiferromagnetic shell magnetic nanoparticles. - Abstract: Wuestite particles (Fe{sub 1-y}O) are synthesized using controlled hydrolysis at room temperature of [Fe(N(SiMe{sub 3}){sub 2}){sub 2}] and stabilized by amine ligands. This method leads to 5 nm pure wuestite particles. This phase is clearly identified by transmission electron microscopy and wide angle X-ray scattering. Distortion in the crystallographic structure has been demonstrated. Particular attention is paid on the Fe(III) formation. Moreover, a combination of Moessbauer spectroscopy and SQuID measurements, revealed that the particles are composed of an antiferromagnetic core surrounded by a ferromagnetic shell. According to the Neel theory, the Fe(III) and Fe(II) ions present in the particles are ferromagnetically coupled and the proportion of Fe(III) ions varies from 3.9 to 7.1% as a function of the amine ligand.

  9. Core lifter

    Energy Technology Data Exchange (ETDEWEB)

    Pavlov, N G; Edel' man, Ya A

    1981-02-15

    A core lifter is suggested which contains a housing, core-clamping elements installed in the housing depressions in the form of semirings with projections on the outer surface restricting the rotation of the semirings in the housing depressions. In order to improve the strength and reliability of the core lifter, the semirings have a variable transverse section formed from the outside by the surface of the rotation body of the inner arc of the semiring aroung the rotation axis and from the inner a cylindrical surface which is concentric to the outer arc of the semiring. The core-clamping elements made in this manner have the possibility of freely rotating in the housing depressions under their own weight and from contact with the core sample. These semirings do not have weakened sections, have sufficient strength, are inserted into the limited ring section of the housing of the core lifter without reduction in its through opening and this improve the reliability of the core lifter in operation.

  10. Study of magnetization and magnetoelectricity in CoFe2O4/BiFeO3 core-shell composites

    Science.gov (United States)

    Kuila, S.; Tiwary, Sweta; Sahoo, M. R.; Barik, A.; Babu, P. D.; Siruguri, V.; Birajdar, B.; Vishwakarma, P. N.

    2018-02-01

    CoFe2O4 (core)/BiFeO3 (shell) nanoparticles are prepared by varying the relative molar concentration of core and shell materials (40%CoFe2O4-60%BiFeO3, 50%CoFe2O4-50%BiFeO3, and 60%CoFe2O4-40%BiFeO3). The core-shell nature is confirmed from transmission electron microscopy on these samples. A plot of ΔM (=MFC-MZFC) vs temperature suggests the presence of two types of spin dynamics: (a) particle size dependent spin blocking and (b) spin-disorder. These two spin dynamic processes are found to contribute independently to the generation of magnetoelectric voltage. Very clear first order and second order magnetoelectric voltages are recorded. The resemblance of the first order magnetoelectric coefficient vs temperature plot to that of building up of order parameters in the mean field theory suggests that spin disorder can act like one of the essential ingredients in building the magnetoelectric coupling. The best result is obtained for the 50-50 composition sample, which may be due to better coupling of magnetostrictive CoFe2O4, and piezoelectric BiFeO3, because of the optimum thickness of shell and core.

  11. Vortex flow during early and late left ventricular filling in normal subjects: quantitative characterization using retrospectively-gated 4D flow cardiovascular magnetic resonance and three-dimensional vortex core analysis.

    Science.gov (United States)

    Elbaz, Mohammed S M; Calkoen, Emmeline E; Westenberg, Jos J M; Lelieveldt, Boudewijn P F; Roest, Arno A W; van der Geest, Rob J

    2014-09-27

    LV diastolic vortex formation has been suggested to critically contribute to efficient blood pumping function, while altered vortex formation has been associated with LV pathologies. Therefore, quantitative characterization of vortex flow might provide a novel objective tool for evaluating LV function. The objectives of this study were 1) assess feasibility of vortex flow analysis during both early and late diastolic filling in vivo in normal subjects using 4D Flow cardiovascular magnetic resonance (CMR) with retrospective cardiac gating and 3D vortex core analysis 2) establish normal quantitative parameters characterizing 3D LV vortex flow during both early and late ventricular filling in normal subjects. With full ethical approval, twenty-four healthy volunteers (mean age: 20±10 years) underwent whole-heart 4D Flow CMR. The Lambda2-method was used to extract 3D LV vortex ring cores from the blood flow velocity field during early (E) and late (A) diastolic filling. The 3D location of the center of vortex ring core was characterized using cylindrical cardiac coordinates (Circumferential, Longitudinal (L), Radial (R)). Comparison between E and A filling was done with a paired T-test. The orientation of the vortex ring core was measured and the ring shape was quantified by the circularity index (CI). Finally, the Spearman's correlation between the shapes of mitral inflow pattern and formed vortex ring cores was tested. Distinct E- and A-vortex ring cores were observed with centers of A-vortex rings significantly closer to the mitral valve annulus (E-vortex L=0.19±0.04 versus A-vortex L=0.15±0.05; p=0.0001), closer to the ventricle's long-axis (E-vortex: R=0.27±0.07, A-vortex: R=0.20±0.09, p=0.048) and more elliptical in shape (E-vortex: CI=0.79±0.09, A-vortex: CI=0.57±0.06; vortex. The circumferential location and orientation relative to LV long-axis for both E- and A-vortex ring cores were similar. Good to strong correlation was found between vortex shape and

  12. Magnetic Fe3O4@MCM-41 core-shell nanoparticles functionalized with thiol silane for efficient l-asparaginase immobilization.

    Science.gov (United States)

    Ulu, Ahmet; Noma, Samir Abbas Ali; Koytepe, Suleyman; Ates, Burhan

    2018-06-06

    l-Asparaginase (l-ASNase) is a vital enzyme for medical treatment and food industry. Here, we assessed the use of Fe 3 O 4 @Mobil Composition of Matter No. 41 (MCM-41) magnetic nanoparticles as carrier matrix for l-ASNase immobilization. In addition, surface of Fe 3 O 4 @MCM-41 magnetic nanoparticles was functionalized with 3-mercaptopropyltrimethoxysilane (MPTMS) to enhance stability of l-ASNase. The chemical structure, thermal properties, magnetic profile and morphology of the thiol-functionalized Fe 3 O 4 @MCM-41 magnetic nanoparticles were characterized with Fourier transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA), differential thermal analysis (DTA), differential scanning calorimetry (DSC), vibrating sample magnetometer (VSM), scanning electron microscope (SEM), energy dispersive X-ray (EDX) spectroscopy and zeta-potential measurement. l-ASNase was covalently immobilized onto the thiol-functionalized Fe 3 O 4 @MCM-41 magnetic nanoparticles. The properties of the immobilized enzyme, including optimum pH, temperature, kinetic parameters, thermal stability, reusability and storage stability were investigated and compared to free one. Immobilized enzyme was found to be stable over a wide range of pH and temperature range than free enzyme. The immobilized l-ASNase also showed higher thermal stability after 180 min incubation at 50 °C. The immobilized enzyme still retained 63% of its original activity after 16 times of reuse. The Km value for the immobilized enzyme was 1.15-fold lower than the free enzyme, which indicates increased affinity for the substrate. Additionally, the immobilized enzyme was active over 65% and 53% after 30 days of storage at 4 °C and room temperature (∼25 °C), respectively. Thereby, the results confirmed that thiol-functionalized Fe 3 O 4 @MCM-41 magnetic nanoparticles had high efficiency for l-ASNase immobilization and improved stability of L-ASNase.

  13. Tandem assays of protein and glucose with functionalized core/shell particles based on magnetic separation and surface-enhanced Raman scattering.

