7 CFR 4285.2 - Cooperative agreement purposes.

Science.gov (United States)

2010-01-01

... agency to: (a) Conduct marketing research related to agricultural cooperatives. (b) Assist other organizations in conducting marketing research related to agricultural cooperatives. ... RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE COOPERATIVE AGREEMENTS Federal-State Research on...

China and CERN renew their Co-operation Agreement

CERN Multimedia

2004-01-01

Dr. Liu Yanhua, Chinese Vice Minister of Science and Technology, and Dr. Robert Aymar, Director-General of CERN, sign a new Co-operation Agreement between the Government of the People's Republic of China and CERN. During his visit to CERN on 17 February, Liu Yanhua, Vice Minister of Science and Technology of the People's Republic of China, signed a new Co-operation Agreement with the Laboratory. The Agreement, which is valid for a period of five years and renewable, lays down the framework for the development of scientific and technological co-operation between CERN and China. This includes China's participation, as a non-Member State, in CERN's research projects as well as its main programmes. Robert Aymar and Liu Yanhua underlined that this Agreement will provide an excellent framework for close co-operation on the LHC Programme and Grid and accelerator technologies. Scientific co-operation between China and CERN is nothing new, as Chinese physicists already took part in the LEP experiments. Today, CERN's C...

Outline of new Japan-U.S. atomic energy cooperation agreement

International Nuclear Information System (INIS)

Oki, Naotaka

1988-01-01

The former agreement was revised into the new Agreement between the Japanese Government and the U.S. Government for Cooperation Relating to Peaceful Utilization of Atomic Energy (simply referred as the new Japan-U.S. Atomic Energy Cooperation Agreement). The Implementation Convention between the Japanese Government and the U.S. Government Based on Article 11 of the Agreement between the Japanese Government and the U.S. Government for Cooperation Relating to Peaceful Utilization of Atomic Energy was also concluded. The new Agreement is intended to serve for long-term stabilization of the cooperative relationship for atomic energy between Japan and the U.S., strengthening of nuclear non-proliferation efforts, and improvement in the parity, regulation rights and bilateralism between the two countries. The Agreement states that the countries should cooperate in exchanging experts and information and supplying radioactive substance, that the specified nuclear substances can be stored, reprocessed, etc. after an agreement is made between the governments, that proper protection activities should be performed for the specified substances, that the cooperation under the Agreement is limited to peaceful purposes, etc. (Nogami, K.)

Cooperative monitoring of regional security agreements

Energy Technology Data Exchange (ETDEWEB)

Pregenzer, A.L.; Vannoni, M.; Biringer, K.L. [Sandia National Labs., Albuquerque, NM (United States). Nonproliferation and Arms Control Analysis Dept.

1996-11-01

This paper argues that cooperative monitoring plays a critical role in the implementation of regional security agreements and confidence building measures. A framework for developing cooperative monitoring options is proposed and several possibilities for relating bilateral and regional monitoring systems to international monitoring systems are discussed. Three bilateral or regional agreements are analyzed briefly to illustrate different possibilities. These examples illustrate that the relationship of regional or bilateral arms control or security agreements to international agreements depends on a number of factors: the overlap of provisions between regional and international agreements; the degree of interest in a regional agreement among the international community; efficiency in implementing the agreement; and numerous political considerations. Given the importance of regional security to the international community, regions should be encouraged to develop their own infrastructure for implementing regional arms control and other security agreements. A regional infrastructure need not preclude participation in an international regime. On the contrary, establishing regional institutions for arms control and nonproliferation could result in more proactive participation of regional parties in developing solutions for regional and international problems, thereby strengthening existing and future international regimes. Possible first steps for strengthening regional infrastructures are identified and potential technical requirements are discussed.

Pesticide Worker Safety Cooperative Agreements

Science.gov (United States)

The worker safety program cooperative agreements fund projects to educate pesticide applicators, handlers, and farmworkers on working safely with, and around, pesticides. Read about pesticide related grant opportunities and reports from previous grants.

FcγRII-binding Centyrins mediate agonism and antibody-dependent cellular phagocytosis when fused to an anti-OX40 antibody.

Science.gov (United States)

Zhang, Di; Whitaker, Brian; Derebe, Mehabaw G; Chiu, Mark L

2018-04-01

Immunostimulatory antibodies against the tumor necrosis factor receptors (TNFR) are emerging as promising cancer immunotherapies. The agonism activity of such antibodies depends on crosslinking to Fc gamma RIIB receptor (FcγRIIB) to enable the antibody multimerization that drives TNFR activation. Previously, Fc engineering was used to enhance the binding of such antibodies to Fcγ receptors. Here, we report the identification of Centyrins as alternative scaffold proteins with binding affinities to homologous FcγRIIB and FcγRIIA, but not to other types of Fcγ receptors. One Centyrin, S29, was engineered at distinct positions of an anti-OX40 SF2 antibody to generate bispecific and tetravalent molecules named as mAbtyrins. Regardless of the position of S29 on the SF2 antibody, SF2-S29 mAbtyrins could bind FcγRIIB and FcγRIIA specifically while maintaining binding to OX40 receptors. In a NFκB reporter assay, attachment of S29 Centyrin molecules at the C-termini, but not the N-termini, resulted in SF2 antibodies with increased agonism owing to FcγRIIB crosslinking. The mAbtyrins also showed agonism in T-cell activation assays with immobilized FcγRIIB and FcγRIIA, but this activity was confined to mAbtyrins with S29 specifically at the C-termini of antibody heavy chains. Furthermore, regardless of the position of the molecule, S29 Centyrin could equip an otherwise Fc-silent antibody with antibody-dependent cellular phagocytosis activity without affecting the antibody's intrinsic antibody-dependent cell-meditated cytotoxicity and complement-dependent cytotoxicity. In summary, the appropriate adoption FcγRII-binding Centyrins as functional modules represents a novel strategy to engineer therapeutic antibodies with improved functionalities.