    Science.gov (United States)

    Kong, Xianming; Yu, Qian; Lv, Zhongpeng; Du, Xuezhong

    2013-10-11

    Tandem assays of protein and glucose in combination with mannose-functionalized Fe3 O4 @SiO2 and Ag@SiO2 tag particles have promising potential in effective magnetic separation and highly sensitive and selective SERS assays of biomaterials. It is for the first time that tandem assay of glucose is developed using SERS based on the Con A-sandwiched microstructures between the functionalized magnetic and tag particles. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Reactor core

    International Nuclear Information System (INIS)

    Azekura, Kazuo; Kurihara, Kunitoshi.

    1992-01-01

    In a BWR type reactor, a great number of pipes (spectral shift pipes) are disposed in the reactor core. Moderators having a small moderating cross section (heavy water) are circulated in the spectral shift pipes to suppress the excess reactivity while increasing the conversion ratio at an initial stage of the operation cycle. After the intermediate stage of the operation cycle in which the reactor core reactivity is lowered, reactivity is increased by circulating moderators having a great moderating cross section (light water) to extend the taken up burnup degree. Further, neutron absorbers such as boron are mixed to the moderator in the spectral shift pipe to control the concentration thereof. With such a constitution, control rods and driving mechanisms are no more necessary, to simplify the structure of the reactor core. This can increase the fuel conversion ratio and control great excess reactivity. Accordingly, a nuclear reactor core of high conversion and high burnup degree can be attained. (I.N.)

  15. Ice Cores

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Records of past temperature, precipitation, atmospheric trace gases, and other aspects of climate and environment derived from ice cores drilled on glaciers and ice...

  16. An integrated magnetics component

    DEFF Research Database (Denmark)

    2013-01-01

    The present invention relates to an integrated magnetics component comprising a magnetically permeable core comprising a base member extending in a horizontal plane and first, second, third and fourth legs protruding substantially perpendicularly from the base member. First, second, third...... and fourth output inductor windings are wound around the first, second, third and fourth legs, respectively. A first input conductor of the integrated magnetics component has a first conductor axis and extends in-between the first, second, third and fourth legs to induce a first magnetic flux through a first...... flux path of the magnetically permeable core. A second input conductor of the integrated magnetics component has a second coil axis extending substantially perpendicularly to the first conductor axis to induce a second magnetic flux through a second flux path of the magnetically permeable core...

  17. Site-specific ligation of anthracene-1,8-dicarboxylates to an Mn12 core: a route to the controlled functionalisation of single-molecule magnets.

    Science.gov (United States)

    Pacchioni, Mirko; Cornia, Andrea; Fabretti, Antonio C; Zobbi, Laura; Bonacchi, Daniele; Caneschi, Andrea; Chastanet, Guillaume; Gatteschi, Dante; Sessoli, Roberta

    2004-11-21

    A novel single-molecule magnet of the Mn12 family, [Mn12O12(O2CC6H5)8(L)4(H2O)4].8CH2Cl2, has been synthesised by site-specific ligand exchange using a tailor-made dicarboxylate (L2-), which leads to selective occupation of axial binding sites.

  18. Dehydration of glucose to 5-hydroxymethylfurfural by a core-shell Fe3O4@SiO2-SO3H magnetic nanoparticle catalyst

    Science.gov (United States)

    This paper discusses the potential use of (Fe3O4@SiO2-SO3H) nanoparticle catalyst for the dehydration of glucose into 5-hydroxymethylfurfural (HMF). A magnetically recoverable (Fe3O4@SiO2-SO3H) nanoparticle catalyst was successfully prepared by supporting sulfonic acid groups (SO3H) on the surface o...

  19. Design and synthesis of core-shell Fe3O4@PTMT composite magnetic microspheres for adsorption of heavy metals from high salinity wastewater.

    Science.gov (United States)

    Huang, Xin; Yang, Jinyue; Wang, Jingkang; Bi, Jingtao; Xie, Chuang; Hao, Hongxun

    2018-05-10

    In this study, a novel magnetic nanoparticles (MNP) modified by an organodisulfide polymer (PTMT) was designed for adsorption of heavy metals (Hg(II), Pb(II) and Cd(II)) from simulated coal chemical high salinity wastewater. The MNP-PTMT nano-composite was synthesize and characterized by SEM, TEM, FTIR, BET, VSM, TGA and XRD. The results indicate that the wanted MNP-PTMT magnetic nanoparticles were successfully obtained by modification. Adsorption experiments were systematically carried out to evaluate the performance of the obtained nanoparticles and to build up the adsorption models. The results demonstrate that the adsorption kinetic and isotherms thermodynamic followed the pseudo-second-order model and the Freundlich equation, respectively. In the presence of the inorganic salt in high salinity wastewater, the adsorption efficiency of MNP-PTMT for heavy metals was still excellent. The magnetic adsorbent could be recovered from aqueous solution by an external magnetic field in 20s and the subsequent regeneration of Hg(II)/Pb(II) loaded MNP-PTMT can be efficiently achieved by using EDTA-2Na solution as desorbent. The novel MNP-PTMT nanoparticles could be used reproductively for five times without apparent decrease in sorption capacity. Copyright © 2018 Elsevier Ltd. All rights reserved.

  20. Determination of Organophosphorous Pesticides in Environmental Water Samples Using Surface-Engineered C18 Functionalized Silica-Coated Core-Shell Magnetic Nanoparticles-Based Extraction Coupled with GC-MS/MS Analysis.

    Science.gov (United States)

    Srivastava, Neha; Kumari, Supriya; Nair, Kishore; Alam, Samsul; Raza, Syed K

    2017-05-01

    The present paper depicts a novel method based on magnetic SPE (MSPE) for the determination of organophosphorus pesticides (OPs) such as phorate, malathion, and chlorpyrifos in environmental water samples. In this study, C18 functionalized silica-coated core-shell iron oxide magnetic nanoparticles (MNPs) were used as a surface-engineered magnetic sorbent for the selective extraction of pesticides from aqueous samples, followed by GC-MS and GC-tandem MS analysis for confirmative determination of the analytes. Various important method parameters, including quantity of MNP adsorbent, volume of sample, effective time for extraction, nature of the desorbing solvent, and pH of the aqueous sample, were investigated and optimized to obtain maximum method performance. Under the optimized instrumental analysis conditions, good linearity (r2 value ≥0.994) was achieved at the concentration range of 0.5-500 μg/L. Recoveries were in the range of 79.2-96.3 and 80.4-97.5% in selective-ion monitoring and multiple reaction monitoring (MRM) modes, respectively, at the spiking concentrations of 1, 5, and 10 μg/L. MRM mode showed better sensitivity, selectivity, and low-level detection (0.5 μg/L) of analytes. The novel MSPE method is a simple, cheap, rapid, and eco-friendly method for the determination of OPs in environmental water samples.