Comparisons of the Nottingham Health Profile and the SF-36 health survey for the assessment of quality of life in individuals with chronic stroke Comparação do perfil de saúde de Nottingham e SF-36 na avaliação da qualidade de vida de indivíduos com acidente vascular encefálico crônico

Directory of Open Access Journals (Sweden)

Dinalva L. Cabral

2012-08-01

Full Text Available BACKGROUND: Appropriate instruments for the assessment of health-related quality of life (HRQOL domains are useful for planning therapeutic interventions for individuals with stroke. The generic quality of life (QOL instruments, Short Form Health Survey-36 (SF-36 and Nottingham Health Profile (NHP, have been frequently employed in the Brazilian literature. However, the literature is still scarce regarding their psychometric properties when applied to stroke individuals. OBJECTIVES: To compare the Brazilian versions of the SF-36 and the NHP to verify which had better psychometric properties for the assessment of HRQOL in 120 individuals with chronic stroke. METHOD: Spearman correlation coefficients were calculated to examine the comparable domains and total scores of the SF-36 and the NPH; Cronbach's alpha coefficients, to evaluate internal consistency; intra-class correlation coefficients, to assess reliability; and Bland-Altman plots, to assess the levels of agreement, with a significance level of 5%. RESULTS: Significant positive associations were observed between the common domains and the total scores of the SF-36 and the NPH. Ceiling effects were more frequent for the NPH. The total scores of both instruments achieved adequate reliability levels, and the agreement levels were within the normal limits in 95% of the cases. CONCLUSIONS: The SF-36 and the NPH were shown to measure similar constructs and proved to be useful measures for the assessment of QOL of chronic stroke subjects. However, the SF-36 yielded better results and appeared to be more appropriate.CONTEXTUALIZAÇÃO: Instrumentos adequados para avaliar os vários domínios da qualidade de vida (QV relacionada à saúde (QVRS constituem uma importante abordagem para o planejamento terapêutico e, assim, melhor assistir os indivíduos acometidos pelo acidente vascular encefálico (AVE. Na literatura brasileira, os instrumentos genéricos Formulário Abreviado de Avaliação de Sa

US-India agreement for peaceful nuclear cooperation

International Nuclear Information System (INIS)

2008-01-01

The United States and India acheived a historic agreement for strategic partnership after the completion of negotiations on the bilateral agreement for peaceful nuclear cooperation, also known as the agreement of 123. This agreement regulates the civilian nuclear trade between the two countries and opens the door wide to U.S. and Indian companies for a partnership in every other country in the civil nuclear industry. This agreement has opened the door to complete the remaining steps for the the widest American Indian cooperation in the field of civil uses of atomic energy. Critics to the agreement within the United States say that the agreement reflected serious consequences on the ability of the United States to force other countries to comply with the prevention of nuclear proliferation. The global criticism focused on that the agreement strikes at the heart of the Treaty on the Non-Proliferation of Nuclear Weapons, and is considered a dangerous precedent to break the laws of the International Tribunal, and especially the laws and rules of the International Group of Suppliers, which includes 45 countries. The International Atomic Energy Agency (IAEA) says that the agreement is an important step towards meeting India's growing energy needs, especially nuclear technology which is the engine of development. Immediately after the completion of the United States and India for their bilateral agreement for nuclear cooperation, Israel announced that it was seeking U.S. help in the establishment of a power reactor while pressing the direction of tightening control over Iran's nuclear program while some Arab countries announced their desire to have nuclear reactors for electricity generation purposes.

Co-operation Agreement. The Text of the Agreement of 25 May 1998 between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials; Acuerdo de Cooperacion. Texto del Acuerdo de 25 de Mayo de 1998 entre el Organismo Internacional de Energia Atomica y la Agencia Brasileno-Argentina de Contabilidad y Control de Materiales Nucleares

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-06-30

The text of the Co-operation Agreement between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials is reproduced herein for the information of all Members. The Agreement entered into force on 25 May 1998, pursuant to Article 8 [Spanish] El texto del Acuerdo de Cooperacion entre el Organismo Internacional de Energia Atomica y la Agencia Brasileno-Argentina de Contabilidad y Control de Materiales Nucleares se reproduce en el presente documento para informacion de todos los Miembros. El Acuerdo entro en vigor el 25 de mayo de 1998 en conformidad con lo dispuesto en el articulo 8.

7 CFR 4285.81 - Cooperative agreement awards.

Science.gov (United States)

2010-01-01

... Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE COOPERATIVE AGREEMENTS Federal-State Research on... the methods identified in approved application and budget, the regulations of this part, the terms and...

Avaliação retrospectiva por meio do questionário SF-36 de pacientes submetidos à estabilização dinâmica pedicular para o tratamento de doenças degenerativas lombares Evaluación retrospectiva empleando el cuestionario SF-36 en pacientes sometidos a estabilización dinámica pedicular para el tratamiento de la enfermedad degenerativa lumbar Retrospective evaluation by means of SF-36 questionnaires of patients submitted to pedicular dynamic stabilization for degenerative lumbar diseases treatment

Directory of Open Access Journals (Sweden)

Leonardo Fonseca Rodrigues

2010-06-01

Full Text Available INTRODUÇÃO: a estabilização dinâmica pedicular tem sido utilizada desde os anos 1990 para o tratamento da doença lombar degenerativa como uma alternativa aos métodos de fusão. Devido às suas características de não-fusão, estes implantes tendem a reduzir a carga nos discos intervertebrais adjacentes e na coluna posterior, com o objetivo de não prejudicar a biomecânica da coluna, diminuindo assim a chance de degeneração do disco adjacente. OBJETIVO: O objetivo deste estudo retrospectivo foi avaliar, por meio do questionário SF-36, os resultados dos pacientes que se submeteram à estabilização dinâmica pedicular para o tratamento da patologia degenerativa lombar. MÉTODOS: foram avaliados 31 pacientes que se submeteram à estabilização dinâmica pedicular, de abril de 2004 a junho de 2008, por meio do questionário de qualidade de vida SF-36. RESULTADOS: o SF-36 mostrou um índice de melhora na qualidade de vida desses pacientes durante o período de acompanhamento, variando de 33,15% no pré-operatório, para 75,99% no pós-operatório, correspondente a uma diferença de 129% no resultado final, que é significativo estatisticamente de acordo com o teste t de student (pINTRODUCCIÓN: la estabilización dinámica pedicular ha sido empleada desde los años 1990 en el tratamiento de la enfermedad degenerativa lumbar y como una alternativa a los métodos de fusión. Debido a sus características de no requerir fusión, estos implantes tiendes a reducir la carga sobre los disco intervertebrales adyacentes y sobre la columna posterior, con el propósito de no afectar la biomecánica vertebral. Por lo tanto, disminuye la degeneración de discos adyacentes. OBJETIVO: esto estudio retrospectivo tiene la finalidad de evaluar los resultados obtenidos al emplear el cuestionario SF-36, en pacientes que han presentado estabilización dinámica pedicular durante el tratamiento de la patología degenerativa da columna lumbar. M�

Cooperative monitoring of regional security agreements

Energy Technology Data Exchange (ETDEWEB)

Pregenzer, A.L.; Vannoni, M.; Biringer, K.L.

1995-08-01

This paper argues that cooperative monitoring plays a critical role in the implementation of regional security agreements and confidence building measures. A framework for developing cooperative monitoring options is proposed and several possibilities for relating bilateral and regional monitoring systems to international monitoring systems are discussed. Three bilateral or regional agreements are analyzed briefly to illustrate different possibilities: (1) the demilitarization of the Sinai region between Israel and Egypt in the 1970s; (2) the 1991 quadripartite agreement for monitoring nuclear facilities among Brazil, Argentina, The Argentine-Brazilian Agency for Accounting and Control of Nuclear Materials and the International Atomic Energy Agency; and (3) a bilateral Open Skies agreement between Hungary and Romania in 1991. These examples illustrate that the relationship of regional or bilateral arms control or security agreements to international agreements depends on a number of factors: the overlap of provisions between regional and international agreements; the degree of interest in a regional agreement among the international community; efficiency in implementing the agreement; and numerous political considerations.Given the importance of regional security to the international community, regions should be encouraged to develop their own infrastructure for implementing regional arms control and other security agreements. A regional infrastructure need not preclude participation in an international regime. On the contrary, establishing regional institutions for arms control and nonproliferation could result in more proactive participation of regional parties in developing solutions for regional and international problems, thereby strengthening existing and future international regimes. Possible first steps for strengthening regional infrastructures are identified and potential technical requirements are discussed.

Corrosion rate of steel embedded in blended Portland and fluid catalytic cracking catalyst residue (FC3R cement mortars

Directory of Open Access Journals (Sweden)

Payá, J.

2008-12-01

Full Text Available This paper reports on a study of the corrosion levels in steel bars embedded in mortars made with a blend of Portland cement and (0-20% spent fluid catalytic cracking catalyst residue (FC3R, with a variable (0.3-0.7 water/binder (w/b ratio. The specimens were stored in the following conditions: relative humidity of 40, 80 or 100% and CO2 concentrations of 5 and 100%. The steel corrosion rate was measured with polarization resistance techniques. In the absence of aggressive agents, the steel was found to remain duly passivated in mortars with an FC3R content of up to 15% under all the conditions of relative humidity tested. The reinforcement corrosion level in mortars with a w/b ratio of 0.3 and 15% FC3R subjected to accelerated carbonation was similar to the level observed in the unblended Portland cement control mortar.En este trabajo se ha estudiado el nivel de corrosión de barras de acero embebidas en morteros de cemento Portland con relación agua/material cementante (a/mc variable (0,3-0,7, en los que parte del cemento (0-20% se sustituyó por catalizador de craqueo usado (FC3R. Las condiciones de conservación de las probetas elaboradas fueron las siguientes: distintas humedades relativas (40, 80 y 100% y dos concentraciones de CO2 (5 y 100%. La velocidad de corrosión de los aceros se midió mediante la técnica de resistencia de polarización. Se ha podido determinar que, bajo las distintas condiciones de humedad relativa y ausencia de agresivo, los aceros se mantuvieron correctamente pasivados en los morteros con contenidos de FC3R de hasta el 15%. El nivel de corrosión que presenta el refuerzo embebidos en morteros con sustitución de un 15% de cemento por FC3R y relación a/mc 0,3, al ser sometidos a un proceso de carbonatación acelerada, era muy similar al mostrado por el mortero patrón, sin FC3R.

New co-operation agreement between CERN and JINR

CERN Multimedia

CERN Bulletin

2010-01-01

CERN Director-General Rolf Heuer (left) and JINR Director Alexei Sissakian (right). On Thursday 28 January, CERN Director-General Rolf Heuer and JINR Director Alexei Sissakian signed a new enlarged co-operation agreement to continue and enhance the scientific and technical co-operation of the two institutes in the field of high-energy physics. CERN and JINR have a long and successful history of collaboration extending back to the earliest days of their existence. The first informal meeting on international co-operation in the field of high-energy accelerators took place at CERN in 1959. It was attended by senior scientists from the United States, the USSR (including JINR) and CERN. Both JINR and CERN have played the role of a bridge between East and West for decades, contributing to the development of international scientific co-operation. In 1992 JINR signed a co-operation agreement with CERN that included an important number of protocols covering JINR’s participation in the construction of th...

Final Technical Report - SciDAC Cooperative Agreement: Center for Wave Interactions with Magnetohydrodynamics

International Nuclear Information System (INIS)

Schnack, Dalton D.