  1. Microesferas poliméricas magnéticas à base de estireno e divinilbenzeno com morfologia casca e núcleo Magnetic polymeric microspheres based on styrene and divinylbenzene with core-shell morphology

    Directory of Open Access Journals (Sweden)

    Washington J. F. Formiga

    2013-01-01

    Full Text Available Microesferas poliméricas com propriedades magnéticas à base de estireno (STY e divinilbenzeno (DVB foram sintetizadas usando a técnica de polimerização em suspensão em duas etapas. Na primeira, foram preparados os núcleos poliméricos à base de STY e DVB e magnetita. Na segunda, os núcleos foram previamente inchados em uma emulsão de STY e DVB e novamente polimerizados para a formação da casca. Foram variados o método de adição da emulsão e o tempo de inchamento. Os materiais obtidos foram caracterizados quanto ao tamanho de partícula por peneiramento, análise termogravimétrica (TGA, microscopia eletrônica de varredura (SEM e magnetometria de amostra vibrante (VSM. Os métodos avaliados na formação da casca de poli(estireno-co-divinilbenzeno produziram partículas com diâmetro médio maior do que o núcleo. Este resultado indica a formação de morfologia casca e núcleo. O controle morfológico só foi obtido com as resinas RR48/1 e RR48/3. O método onde a emulsão de estireno e divinilbenzeno foi adicionada em etapa única, seguida de 48 horas de inchamento do núcleo a 10 °C (RR48/1, forneceu o maior rendimento (64%. Além disso, todas as resinas casca-núcleo foram sensíveis ao estímulo magnético realizado por um ímã, atestando assim que foram produzidas resinas com propriedades magnéticas.Magnetic polymeric microspheres based on styrene (STY and divinylbenzene (DVB were synthesized in two steps. Firstly, the polymeric core, constituted by STY, DVB and magnetite, was prepared by suspension polymerization. Then, the core was swollen in a STY and DVB emulsion. Subsequently, a second suspension polymerization was carried out in order to form a shell. The emulsion addition method and the swelling time were varied. The particle size, morphology, thermal stability and magnetic properties of the microspheres were studied by sieving, thermogravimetric analysis (TGA, scanning electron microscopy (SEM and vibrating

  2. Reactor core

    International Nuclear Information System (INIS)

    Matsuura, Tetsuaki; Nomura, Teiji; Tokunaga, Kensuke; Okuda, Shin-ichi

    1990-01-01

    Fuel assemblies in the portions where the gradient of fast neutron fluxes between two opposing faces of a channel box is great are kept loaded at the outermost peripheral position of the reactor core also in the second operation cycle in the order to prevent interference between a control rod and the channel box due to bending deformation of the channel box. Further, the fuel assemblies in the second row from the outer most periphery in the first operation cycle are also kept loaded at the second row in the second operation cycle. Since the gradient of the fast neutrons in the reactor core is especially great at the outer circumference of the reactor core, the channel box at the outer circumference is bent such that the surface facing to the center of the reactor core is convexed and the channel box in the second row is also bent to the identical direction, the insertion of the control rod is not interfered. Further, if the positions for the fuels at the outermost periphery and the fuels in the second row are not altered in the second operation cycle, the gaps are not reduced to prevent the interference between the control rod and the channel box. (N.H.)

  3. Amperometric glucose sensor based on enhanced catalytic reduction of oxygen using glucose oxidase adsorbed onto core-shell Fe{sub 3}O{sub 4}-silica-Au magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Wang Aijun [College of Geography and Environmental Science, College of Chemistry and Life Science, Zhejiang Normal University, Jinhua 321004 (China); Key Laboratory of Green Chemical Media and Reactions, Ministry of Education, School of Chemistry and Environmental Science, Henan Normal University, Xinxiang 453007 (China); Li Yongfang [College of Chemistry and Chemical Engineering, Henan Institute of Science and Technology, Xinxiang 453003 (China); Li Zhonghua [Key Laboratory of Green Chemical Media and Reactions, Ministry of Education, School of Chemistry and Environmental Science, Henan Normal University, Xinxiang 453007 (China); Feng Jiuju, E-mail: jjfengnju@gmail.com [College of Geography and Environmental Science, College of Chemistry and Life Science, Zhejiang Normal University, Jinhua 321004 (China); Key Laboratory of Green Chemical Media and Reactions, Ministry of Education, School of Chemistry and Environmental Science, Henan Normal University, Xinxiang 453007 (China); Sun Yanli [Key Laboratory of Green Chemical Media and Reactions, Ministry of Education, School of Chemistry and Environmental Science, Henan Normal University, Xinxiang 453007 (China); Chen Jianrong [College of Geography and Environmental Science, College of Chemistry and Life Science, Zhejiang Normal University, Jinhua 321004 (China)

    2012-08-01

    Monodisperse Fe{sub 3}O{sub 4} magnetic nanoparticles (NPs) were prepared under facile solvothermal conditions and successively functionalized with silica and Au to form core/shell Fe{sub 3}O{sub 4}-silica-Au NPs. Furthermore, the samples were used as matrix to construct a glucose sensor based on glucose oxidase (GOD). The immobilized GOD retained its bioactivity with high protein load of 3.92 Multiplication-Sign 10{sup -9} mol{center_dot}cm{sup -2}, and exhibited a surface-controlled quasi-reversible redox reaction, with a fast heterogeneous electron transfer rate of 7.98 {+-} 0.6 s{sup -1}. The glucose biosensor showed a broad linear range up to 3.97 mM with high sensitivity of 62.45 {mu}A{center_dot}mM{sup -1} cm{sup -2} and fast response (less than 5 s). - Graphical abstract: Core-shell structured Fe{sub 3}O{sub 4}-silica-Au nanoparticles were prepared and used as matrix to construct an amperometric glucose sensor based on glucose oxidase, which showed broad linear range, high sensitivity, and fast response. Highlights: Black-Right-Pointing-Pointer Synthesis of monodispersed Fe{sub 3}O{sub 4} nanoparticles. Black-Right-Pointing-Pointer Fabrication of core/shell Fe{sub 3}O{sub 4}-silica-Au nanoparticles. Black-Right-Pointing-Pointer Construction of a novel glucose sensor with wide linear range, high sensitivity and fast response.

  4. Facile preparation of surface-exchangeable core@shell iron oxide@gold nanoparticles for magnetic solid-phase extraction: Use of gold shell as the intermediate platform for versatile adsorbents with varying self-assembled monolayers

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yaping [Beijing National Laboratory of Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Graduate School, University of Chinese Academy of Sciences, Beijing 100049 (China); Qi, Li, E-mail: qili@iccas.ac.cn [Beijing National Laboratory of Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Shen, Ying [Beijing National Laboratory of Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Graduate School, University of Chinese Academy of Sciences, Beijing 100049 (China); Ma, Huimin [Beijing National Laboratory of Molecular Sciences, Key Laboratory of Analytical Chemistry for Living Biosystems, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)

    2014-02-06

    Graphical abstract: -- Highlights: •The core@shell Fe{sub 3}O{sub 4}@Au nanoparticles functionalized with SAMs were successfully constructed. •The SAMs could be transformed from one kind to another via thiol exchange process. •The developed nanomaterials could be applied in mode switching MSPE. -- Abstract: The core@shell Fe{sub 3}O{sub 4}@Au nanoparticles (NPs) functionalized with exchangeable self-assembled monolayers have been developed for mode switching magnetic solid-phase extraction (MSPE) using high performance liquid chromatography with ultraviolet detection. The adsorbents were synthesized by chemical coprecipitation to prepare magnetic cores followed by sonolysis to produce gold shells. Functionalization of Fe{sub 3}O{sub 4}@Au NPs surface was realized through self-assembly of commercially available low molecular weight thiol-containing ligands using gold shells as intermediate platform and the dynamic nature of Au–S chemistry allowed substituent of one thiol-containing ligand with another simply by thiol exchange process. The resultant adsorbents were characterized by transmission electronic microscopy, Fourier transform infrared spectroscopy, elemental analysis, contact angle measurement, and vibrating sample magnetometry. To evaluate the versatile performance of the developed MSPE adsorbents, they were applied for normal-phase SPE followed by reversed-phase SPE. A few kinds of diphenols and polycyclic aromatic hydrocarbons (PAHs) were employed as model analytes, respectively. The predominant parameters affecting extraction efficiency were investigated and optimized. Under the optimum experimental conditions, wide dynamic linear range (6.25–1600 μg L{sup −1} for diphenols and 1.56–100 μg L{sup −1} for PAHs) with good linearity (r{sup 2} ≥ 0.989) and low detection limits (0.34–16.67 μg L{sup −1} for diphenols and 0.26–0.52 μg L{sup −1} for PAHs) were achieved. The advantage of the developed method is that the Fe{sub 3}O