2012-01-01

Final technical report for research performed by Dr. Thomas G. Jenkins in collaboration with Professor Dalton D. Schnack on SciDAC Cooperative Agreement: Center for Wave Interactions with Magnetohydrodyanics, DE-FC02-06ER54899, for the period of 8/15/06 - 8/14/11. This report centers on the Slow MHD physics campaign work performed by Dr. Jenkins while at UW-Madison and then at Tech-X Corporation. To make progress on the problem of RF induced currents affect magnetic island evolution in toroidal plasmas, a set of research approaches are outlined. Three approaches can be addressed in parallel. These are: (1) Analytically prescribed additional term in Ohm's law to model the effect of localized ECCD current drive; (2) Introduce an additional evolution equation for the Ohm's law source term. Establish a RF source 'box' where information from the RF code couples to the fluid evolution; and (3) Carry out a more rigorous analytic calculation treating the additional RF terms in a closure problem. These approaches rely on the necessity of reinvigorating the computation modeling efforts of resistive and neoclassical tearing modes with present day versions of the numerical tools. For the RF community, the relevant action item is - RF ray tracing codes need to be modified so that general three-dimensional spatial information can be obtained. Further, interface efforts between the two codes require work as well as an assessment as to the numerical stability properties of the procedures to be used.

Final report for the Department of Energy funded cooperative agreement ''Electronic Research Demonstration Project'' [University electronic research administration demonstration project

Energy Technology Data Exchange (ETDEWEB)

Rodman, John

1998-07-31

This is the final report for the Department of Energy (DOE) funded cooperative agreement ''Electronic Research Demonstration Project (DE-FC02-92ER35180)'' for the period August 1994-July 1998. The goal of the project, referred to as NewERA, was to demonstrate the use of open standards for electronic commerce to support research administration, otherwise referred to as Electronic Research Administration (ERA). The NewERA demonstration project provided a means to test interagency standards developed within the Federal Grant Electronic Commerce Committee, a group comprised of federal granting agencies. The NewERA program was initiated by DOE. NewERA was comprised of three separate, but related, ERA activities in preaward administration, postaward administration, and secure Internet commerce. The goal of New ERA was to demonstrate an open standard implementation of ERA using electronic data interchange, e-mail and Internet transaction security between grant applicants and DOE, along with t h e other participating agencies.

40 CFR 35.6215 - Eligibility for Core Program Cooperative Agreements.

Science.gov (United States)

2010-07-01

... Cooperative Agreement. (c) When it is more economical for a government entity other than the recipient (such as a political subdivision or State Attorney General) to implement tasks funded through a Core Program Cooperative Agreement, benefits to such entities must be provided for in an intergovernmental...

Study on the strategy of negotiation for Korea-Euratom Nuclear Cooperation Agreement

Energy Technology Data Exchange (ETDEWEB)

Soo, Ryu Jae; Lee, Gwang Seok; Lee, Hanmyung; Jun, Eunju; Lee, Dong Hoon

2012-09-15

We suggested the draft of Korea-EURATOM nuclear cooperation agreement that is expected to conclude in the near future by analyzing status and policy on the nuclear development and nuclear cooperation agreement in EURATOM. We expect that results of this study will propose basic strategy and direction of negotiations for Korea-EURATOM nuclear cooperation agreement in the near future.

32 CFR 99.7 - Procedures for requesting an indemnification agreement.

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false Procedures for requesting an indemnification agreement. 99.7 Section 99.7 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.7...

Cooperation Agreement. The text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization

International Nuclear Information System (INIS)

2009-01-01

The text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization is reproduced herein for the information of all Members. The Agreement entered into force on 13 October 2008 pursuant to Article 8

Cooperation Agreement. The Text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization

International Nuclear Information System (INIS)

2009-01-01

The text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization is reproduced herein for the information of all Members. The Agreement entered into force on 13 October 2008 pursuant to Article 8

75 FR 24663 - Notice of Proposed Solicitation for Cooperative Agreement Applications (SCAA)

Science.gov (United States)

2010-05-05

... Agreement Applications (SCAA) AGENCY: Defense Logistics Agency, DOD. ACTION: Proposed solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the DoD Procurement Technical Assistance Program (PTAP) by awarding cost sharing cooperative agreements to assist...

32 CFR 22.215 - Distinguishing grants and cooperative agreements.

Science.gov (United States)

2010-07-01

... GRANT AND AGREEMENT REGULATIONS DoD GRANTS AND AGREEMENTS-AWARD AND ADMINISTRATION Selecting the... than an absolute, concept, and that it is primarily based on programmatic factors, rather than requirements for grant or cooperative agreement award or administration. For example, substantial involvement...

Study of the low energy gamma transitions of molybdenum 99; Etude des transitions gamma de basse energie du molybdene 99

Energy Technology Data Exchange (ETDEWEB)

Ravier, J.

1959-07-01

The study of the decay scheme of Mo{sup 99} has been performed on the magnetic iron-less and double focalization spectrograph of the Institute of Nuclear Physics of Lyon. Methods of internal and external conversion have been used. The intensities of the Mo{sup 99} sources used were not strong enough to determine the characteristics of the internal conversion accurately but were sufficient to precise the decay scheme at low energy. We have determined the internal conversion ratio for the transition of 180 KeV, we have got: 0.13 ± 0.03 which is not in agreement with the value given by a previous experiment based on γ-γ coincidence. Our method seems to be more reliable. We confirm the E2 feature of this transition and its 5/2+ spin. We have determined another important parameter for the 180 KeV de-excitation: the percentage of transitions that do not pass by the isomeric level but by the 140 KeV level is (6 ± 2)%, the isomeric level being at 142 KeV. The gamma spectra at low energy has been studied through the photoelectric effect in a lead converter [French] L'etude du schema de desintegration du Mo{sup 99} deja faite par differents auteurs a ete reprise par des methodes de conversion interne et externe, an moyen du spectrographe magnetique sans fer et a double focalisation de l'Institut de Physique Nucleaire de Lyon. Apres avoir cherche les possibilites d'obtention de sources de haute activite specifique par separation isotopique Szilard-Chalmers sur des molybdates alcalins, le spectre de conversion interne a basse energie a ete mesure. Ainsi se trouverent etre determines les coefficients partiaux de conversion interne. Le spectre γ a basse energie a ete etudier au moyen de l'effet photoelectrique sur un convertisseur de plomb. Les coefficients de conversion interne et les intensites relatives des differentes transitions ont ete calcules moyennant certaines hypotheses. La comparaison entre les valeurs donnees par la theorie et l'experience des differentes

Technology Cooperation Agreement Pilot Project (TCAPP)

Energy Technology Data Exchange (ETDEWEB)

Keegan, P.; Benioff, R.