  5. The thermal evolution of Mercury's Fe-Si core

    Science.gov (United States)

    Knibbe, Jurriën Sebastiaan; van Westrenen, Wim

    2018-01-01

    We have studied the thermal and magnetic field evolution of planet Mercury with a core of Fe-Si alloy to assess whether an Fe-Si core matches its present-day partially molten state, Mercury's magnetic field strength, and the observed ancient crustal magnetization. The main advantages of an Fe-Si core, opposed to a previously assumed Fe-S core, are that a Si-bearing core is consistent with the highly reduced nature of Mercury and that no compositional convection is generated upon core solidification, in agreement with magnetic field indications of a stable layer at the top of Mercury's core. This study also present the first implementation of a conductive temperature profile in the core where heat fluxes are sub-adiabatic in a global thermal evolution model. We show that heat migrates from the deep core to the outer part of the core as soon as heat fluxes at the outer core become sub-adiabatic. As a result, the deep core cools throughout Mercury's evolution independent of the temperature evolution at the core-mantle boundary, causing an early start of inner core solidification and magnetic field generation. The conductive layer at the outer core suppresses the rate of core growth after temperature differences between the deep and shallow core are relaxed, such that a magnetic field can be generated until the present. Also, the outer core and mantle operate at higher temperatures than previously thought, which prolongs mantle melting and mantle convection. The results indicate that S is not a necessary ingredient of Mercury's core, bringing bulk compositional models of Mercury more in line with reduced meteorite analogues.

  6. Core shift effect in blazars

    Science.gov (United States)

    Agarwal, A.; Mohan, P.; Gupta, Alok C.; Mangalam, A.; Volvach, A. E.; Aller, M. F.; Aller, H. D.; Gu, M. F.; Lähteenmäki, A.; Tornikoski, M.; Volvach, L. N.

    2017-07-01

    We studied the pc-scale core shift effect using radio light curves for three blazars, S5 0716+714, 3C 279 and BL Lacertae, which were monitored at five frequencies (ν) between 4.8 and 36.8 GHz using the University of Michigan Radio Astronomical Observatory (UMRAO), the Crimean Astrophysical Observatory (CrAO) and Metsähovi Radio Observatory for over 40 yr. Flares were Gaussian fitted to derive time delays between observed frequencies for each flare (Δt), peak amplitude (A) and their half width. Using A ∝ να, we infer α in the range of -16.67-2.41 and using Δ t ∝ ν ^{1/k_r}, we infer kr ∼ 1, employed in the context of equipartition between magnetic and kinetic energy density for parameter estimation. From the estimated core position offset (Ωrν) and the core radius (rcore), we infer that opacity model may not be valid in all cases. The mean magnetic field strengths at 1 pc (B1) and at the core (Bcore) are in agreement with previous estimates. We apply the magnetically arrested disc model to estimate black hole spins in the range of 0.15-0.9 for these blazars, indicating that the model is consistent with expected accretion mode in such sources. The power-law-shaped power spectral density has slopes -1.3 to -2.3 and is interpreted in terms of multiple shocks or magnetic instabilities.

  7. Core-dependent and ligand-dependent relativistic corrections to the nuclear magnetic shieldings in MH4-n Y n (n = 0-4; M = Si, Ge, Sn, and Y = H, F, Cl, Br, I) model compounds.

    Science.gov (United States)

    Maldonado, Alejandro F; Aucar, Gustavo A; Melo, Juan I

    2014-09-01

    The nuclear magnetic shieldings of Si, Ge, and Sn in MH(4-n) Y(n) (M = Si, Ge, Sn; Y = F, Cl, Br, I and n = 1-4) molecular systems are highly influenced by the substitution of one or more hydrogens by heavy-halogen atoms. We applied the linear response elimination of small components (LRESC) formalism to calculate those shieldings and learn whether including only a few of the leading relativistic correction terms is sufficient to be able to quantitatively reproduce the full relativistic value. It was observed that the nuclear magnetic shieldings change as the number of heavy halogen substituents and their weights vary, and the pattern of σ(M) generally does not exhibit the normal halogen dependence (NHD) behavior that can be seen in similar molecular systems containing carbon atoms. We also analyzed each relativistic correction afforded by the LRESC method and split them in two: core-dependent and ligand-dependent contributions; we then looked for the electronic mechanisms involved in the different relativistic effects and in the total relativistic value. Based on this analysis, we were able to study the electronic mechanism involved in a recently proposed relativistic effect, the "heavy atom effect on vicinal heavy atom" (HAVHA), in more detail. We found that the main electronic mechanism is the spin-orbit or σ p (T(3)) correction, although other corrections such as σ p (S(1)) and σ p (S(3)) are also important. Finally, we analyzed proton magnetic shieldings and found that, for molecules containing Sn as the central atom, σ(H) decreases as the number of heavy halogen substituents (of the same type: either F, Cl, or Br) increases, albeit at different rates for different halogens. σ(H) only increase as the number of halogen substituents increases if the halogen is iodine.

  8. Iron-titanium oxide minerals and magnetic susceptibility anomalies in the Mariano Lake-Lake Valley cores - Constraints on conditions of uranium mineralization in the Morrison Formation, San Juan Basin, New Mexico

    International Nuclear Information System (INIS)

    Reynolds, R.L.; Fishman, N.S.; Scott, J.H.; Hudson, M.R.

    1986-01-01

    Petrographic study of the Mariano Lake-Lake Valley cores reveals three distinct zones of postdepositional alteration of detrital Fe-Ti (iron-titanium) oxide minerals in the Westwater Canyon Member of the Upper Jurassic Morrisson Formation. In the uranium-bearing and adjacent portions of the Westwater Canyon, these detrital Fe-Ti oxide minerals have been thoroughly altered by leaching of iron. Stratigraphically lower parts of the Westwater Canyon and the underlying Recapture Member are characterized by preservation of Fe-Ti oxide grains, primarily magnetite and ilmenite, and of hematite, and by an absence or uranium concentrations. Partly destroyed Fe-Ti oxide minerals occupy an interval between the zones of destruction and preservation. Alteration patterns of the Fe-Ti oxide minerals are reflected in bore-hole magnetic susceptibility logs. Magnetic susceptibility response in the upper parts of the Westwater Canyon Member is flat and uniformly <500 μSI units, but at greater depths it fluctuates sharply, from <1,000 to nearly 8,000 μSI units. The boundary between uniformly low and high magnetic susceptibility response corresponds closely to the interval that divides the zone of completely altered from the zone of preserved detrital Fe-Ti oxide minerals. The alteration pattern suggests that solutions responsible for destruction of the Fe-ti oxide minerals originated in the overlying Brushy Basin Member of the Morrison Formation. Previous studies indicate that these solutions were rich in soluble organic matter and perhaps in uranium. Uranium precipitation may have been controlled by a vertically fluctuation interface between organic-rich solutions and geochemically different fluids in which the detrital Fe-Ti oxide minerals were preserved

  9. Synthesis of Superparamagnetic Core-Shell Structure Supported Pd Nanocatalysts for Catalytic Nitrite Reduction with Enhanced Activity, No Detection of Undesirable Product of Ammonium, and Easy Magnetic Separation Capability.