1999-10-20

The Technology Cooperation Agreement Pilot Project (TCAPP) is helping developing countries design and implement actions to attract investment in clean energy technologies that will meet their economic development goals, while mitigating greenhouse gas emissions. TCAPP was launched by three US government agencies -- the US Agency for International Development (USAID), the US Environmental Protection Agency (USEPA), and the US Department of Energy (USDOE) -- in August 1997 to establish a model for climate change technology cooperation with developing and transition countries. This report describes the TCAPP approach and the significant progress made by the participating countries.

Cooperation Agreement. The Text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization

International Nuclear Information System (INIS)

2009-01-01

The text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization is reproduced herein for the information of all Members. The Agreement entered into force on 13 October 2008 pursuant to Article 8 [fr

Cooperation Agreement. The Text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization

International Nuclear Information System (INIS)

2009-01-01

The text of the Cooperation Agreement between the International Atomic Energy Agency and the ITER International Fusion Energy Organization is reproduced herein for the information of all Members. The Agreement entered into force on 13 October 2008 pursuant to Article 8 [es

76 FR 8720 - Notice of Proposed Solicitation for Cooperative Agreement Applications (SCAA)

Science.gov (United States)

2011-02-15

... Agreement Applications (SCAA) AGENCY: Defense Logistics Agency, DoD. ACTION: Proposed solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the DoD... the submission of applications to be considered for base year cost sharing cooperative agreement...

43 CFR 422.9 - Reclamation law enforcement contracts and cooperative agreements.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Reclamation law enforcement contracts and... PROJECTS Program Requirements § 422.9 Reclamation law enforcement contracts and cooperative agreements. (a... Federal laws. (b) Each contract and cooperative agreement authorizing the exercise of Reclamation law...

7 CFR Exhibit C to Subpart B of... - Cooperative Agreement (Example)

Science.gov (United States)

2010-01-01

... 7 Agriculture 14 2010-01-01 2009-01-01 true Cooperative Agreement (Example) C Exhibit C to Subpart B of Part 1955 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... Exhibit C to Subpart B of Part 1955—Cooperative Agreement (Example) Editorial Note: Exhibit C is not...

Reports on memorial lecture meetings on co-operative application finish of the SF cyclotron and its result reports

International Nuclear Information System (INIS)

2000-01-01

The SF cyclotron at the Institute for Nuclear Study (INS) of University of Tokyo began its co-operative application in 1997 to continue its smooth operation during 21 years reaching March, 1997. Together with improvement of INS organization on April, 1997, it was transferred to the Center for Nuclear Study School of Science, University of Tokyo, INS continued a co-operative research for two years thereafter with Tanashi campus of the High Energy Accelerator Research Organization also established on April, 1997. This co-operative research was finished without accident at the end of March, 1999, to close history of co-operative application of cyclotron during 23 years. This report contains 15 memorial lecture and convivial meeting reports at the co-operative application finish of cyclotron and some results of co-operative applications and experiments, during 23 years. (G.K.)

Acceleration toward the conclusion negotiation of bilateral nuclear cooperation agreements indispensable for globalization

International Nuclear Information System (INIS)

Mitsumata, Hiroki; Hattori, Takuya; Ake, Yutaka

2011-01-01

According to Japan's basic policies of new growth strategy, it would be one option of the economic growth to increase exports of nuclear power plant system or its equipments. However, bilateral nuclear cooperation agreements are indispensable for business activities on nuclear power. Recently signature of agreement with Jordan, agreed conclusion negotiation with Vietnam and Korea, under negotiation with India and expected negotiation with Indonesia and Malaysia. Signed agreements with Russia and Kazakhstan will be coming into effect and contribute nuclear fuel supply at export of nuclear power system. This special article consists of four expert's papers titled as (1) necessity of conclusion negotiation of nuclear cooperation agreements with several countries simultaneously and in parallel, (2) Japan's nuclear cooperation in new era, (3) desirable acceleration of conclusion negotiation of nuclear cooperation agreements and (4) insurance of nuclear fuel supply fundamental for global business activities of Japan's nuclear industries-best choice to establish cooperative relations with US and Russia. (T. Tanaka)

Design and synthesis of a redox-active tc-99m radiopharmaceutical with ferrocenedithiocarboxylate [FcCS=Fe(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5}){sup -}

Energy Technology Data Exchange (ETDEWEB)

Uccelli, Licia; Bolzati, Cristina; Boschi, Alessandra; Duatti, Adriano E-mail: dta@ifeuniv.unife.it; Morin, Christophe; Pasqualini, Roberto; Giganti, Melchiore; Piffanelli, Adriano

1999-01-01

The synthesis, at tracer level, of two Tc-99m complexes having the same chemical composition and structure, but differing by one electron in the total electron counting, is reported. These compounds have been prepared by reacting [{sup 99m}TcO{sub 4}]{sup -} with the piperidinium salt of the ligand ferrocenedithiocarboxylate {l_brace}[Fe(II)(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5})]{sup -}=FcCS{r_brace}, in the presence of N-methyl S-methyldithiocarbazate as donor of N{sup 3-} groups, and triphenylphosphine or SnCl{sub 2} as reducing agents. The formation of the neutral complex [{sup 99m}Tc(N)(FcCS){sub 2}] (compound A) and of the monocationic, mixed-valence complex [{sup 99m}Tc(N)(FcCS) (FcCS*)]{sup +} (compound B) {l_brace}FcCS* [Fe(III)(C{sub 5}H{sub 4}CS{sub 2})(C{sub 5}H{sub 5})]{r_brace} was obtained in high yield. Both complexes comprise a terminal Tc{identical_to}N multiple bond and two FcCS ligands coordinated to the metal center through the two sulfur atoms of the -CS{sub 2} group, but they differ in the oxidation state of one of the two iron atoms of the coordinated FcCS ligands. In complex A, the two Fe atoms are both in the +2 oxidation state, while in B, one Fe atom is in the +2 and the other is in the +3 oxidation state. Thus, B is a mixed-valence Fe(II)-Fe(III) complex. B is easily converted into A by one-electron exchange with various reductants such as triphenylphosphine and excess SnCl{sub 2}. Biodistribution studies in rats showed that complexes A and B are mostly retained in lungs and liver without any significant uptake in organs such as heart and brain.

41 CFR 105-74.620 - Cooperative agreement.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Cooperative agreement. 105-74.620 Section 105-74.620 Public Contracts and Property Management Federal Property Management... Administration 74-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74...

Enhancing regional security agreements through cooperative monitoring

International Nuclear Information System (INIS)

Pregenzer, A.L.

1995-05-01

This paper proposes that strengthening regional capabilities for formulating and implementing arms control and confidence-building measures is a tangible method of enhancing regional security. It discusses the importance of developing a regional infrastructure for arms control and confidence building and elucidates the role of technology in facilitating regional arms control and confidence-building agreements. In addition, it identifies numerous applications for regional cooperative monitoring in the areas of arms control, resource management, international commerce and disaster response. The Cooperative Monitoring Center at Sandia National Laboratories, whose aim is to help individual countries and regions acquire the tools they need to develop their own solutions to regional problems, is discussed briefly. The paper ends with recommendations for establishing regional cooperative monitoring centers

AFRA. African Regional Co-operative Agreement

International Nuclear Information System (INIS)

1994-04-01

This publication provides an outline of the African Regional Co-operation Agreement for research, development and training related to nuclear science and technology (AFRA). The agreement stems from an initiative of several African member states of the IAEA to get the agency to help establish an African regional arrangement which would be similar to arrangements which were already in place in the Asian and Latin American regions. Through this regional approach to development, AFRA seeks to accelerate moves toward self-sufficiency in scientific disciplines and appropriate technologies by coordinating intellectual and physical resources and disseminating innovative methods and practices in a cost-effective manner

The Text of the Agreement of 8 July Extending the Asian Regional Co-Operative Project on Food Irradiation. Extension Agreement

International Nuclear Information System (INIS)

1983-12-01

The text of the Agreement to Extend the Agreement of 23 May 1980 Establishing the Asian Regional Co-operative Project on Food Irradiation within the framework of the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology of 1972, as extended in 1977 and in 1982, is reproduced herein for the information of all Members

Apology and forgiveness evolve to resolve failures in cooperative agreements.

Science.gov (United States)

Martinez-Vaquero, Luis A; Han, The Anh; Pereira, Luís Moniz; Lenaerts, Tom

2015-06-09

Making agreements on how to behave has been shown to be an evolutionarily viable strategy in one-shot social dilemmas. However, in many situations agreements aim to establish long-term mutually beneficial interactions. Our analytical and numerical results reveal for the first time under which conditions revenge, apology and forgiveness can evolve and deal with mistakes within ongoing agreements in the context of the Iterated Prisoners Dilemma. We show that, when the agreement fails, participants prefer to take revenge by defecting in the subsisting encounters. Incorporating costly apology and forgiveness reveals that, even when mistakes are frequent, there exists a sincerity threshold for which mistakes will not lead to the destruction of the agreement, inducing even higher levels of cooperation. In short, even when to err is human, revenge, apology and forgiveness are evolutionarily viable strategies which play an important role in inducing cooperation in repeated dilemmas.

The role of bilateral agreements for cooperation in establishing international norms for nuclear exportation

International Nuclear Information System (INIS)

Rowden, M.A.; Kraemer, J.R.

1986-01-01

It seems unlikely that a broad multilateral political consensus on the appropriate nuclear control norms will soon be achieved. Bilateral nuclear cooperation agreements will continue to be the dominant political instruments governing international nuclear commerce. Recent developments make the authors optimistic that flexible implementation of the Nuclear Non-Proliferation Act of 1978 will permit a more effective U.S. policy in the field of nuclear commerce. (CW) [de

Transatlantic Cooperation in Space: Eu-Canada Free Trade Agreement

Directory of Open Access Journals (Sweden)

Luise Weber-Steinhaus

2014-12-01

Full Text Available National governments are keenly aware of the need for investment in space. Canada, as a formal cooperating state in the European Space Agency (ESA, and Germany, as a leading member state of ESA, are interlinked in Europe’s space endeavours. Beyond ESA, Germany and Canada additionally have a strong history of bilateral cooperation on a range of space projects. This paper discusses the novel interdependencies between clear national and now supranational space policies, using the examples of the Canada-European Union (EU Comprehensive Economic and Trade Agreement (CETA. The agreement covers most aspects of the EU-Canada bilateral economic relationship and includes space. The paper focuses on international space policies, strategic bilateral co-operation, and technical accomplishments. It takes a closer look at German-Canadian collaboration in space programs and offers some reflection on the effect of both the EU and ESA’S transatlantic involvement in space.

Chinalco Signed Framework Agreement for Strategic Cooperation with Gansu Province

Institute of Scientific and Technical Information of China (English)

2014-01-01

<正>Recently,Chinalco and Gansu Provincial People’s Government signed"Framework Agreement for Strategic Cooperation on Reform,Restructuring and Transition Development of Chinalco’s Electrolytic Aluminum Enterprises in Gansu",signifying that the strategic cooperation between Chinalco and Gansu Province had made new substantive progress.