    Science.gov (United States)

    Sun, Wuzhu; Yang, Weiyi; Xu, Zhengchao; Li, Qi; Shang, Jian Ku

    2016-01-27

    Superparamagnetic nanocatalysts could minimize both the external and internal mass transport limitations and neutralize OH(-) produced in the reaction more effectively to enhance the catalytic nitrite reduction efficiency with the depressed product selectivity to undesirable ammonium, while possess an easy magnetic separation capability. However, commonly used qusi-monodispersed superparamagnetic Fe3O4 nanosphere is not suitable as catalyst support for nitrite reduction because it could reduce the catalytic reaction efficiency and the product selectivity to N2, and the iron leakage could bring secondary contamination to the treated water. In this study, protective shells of SiO2, polymethylacrylic acid, and carbon were introduced to synthesize Fe3O4@SiO2/Pd, Fe3O4@PMAA/Pd, and Fe3O4@C/Pd catalysts for catalytic nitrite reduction. It was found that SiO2 shell could provide the complete protection to Fe3O4 nanosphere core among these shells. Because of its good dispersion, dense structure, and complete protection to Fe3O4, the Fe3O4@SiO2/Pd catalyst demonstrated the highest catalytic nitrite reduction activity without the detection of NH4(+) produced. Due to this unique structure, the activity of Fe3O4@SiO2/Pd catalysts for nitrite reduction was found to be independent of the Pd nanoparticle size or shape, and their product selectivity was independent of the Pd nanoparticle size, shape, and content. Furthermore, their superparamagnetic nature and high saturation magnetization allowed their easy magnetic separation from treated water, and they also demonstrated a good stability during the subsequent recycling experiment.

  10. Superrotation of Earth’s Inner Core, Extraterrestrial Impacts, and the Effective Viscosity of Outer Core

    OpenAIRE

    Pirooz Mohazzabi; John D. Skalbeck

    2015-01-01

    The recently verified superrotation of Earth’s inner core is examined and a new model is presented which is based on the tidal despinning of the mantle and the viscosity of the outer core. The model also takes into account other damping mechanisms arising from the inner core superrotation such as magnetic and gravitational coupling as well as contribution from eddy viscosity in the outer core. The effective viscosity obtained in this model confirms a previously well constrained value of about...

  11. Effective magnetic moment of neutrinos in strong magnetic fields

    International Nuclear Information System (INIS)

    Perez M, A.; Perez R, H.; Masood, S.S.; Gaitan, R.; Rodriguez R, S.

    2002-01-01

    In this paper we compute the effective magnetic moment of neutrinos propagating in dense high magnetized medium. Taking typical values of magnetic field and densities of astrophysical objects (such as the cores of supernovae and neutron stars) we obtain an effective type of dipole magnetic moment in agreement with astrophysical and cosmological bounds. (Author)

  12. Device for removal of oriented core

    Energy Technology Data Exchange (ETDEWEB)

    Shakhmalov, A.M.

    1981-05-04

    A device for removal of an oriented core, which contains an external core barrel, connected with a gear, a rock-crushing bit, nonrotary core-receiving pipe, and a core marker, placed in the core-receiving pipe and connected kinematically with the external core barrel and gear, is distinguished by the fact that in order to increase the accuracy of determination of the spatial orientation of the core the gear of the core barrel and the marker come in the form of an electric drill, and a magnetic compass witha remote-fix indicator is attached to its housing. The device is also distinguished by the fact that it is equipped with an auxillary marker positioned symmetrically with respect to the first one.

  13. Core BPEL

    DEFF Research Database (Denmark)

    Hallwyl, Tim; Højsgaard, Espen

    The Web Services Business Process Execution Language (WS-BPEL) is a language for expressing business process behaviour based on web services. The language is intentionally not minimal but provides a rich set of constructs, allows omission of constructs by relying on defaults, and supports language......, does not allow omissions, and does not contain ignorable elements. We do so by identifying syntactic sugar, including default values, and ignorable elements in WS-BPEL. The analysis results in a translation from the full language to the core subset. Thus, we reduce the effort needed for working...

  14. Influence of NiO concentration on structural, dielectric and magnetic properties of core/shell CuFe{sub 2}O{sub 4}/NiO nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Kashif [Department of Physics, International Islamic University, Islamabad (Pakistan); Iqbal, Javed, E-mail: javed.saggu@qau.edu.pk [Laboratory of Nanoscience and Technology (LNT), Department of Physics, Quaid-i-Azam University, Islamabad (Pakistan); Jan, Tariq [Department of Physics, University of Lahore, Sargodha Campus, Sargodha (Pakistan); Ahmad, Ishaq [Experimental Physics Labs, National Center for Physics, Islamabad (Pakistan); Wan, Dongyun [School of Materials Science and Engineering, Shanghai University, Shanghai 200444 (China); Ahmad, Ijaz [Department of Chemistry, Allama Iqbal Open University, Islamabad (Pakistan)

    2017-07-01

    Nanocomposites of (1-x)CuFe{sub 2}O{sub 4}/xNiO (x = 10% to 50 wt %) have been synthesized utilizing a chemical co-precipitation method. In order to obtain the required phase, the samples have been annealed at 600 °C for 6 h. The x-ray Diffraction (XRD) technique has been used for the crystallographic structure analysis which not only confirms the coexistent of both copper ferrite (CuFe{sub 2}O{sub 4}) and nickel oxide (NiO) phases in all samples but also verifies the absence of any impurity phases. The average crystallite size as estimated via XRD patterns show that the average size lies in the range of 22–36 nm which has also been confirmed by TEM. The FTIR absorbance spectra also show the characteristic vibration modes of cation at tetrahedral and octahedral sites. The electrical properties like A.C. conductivity, impedance, Dielectric constant, and Tangent loss has been measured by LCR meter. The results show that with the increase in NiO concentration, electrical conductivity increases for all concentration while dielectric constant decreases up to 30% NiO wt% and increases with further addition of NiO. The real and imaginary parts of impedance depict same dispersion i.e the impedance decreases at higher frequency due to increase in conductivity. Moreover the magnetic characterizations performed by VSM, reveal that the hysteresis loops exhibit normal behavior of ferromagnetic/ferrimagnetic materials for all compositions but the coercivity (H{sub c}), and saturation magnetization (M{sub s}) decreases with the increase in NiO contents that transform the material in to soft magnetic. - Highlights: • This novel core/shell nanocomposite synthesized by a facile wet chemical route. • The decrease in coercivity with NiO contents is due to pinning of moments at surface. • Increase in NiO contents makes CuFe{sub 2}O{sub 4} a high dielectric loss material. • The antiferromagnetic nature of NiO shift CuFe{sub 2}O{sub 4} toward a soft magnetic material.

  15. Future Seismic Constraints on Mercury's Core Composition

    Science.gov (United States)

    Knibbe, J. S.; Luginbhuel, S. M.; Rivoldini, A.; Kono, Y.; Van Hoolst, T.; van Westrenen, W.

    2018-05-01

    The composition of Mercury's large core is strongly linked to the planet's origin and magnetic field generation. We present P-wave velocity measurements for liquid Fe-Si and Fe-S metals. A future seismic mission can constrain the core composition.

  16. Magnetic flux concentration methods for magnetic energy harvesting module

    Directory of Open Access Journals (Sweden)

    Wakiwaka Hiroyuki

    2013-01-01

    Full Text Available This paper presents magnetic flux concentration methods for magnetic energy harvesting module. The purpose of this study is to harvest 1 mW energy with a Brooks coil 2 cm in diameter from environmental magnetic field at 60 Hz. Because the harvesting power is proportional to the square of the magnetic flux density, we consider the use of a magnetic flux concentration coil and a magnetic core. The magnetic flux concentration coil consists of an air­core Brooks coil and a resonant capacitor. When a uniform magnetic field crossed the coil, the magnetic flux distribution around the coil was changed. It is found that the magnetic field in an area is concentrated larger than 20 times compared with the uniform magnetic field. Compared with the air­core coil, our designed magnetic core makes the harvested energy ten­fold. According to ICNIRP2010 guideline, the acceptable level of magnetic field is 0.2 mT in the frequency range between 25 Hz and 400 Hz. Without the two magnetic flux concentration methods, the corresponding energy is limited to 1 µW. In contrast, our experimental results successfully demonstrate energy harvesting of 1 mW from a magnetic field of 0.03 mT at 60 Hz.