Technology transfer and the Argentina-German cooperation agreement

International Nuclear Information System (INIS)

Di Primio, J.C.

1977-01-01

The transfer of technology from developed countries is usually done through industrial enterprises. The local industrialization of imported technology does not necessary imply that full benefit is extracted from its application. A pre-established scientific and technical infrastructure is needed to understand and incorporate it, and to develop methods for improvement and use at the industrial level, in the frame of national conditions. The transference of nuclear technology has shown recently new concepts for the implementation. It is becoming a rule that massive industrial nuclear technology transfer to developing nations is conditioned by the latter requirement for simulataneous assistance to create or promote that infrastructure. An example of international cooperation to meet the requirement explained above is the Argentine-German agreement for the peaceful applications of nuclear energy. Since 1971 it has been used to strengthen the scientific and technical programs of the Argentine Atomic Energy Commission, by application to fields relevant by its industrial implications. The objectives and implementation of the agreement are described: cooperative actions where initially directed to the infrastructure needed to support the nuclear fuel cycle industry. The results achieved during the period 1971-76 are critically analyzed. This analysis has influenced the selection of future cooperative projects as well as the extension of the cooperation to other nuclear fields of common interest [es

7 CFR 4285.46 - Prohibited use of cooperative agreement funds.

Science.gov (United States)

2010-01-01

... excluded as the research on cooperatives program activities. (b) Federal funds cannot be used to purchase... purchase: (1) Promotional pieces such as point-of-sale materials, promotional kits, billboard space and... gift nature. (d) Cooperative agreement funds cannot be used to conduct general publicity or information...

Current and future role of agreements for cooperation as the framework for international nuclear commerce

International Nuclear Information System (INIS)

Brush, P.N.

1976-01-01

An agreement for cooperation in the civil use of atomic energy was established by Congress as the primary vehicle for ensuring that the benefits of cooperation outweigh the risks. The elements and nature of the agreement for cooperation are reviewed in this article. The evolution of some of the more significant provisions of the agreements and the type of activities conducted under them are discussed. The question is raised as to whether or not these agreements for cooperation are strong enough in the light of nations of the world becoming more concerned with the implications of burgeoning nuclear power activities. The question, ''Should these agreements be elevated to the status of treaties.'' is asked also

EPRI-USDOE COOPERATIVE AGREEMENT: COFIRING BIOMASS WITH COAL

Energy Technology Data Exchange (ETDEWEB)

David A. Tillman

2001-09-01

The entire Electric Power Research Institute (EPRI) cofiring program has been in existence of some 9 years. This report presents a summary of the major elements of that program, focusing upon the following questions: (1) In pursuit of increased use of renewable energy in the US economy, why was electricity generation considered the most promising target, and why was cofiring pursued as the most effective near-term technology to use in broadening the use of biomass within the electricity generating arena? (2) What were the unique accomplishments of EPRI before the development of the Cooperative Agreement, which made developing the partnership with EPRI a highly cost-effective approach for USDOE? (3) What were the key accomplishments of the Cooperative Agreement in the development and execution of test and demonstration programs-accomplishments which significantly furthered the process of commercializing cofiring?

A Handbook for Understanding of Nuclear Cooperation Agreement

Energy Technology Data Exchange (ETDEWEB)

Lee, B. W.; Lee, H. M.; Ko, H. S.; Ryu, J. S.; Lee, K. S

2007-12-15

The objective of this study is to help understanding for revision of existing Nuclear Cooperation Agreements (NCAs) between Korea and the United States (US). To accomplish the objectives, this study: First, explains a basic concept, role and composition of a NCA. Second, analyzes key factors of a NCA including the right of a supplier and the obligation of a recipient; and Lastly, examines a current status of nuclear cooperation between Korea and the US, and revision procedures of a NCA, especially the US.

LLE 1997. Annual report, October 1996-September 1997

International Nuclear Information System (INIS)

1998-01-01

The fiscal year ending September 1997 (FY97) concluded the fifth year of the cooperative agreement (DE-FC03-92SF19460) with the U.S. Department of Energy (DOE). This report summarizes research at the Laboratory for Laser Energetics (LLE) and is the final report for the first five years of the cooperative agreement. In September 1997, the cooperative agreement was renewed for an additional five years. We summarize our research during FY97, the operation of the National Laser Users' Facility (NLUF), and the education of high school, undergraduate, and graduate students in LLE programs. A general introduction to LLE's experimental physics program and a report on recent results are found on pp. 161-167. This article includes a useful summary of the system's operational capabilities and system parameters after three years of operation. Direct-drive inertial confinement fusion requires precise drive uniformity, the control of hydrodynamic instabilities during the implosion of the fusion target, and accurate target fabrication and characterization. The article summarizes a wide variety of experiments relating to direct-drive laser fusion, from high-yield implosion experiments to planar and spherical Rayleigh-Taylor experiments, laser-imprinting experiments, and laser-plasma interaction experiments. A detailed analysis of the equation of motion for an electron in a plane wave is presented beginning on p. 24. A guiding center model is postulated and compared to numerical simulation of the actual particle motion. The formula is also verified analytically using the method of multiple scales. Work continues on this formalism to study the effects of the pondermotive force on laser-plasma interactions. A theoretical calculation of the dephasing time of an electron accelerated by a laser pulse is found on pp. 92-100. The trajectory of a charged particle, determined analytically for various pulse shapes, is then used to determine the dephasing time of an accelerated particle

LLE 1997. Annual report, October 1996--September 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-01