  17. Conventional magnets. Pt. 1

    International Nuclear Information System (INIS)

    Marks, N.

    1994-01-01

    The design and construction of conventional, steel-cored, direct-current magnets are discussed. Laplace's equation and the associated cylindrical harmonic solutions in two dimensions are established. The equations are used to define the ideal pole shapes and required excitation for dipole, quadrupole and sextupole magnets. Standard magnet geometries are then considered and criteria determining the coil design are presented. The use of codes for predicting flux density distributions and the iterative techniques used for pole face design are then discussed. This includes a description of the use of two-dimensional codes to generate suitable magnet end geometries. Finally, standard constructional techniques for cores and coils are described. (orig.)

  18. AGS superconducting bending magnets

    International Nuclear Information System (INIS)

    Robins, K.E.; Sampson, W.B.; McInturff, A.D.; Dahl, P.F.; Abbatiello, F.; Aggus, J.; Bamberger, J.; Brown, D.; Damm, R.; Kassner, D.; Lasky, C.; Schlafke, A.

    1976-01-01

    Four large aperture superconducting bending magnets are being built for use in the experimental beams at the AGS. Each of these magnets is 2.5 m long and has a room temperature aperture of 20 cm. The magnets are similar in design to the dipoles being developed for ISABELLE and employ a low temperature iron core. Results are presented on the ''training'' behavior of the magnets and a comparison will be made with the smaller aperture versions of this design. The magnet field measurements include end fields and leakage fields as well as the harmonic components of the straight section of the magnet

  19. Modelling characteristics of ferromagnetic cores with the influence of temperature

    International Nuclear Information System (INIS)

    Górecki, K; Rogalska, M; Zarȩbski, J; Detka, K

    2014-01-01

    The paper is devoted to modelling characteristics of ferromagnetic cores with the use of SPICE software. Some disadvantages of the selected literature models of such cores are discussed. A modified model of ferromagnetic cores taking into account the influence of temperature on the magnetizing characteristics and the core losses is proposed. The form of the elaborated model is presented and discussed. The correctness of this model is verified by comparing the calculated and the measured characteristics of the selected ferromagnetic cores.

  20. Nanocrystalline magnetic alloys and ceramics

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    exchange anisotropy in magnetic core-shell structures where the core and the shell com- prise of a ferromagnetic metal and antiferromagnetic oxide respectively (Prados et al. 1999). A number of techniques both physical and chemical have been developed to prepare nanosized magnetic particles. In this paper, the various ...

  1. Nonlinear Model of Tape Wound Core Transformers

    Directory of Open Access Journals (Sweden)

    A. Vahedi

    2015-03-01

    Full Text Available Recently, tape wound cores due to their excellent magnetic properties, are widely used in different types of transformers. Performance prediction of these transformers needs an accurate model with ability to determine flux distribution within the core and magnetic loss. Spiral structure of tape wound cores affects the flux distribution and always cause complication of analysis. In this paper, a model based on reluctance networks method is presented for analysis of magnetic flux in wound cores. Using this model, distribution of longitudinal and transverse fluxes within the core can be determined. To consider the nonlinearity of the core, a dynamic hysteresis model is included in the presented model. Having flux density in different points of the core, magnetic losses can be calculated. To evaluate the validity of the model, results are compared with 2-D FEM simulations. In addition, a transformer designed for series-resonant converter and simulation results are compared with experimental measurements. Comparisons show accuracy of the model besides simplicity and fast convergence

  2. Computational design and fabrication of core-shell magnetic molecularly imprinted polymer for dispersive micro-solid-phase extraction coupled with high-performance liquid chromatography for the determination of rhodamine 6G.

    Science.gov (United States)

    Xie, Jin; Xie, Jie; Deng, Jian; Fang, Xiangfang; Zhao, Haiqing; Qian, Duo; Wang, Hongjuan

    2016-06-01

    A novel core-shell magnetic nano-adsorbent with surface molecularly imprinted polymer coating was fabricated and then applied to dispersive micro-solid-phase extraction followed by determination of rhodamine 6G using high-performance liquid chromatography. The molecularly imprinted polymer coating was prepared by copolymerization of dopamine and m-aminophenylboronic acid (functional monomers), in the presence of rhodamine 6G (template). The selection of the suitable functional monomers was based on the interaction between different monomers and the template using the density functional theory. The ratios of the monomers to template were further optimized by an OA9 (3(4) ) orthogonal array design. The binding performances of the adsorbent were evaluated by static, kinetic, and selective adsorption experiments. The results reveal that the adsorbent possesses remarkable affinity and binding specificity for rhodamine 6G because of the enhanced Lewis acid-base interaction between the B(Ш) embedded in the imprinted cavities and the template. The nano-adsorbent was successfully applied to dispersive micro-solid-phase extraction coupled to high-performance liquid chromatography for the trace determination of rhodamine 6G in samples with a detection limit of 2.7 nmol/L. Spiked recoveries ranged from 93.0-99.1, 89.5-92.7, and 86.9-105% in river water, matrimony vine and paprika samples, respectively, with relative standard deviations of less than 4.3%. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Superconducting magnet and fabrication method

    Science.gov (United States)

    Israelsson, Ulf E. (Inventor); Strayer, Donald M. (Inventor)

    1994-01-01

    A method of trapping a field in a block of superconductor material, includes providing (i) a block of material defining a bore, (ii) a high permeability core within the bore that defines a low reluctance path through the bore, (iii) a high permeability external structure on the exterior of the block of material that defines a low reluctance path between opposite ends of the core, and (iv) an electromagnet configured to apply a magnetic field around the high permeability core. The method proceeds by energizing the electromagnet to produce an applied magnetic field around the high permeability core, cooling the block of material sufficiently to render the block of material superconducting, de-energizing the electromagnet to result in a trapped magnetic field, and at least partially removing the low reluctance path defined by the core and the external structure in order to increase the magnetic flux density of the trapped magnetic field.

  4. Inner Core Rotation from Geomagnetic Westward Drift and a Stationary Spherical Vortex in Earth's Core

    Science.gov (United States)

    Voorhies, C. V.

    1999-01-01

    The idea that geomagnetic westward drift indicates convective leveling of the planetary momentum gradient within Earth's core is pursued in search of a differentially rotating mean state, upon which various oscillations and secular effects might be superimposed. The desired state conforms to roughly spherical boundary conditions, minimizes dissipative interference with convective cooling in the bulk of the core, yet may aide core cooling by depositing heat in the uppermost core and lower mantle. The variational calculus of stationary dissipation applied to a spherical vortex within the core yields an interesting differential rotation profile akin to spherical Couette flow bounded by thin Hartmann layers. Four boundary conditions are required. To concentrate shear induced dissipation near the core-mantle boundary, these are taken to be: (i) no-slip at the core-mantle interface; (ii) geomagnetically estimated bulk westward flow at the base of the core-mantle boundary layer; (iii) no-slip at the inner-outer core interface; and, to describe magnetic locking of the inner core to the deep outer core, (iv) hydrodynamically stress-free at the inner-outer core boundary. By boldly assuming the axial core angular momentum anomaly to be zero, the super-rotation of the inner core is calculated to be at most 1.5 degrees per year.

  5. Iron snow in the Martian core?

    Science.gov (United States)

    Davies, Christopher J.; Pommier, Anne

    2018-01-01

    The decline of Mars' global magnetic field some 3.8-4.1 billion years ago is thought to reflect the demise of the dynamo that operated in its liquid core. The dynamo was probably powered by planetary cooling and so its termination is intimately tied to the thermochemical evolution and present-day physical state of the Martian core. Bottom-up growth of a solid inner core, the crystallization regime for Earth's core, has been found to produce a long-lived dynamo leading to the suggestion that the Martian core remains entirely liquid to this day. Motivated by the experimentally-determined increase in the Fe-S liquidus temperature with decreasing pressure at Martian core conditions, we investigate whether Mars' core could crystallize from the top down. We focus on the "iron snow" regime, where newly-formed solid consists of pure Fe and is therefore heavier than the liquid. We derive global energy and entropy equations that describe the long-timescale thermal and magnetic history of the core from a general theory for two-phase, two-component liquid mixtures, assuming that the snow zone is in phase equilibrium and that all solid falls out of the layer and remelts at each timestep. Formation of snow zones occurs for a wide range of interior and thermal properties and depends critically on the initial sulfur concentration, ξ0. Release of gravitational energy and latent heat during growth of the snow zone do not generate sufficient entropy to restart the dynamo unless the snow zone occupies at least 400 km of the core. Snow zones can be 1.5-2 Gyrs old, though thermal stratification of the uppermost core, not included in our model, likely delays onset. Models that match the available magnetic and geodetic constraints have ξ0 ≈ 10% and snow zones that occupy approximately the top 100 km of the present-day Martian core.

  6. Side core lifter

    Energy Technology Data Exchange (ETDEWEB)

    Edelman, Ya A

    1982-01-01

    A side core lifter is proposed which contains a housing with guide slits and a removable core lifter with side projections on the support section connected to the core receiver. In order to preserve the structure of the rock in the core sample by means of guaranteeing rectilinear movement of the core lifter in the rock, the support and core receiver sections are hinged. The device is equipped with a spring for angular shift in the core-reception part.

  7. Grain alignment in starless cores

    International Nuclear Information System (INIS)

    Jones, T. J.; Bagley, M.; Krejny, M.; Andersson, B.-G.; Bastien, P.

    2015-01-01

    We present near-IR polarimetry data of background stars shining through a selection of starless cores taken in the K band, probing visual extinctions up to A V ∼48. We find that P K /τ K continues to decline with increasing A V with a power law slope of roughly −0.5. Examination of published submillimeter (submm) polarimetry of starless cores suggests that by A V ≳20 the slope for P versus τ becomes ∼−1, indicating no grain alignment at greater optical depths. Combining these two data sets, we find good evidence that, in the absence of a central illuminating source, the dust grains in dense molecular cloud cores with no internal radiation source cease to become aligned with the local magnetic field at optical depths greater than A V ∼20. A simple model relating the alignment efficiency to the optical depth into the cloud reproduces the observations well.

  8. Facile synthesis of new nano sorbent for magnetic solid-phase extraction by self assembling of bis-(2,4,4-trimethyl pentyl)-dithiophosphinic acid on Fe3O4-Ag core-shell nanoparticles: Characterization and application

    International Nuclear Information System (INIS)

    Tahmasebi, Elham; Yamini, Yadollah

    2012-01-01

    Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe 3 O 4 -Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: ► A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. ► Silver was coated on Fe 3 O 4 nanoparticles (MNPs) by reduction of AgNO 3 with NaBH 4 . ► Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. ► Size, morphology, composition and properties of the nanoparticles were characterized. ► Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe 3 O 4 nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 °C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 μL of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05–100 μg L −1 (R 2 > 0.9980) and the LODs (S/N = 3) were obtained in the range of 0.02–0.10 μg L −1 . Relative standard deviations (RSDs) for intra- and inter-day precision were 2.6–4.2% and 3.6–8

  9. Classification of Magnetic Nanoparticle Systems

    DEFF Research Database (Denmark)

    Bogren, Sara; Fornara, Andrea; Ludwig, Frank

    2015-01-01

    and the size parameters are determined from electron microscopy and dynamic light scattering. Using these methods, we also show that the nanocrystal size and particle morphology determines the dynamic magnetic properties for both single- and multi-core particles. The presented results are obtained from...... the four year EU NMP FP7 project, NanoMag, which is focused on standardization of analysis methods for magnetic nanoparticles.......This study presents classification of different magnetic single- and multi-core particle systems using their measured dynamic magnetic properties together with their nanocrystal and particle sizes. The dynamic magnetic properties are measured with AC (dynamical) susceptometry and magnetorelaxometry...

  10. Advantages of iron core in a tokamak

    International Nuclear Information System (INIS)

    Bettis, E.S.; Ballou, J.K.; Becraft, W.R.; Peng, Y.K.M.; Watts, H.L.

    1977-01-01

    A quantitative comparison of the iron core vs air core concepts was carried out on a preliminary basis by using a representative tokamak reactor design with the following self-consistent reference parameters. In the area of plasma engineering, poloidal field and MHD equilibrium considerations with an unsaturated iron core is discussed. The question of proper poloidal field coils to maintain D-shaped plasmas of relatively high anti β (7%) with a saturated iron core is also discussed. Estimates of the required iron core size, volt seconds, magnetic flux and its influence on force loading on the superconducting toroidal field coils are shown. Conceptual designs of the mechanical structure of an iron core device are presented. Favorable impacts on the OH power supply cost and complexity are indicated

  11. Behaviour of magnetic superconductors in a magnetic field

    International Nuclear Information System (INIS)

    Buzdin, A.I.

    1984-01-01

    The behaviour of magnetic superconductors with close ferromagnetic and superconducting transition temperatures in a magnetic field is considered. It is shown that on lowering of the temperature the superconducting transition changes from a second to first order transition. The respective critical fields and dependence of the magnetization on the magnetic field and temperature are found. The magnetization discontinuity in the vortex core in magnetic superconductors is noted. Due to this property and the relatively large scattering cross section, magnetic superconductors are convenient for studying the superconducting vortex lattice by neutron diffraction techniques

  12. Early Dynamics of the Moon's Core

    Science.gov (United States)

    Cuk, Matija; Hamilton, Douglas; Stewart, Sarah T.

    2018-04-01

    The Moon has a small molten iron core (Williams et al. 2006). Remanent magnetization in lunar rocks likely derives from a past lunar dynamo (Wieczorek 2018 and references therein), which may have been powered by differential precession between the mantle and the core. The rotations of the lunar mantle and core were largely decoupled for much of lunar history, with a large mutual offset during the Cassini State Transition (Meyer and Wisdom, 2011). It is likely that the past work underestimated lunar obliquities, and therefore core offsets, during early lunar history (Cuk et al. 2016). Here we investigate the dynamics of the lunar core and mantle using a Lie-Poisson numerical integrator (Touma and Wisdom 2001) which includes interactions between triaxial core and mantle, as well as all gravitational and tidal effects included in the model of Cuk et al. (2016). Since we assume a rigid triaxial mantle, this model is applicable to the Moon only once it has acquired its current shape, which probably happened before the Moon reached 25 Earth radii. While some details of the core dynamics depend on our assumptions about the shape of the lunar core-mantle boundary, we can report some robust preliminary findings. The presence of the core does not change significantly the evolutionary scenario of Cuk et al. (2016). The core and mantle are indeed decoupled, with the core having a much smaller obliquity to the ecliptic than the mantle for almost all of the lunar history. The core was largely in an equivalent of Cassini State 2, with the vernal equinoxes (wrt the ecliptic) of the core and the mantle being anti-aligned. The core-mantle spin axis offset has been very large during the Moon's first billion years (this is true both in canonical and high-inclination tidal evolution), causing the lunar core to be sub-synchronous. If the ancient lunar magnetic dipole was rotating around the core axis that was inclined to the Moon's spin axis, then the magnetic poles would move across

  13. Magnetically responsive calcium carbonate microcrystals.

    Science.gov (United States)

    Fakhrullin, Rawil F; Bikmullin, Aidar G; Nurgaliev, Danis K

    2009-09-01

    Here we report the fabrication of magnetically responsive calcium carbonate microcrystals produced by coprecipitation of calcium carbonate in the presence of citrate-stabilized iron oxide nanoparticles. We demonstrate that the calcite microcrystals obtained possess superparamagnetic properties due to incorporated magnetite nanoparticles and can be manipulated by an external magnetic field. The microcrystals doped with magnetic nanoparticles were utilized as templates for the fabrication of hollow polyelectrolyte microcapsules, which retain the magnetic properties of the sacrificial cores and might be spatially manipulated using a permanent magnet, thus providing the magnetic-field-facilitated delivery and separation of materials templated on magnetically responsive calcite microcrystals.

  14. Synthesis, surface modification/decoration of luminescent–magnetic core/shell nanomaterials, based on the lanthanide doped fluorides (Fe{sub 3}O{sub 4}/SiO{sub 2}/NH{sub 2}/PAA/LnF{sub 3})

    Energy Technology Data Exchange (ETDEWEB)

    Runowski, Marcin; Lis, Stefan, E-mail: blis@amu.edu.pl

    2016-02-15

    The synthesized magnetite nanoparticles (10–15 nm) were successfully coated with amine modified silica nanoshell, which led to the formation of core/shell type nanostructures (30–50 nm). The as-prepared nanoparticles were surface modified with polyacrylic acid (PAA) via electrostatic interactions of –NH{sub 2} and –COOH groups. Afterwards, the surface PAA molecules acted as complexing agents of the introduced lanthanide (Ln{sup 3+}) ions. Subsequently, the as-prepared nanostructures were surface decorated with luminescent LnF{sub 3} nanoparticles, forming Eu{sup 3+} or Tb{sup 3+} doped Fe{sub 3}O{sub 4}/SiO{sub 2}/NH{sub 2}/PAA/LnF{sub 3} nanomaterials (50–100 nm). The obtained luminescent–magnetic products exhibited simultaneously bright red or green emission under UV lamp irradiation (λ{sub ex}=254 nm), and a response for the applied magnetic field (strong magnet attracts the colloidal particles, dispersed in aqueous medium). After the synthesis, properties of the nanomaterials were investigated by powder X-ray diffraction (XRD) technique, transmission electron microscopy (TEM), infrared spectroscopy (IR) and spectrofluorometry (analysis of excitation/emission spectra and luminescence decay curves). Such advanced nanomaterials can be potentially used in multimodal imaging, targeted therapies and as multifunctional contrast agents, novel luminescent–magnetic tracers, protection of documents, etc. - Highlights: • Luminescent–magnetic nanomaterials Fe{sub 3}O{sub 4}/SiO{sub 2}/NH{sub 2}/PAA/LnF{sub 3} were synthesized. • Core/shell nanostructures were obtained by surface modification of nanoparticles. • Luminescent lanthanide fluoride nanoparticles doped with Eu{sup 3+} and Tb{sup 3+} ions. • Multifunctional core/shell nanostructures exhibited red or green emission. • Nanomaterials formed stable aqueous colloids.

  15. Intrinsic magnetic torque at low magnetic induction

    International Nuclear Information System (INIS)

    Doria, M.M.; Oliveira, I.G. de.

    1993-01-01

    Using anisotropic London theory the intrinsic magnetic torque for extreme type II uniaxial superconductors for any value of the magnetic induction is obtained. It is considered the vortex lines straight and take into account the contribution of the supercurrents flowing inside the vortex core within the London theory. It is shown that the interline and intra line free energies give opposite torque contributions, the first drives the magnetic induction parallel to the superconductor's axis of symmetry and the second orthogonal to it. At high magnetic induction torque expression obtained generalizes V. Kogan's formula since it has no free parameters other than the anisotropy γ = m 1 /m 3 and the Ginzburg-Landau parameter κ. At low magnetic induction it is proposed a way to observe vortex chains effects in the total torque based on the fact that London theory is linear and the energy to make a single vortex line in space is independent of the magnetic induction. (author)

  16. Electromagnetically driven westward drift and inner-core superrotation in Earth's core.

    Science.gov (United States)

    Livermore, Philip W; Hollerbach, Rainer; Jackson, Andrew

    2013-10-01

    A 3D numerical model of the earth's core with a viscosity two orders of magnitude lower than the state of the art suggests a link between the observed westward drift of the magnetic field and superrotation of the inner core. In our model, the axial electromagnetic torque has a dominant influence only at the surface and in the deepest reaches of the core, where it respectively drives a broad westward flow rising to an axisymmetric equatorial jet and imparts an eastward-directed torque on the solid inner core. Subtle changes in the structure of the internal magnetic field may alter not just the magnitude but the direction of these torques. This not only suggests that the quasi-oscillatory nature of inner-core superrotation [Tkalčić H, Young M, Bodin T, Ngo S, Sambridge M (2013) The shuffling rotation of the earth's inner core revealed by earthquake doublets. Nat Geosci 6:497-502.] may be driven by decadal changes in the magnetic field, but further that historical periods in which the field exhibited eastward drift were contemporaneous with a westward inner-core rotation. The model further indicates a strong internal shear layer on the tangent cylinder that may be a source of torsional waves inside the core.

  17. Electromagnetically driven westward drift and inner-core superrotation in Earth’s core

    Science.gov (United States)

    Livermore, Philip W.; Hollerbach, Rainer; Jackson, Andrew

    2013-01-01

    A 3D numerical model of the earth’s core with a viscosity two orders of magnitude lower than the state of the art suggests a link between the observed westward drift of the magnetic field and superrotation of the inner core. In our model, the axial electromagnetic torque has a dominant influence only at the surface and in the deepest reaches of the core, where it respectively drives a broad westward flow rising to an axisymmetric equatorial jet and imparts an eastward-directed torque on the solid inner core. Subtle changes in the structure of the internal magnetic field may alter not just the magnitude but the direction of these torques. This not only suggests that the quasi-oscillatory nature of inner-core superrotation [Tkalčić H, Young M, Bodin T, Ngo S, Sambridge M (2013) The shuffling rotation of the earth’s inner core revealed by earthquake doublets. Nat Geosci 6:497–502.] may be driven by decadal changes in the magnetic field, but further that historical periods in which the field exhibited eastward drift were contemporaneous with a westward inner-core rotation. The model further indicates a strong internal shear layer on the tangent cylinder that may be a source of torsional waves inside the core. PMID:24043841

  18. Core reset system design for linear induction accelerator

    International Nuclear Information System (INIS)

    Durga Praveen Kumar, D.; Mitra, S.; Sharma, Archana; Nagesh, K.V.; Chakravarthy, D.P.

    2006-01-01

    A repetitive pulsed power system based Linear Induction Accelerator (LIA-200) is being developed at BARC to get an electron beam of 200keV, 5kA, 50ns, 10-100 Hz. Amorphous core is the heart of these accelerators. It serves various functions in different subsystems viz. pulse power modulator, pulse transformer, magnetic switches and induction cavities. One of the factors that make the magnetic components compact is utilization of the total flux swing available in the core. In the present system, magnetic switches, pulse transformers, and induction cavity are designed to avail the full flux swing available in the core. For achieving this objective, flux density in the core has to be kept at the reverse saturation, before the main pulse is applied. The electrical circuit which makes it possible is called the core reset system. In this paper the details of core reset system designed for LIA-200 are described. (author)

  19. Chelating capture and magnetic removal of non-magnetic heavy metal substances from soil

    OpenAIRE

    Liren Fan; Jiqing Song; Wenbo Bai; Shengping Wang; Ming Zeng; Xiaoming Li; Yang Zhou; Haifeng Li; Haiwei Lu

    2016-01-01

    A soil remediation method based on