The fiscal year ending September 1997 (FY97) concluded the fifth year of the cooperative agreement (DE-FC03-92SF19460) with the U.S. Department of Energy (DOE). This report summarizes research at the Laboratory for Laser Energetics (LLE) and is the final report for the first five years of the cooperative agreement. In September 1997, the cooperative agreement was renewed for an additional five years. We summarize our research during FY97, the operation of the National Laser Users` Facility (NLUF), and the education of high school, undergraduate, and graduate students in LLE programs. A general introduction to LLE`s experimental physics program and a report on recent results are found on pp. 161-167. This article includes a useful summary of the system`s operational capabilities and system parameters after three years of operation. Direct-drive inertial confinement fusion requires precise drive uniformity, the control of hydrodynamic instabilities during the implosion of the fusion target, and accurate target fabrication and characterization. The article summarizes a wide variety of experiments relating to direct-drive laser fusion, from high-yield implosion experiments to planar and spherical Rayleigh-Taylor experiments, laser-imprinting experiments, and laser-plasma interaction experiments. A detailed analysis of the equation of motion for an electron in a plane wave is presented beginning on p. 24. A guiding center model is postulated and compared to numerical simulation of the actual particle motion. The formula is also verified analytically using the method of multiple scales. Work continues on this formalism to study the effects of the pondermotive force on laser-plasma interactions. A theoretical calculation of the dephasing time of an electron accelerated by a laser pulse is found on pp. 92-100. The trajectory of a charged particle, determined analytically for various pulse shapes, is then used to determine the dephasing time of an accelerated particle.

Shaanxi Gold Group Signed Strategic Cooperation Agreements With Five Enterprises

Institute of Scientific and Technical Information of China (English)

2016-01-01

Recently,Shaanxi Gold Group Inc.successfully signed strategic cooperation agreements and secondary member agency agreements with 5 related enterprises in Shaanxi including Northwest Nonferrous Metals Research Institute,Baoti Group Co.,Ltd,Hanzhong Zinc Industry Co.,Ltd,Shaanxi Zinc Industry Co.,Ltd,and Shaanxi Feng

Analysis of the revision of the nuclear cooperation agreement between the USA and Switzerland

International Nuclear Information System (INIS)

Lee, K. S.; Lee, B. W.

1999-01-01

The US and Switzerland enforced a new nuclear cooperation agreement in June 1998. After extended negotiation for the new nuclear cooperation agreement, Switzerland accomplished to get the advance, long-term consent approach, not to allow the US's prior consent right on the spent fuel used in the US-origin reactors, and to specify conditions for the suspension of advance, long-term consent. This paper analyzes the contents and implications of the revision of the nuclear cooperation agreement between the two countries

Evaluación del estado de salud con la Encuesta SF-36: resultados preliminares en México Health status evaluation with the SF-36 Survey: preliminary results in Mexico

Directory of Open Access Journals (Sweden)

Miguel A. Zúniga

1999-03-01

Full Text Available Objetivo. Establecer, con la Encuesta SF-36, un perfil multidimensional del estado de salud de una población del sureste de México y analizar las propiedades psicométricas de una traducción de la Encuesta SF-36 autorizada por el Proyecto Internacional de Evaluación de la Calidad de Vida. Material y métodos. La SF-36 se aplicó a 257 participantes voluntarios de una clínica médica y a un grupo control de una institución pública gubernamental. Se utilizó, sin modificar, la metodología de construcción de las escalas de salud propuestas por los autores de la encuesta. Se analizó psicométricamente la validez y la confiabilidad de la adaptación de la SF-36 para su uso en México. Resultados. Se construyeron ocho escalas o conceptos de salud relacionados con función física, rol físico, dolor corporal, salud general, vitalidad, función social, rol emocional y salud mental. En los participantes de los servicios médicos la escala con más bajo promedio fue la de salud general (63, y la más alta, la de rol físico (89. En la población control la escala con promedio más alto fue función física (94.6, y la más baja, salud general (73. La comparación de promedios de escalas en ambos grupos de participantes mostró diferencias estadísticamente significativas en función física, rol físico, dolor corporal, salud general y vitalidad. Conclusiones. Con base en los resultados de la evaluación psicométrica, la SF-36 muestra que es consistente con todos los supuestos de validez y confiabilidad en forma satisfactoria, aunque la traducción de ciertas preguntas se examinará en profundidad para determinar modificaciones subsecuentes.Objective. To establish a multidimensional profile of the health status in a population of southeastern Mexico and analyze the psychometric properties of a translation of the SF-36 survey authorized by the International Quality of Life Assessment Project. Material and methods. The SF-36 was administered to

Normas poblacionales de referencia de la versión española del SF-12V2 para la Región de Murcia Population based norms of the Spanish version of the SF-12V2 for Murcia (Spain

Directory of Open Access Journals (Sweden)

Olga Monteagudo Piqueras

2011-02-01

Full Text Available Objetivo: Los cuestionarios de salud percibida proporcionan información sobre resultados de salud. La valoración de su impacto requiere disponer de valores de referencia. En la población española, los estudios previos los han proporcionado para el SF-12v1. El objetivo fue obtener, para la versión española del SF-12v2, las normas poblacionales de referencia de la Región de Murcia. Métodos: Estudio transversal con encuesta telefónica a 3.486 personas no institucionalizadas de 18 años o más de edad, de la Región de Murcia. Se calcularon medidas de tendencia central, dispersión y percentiles de las dimensiones, y componentes sumario físico y mental (CSF y CSM del SF-12v2. Para la evaluación de constructo se compararon diferencias de medias en grupos conocidos (prueba t de Student o ANOVA. Resultados: Participaron en el estudio 3.381 sujetos. El 50,5% eran hombres, con una media de 43,6 años de edad, y de 46,0 en las mujeres. El CSF medio fue 48,6 (±10,6 y el CSM fue 53,6 (±10,7, y estas puntuaciones fueron superiores (mejores en los hombres, los grupos de edad más joven, las personas con estudios superiores y aquellas sin ninguna condición médica crónica (p=0,000. Los hombres presentaron mejores puntuaciones que las mujeres en la mayoría de las dimensiones y componentes sumario. La dimensión peor valorada por hombres y mujeres fue la salud general y el CSF. Conclusiones: Estos resultados, aunque deben considerarse como normas poblacionales de referencia de la versión española del SF-12v2 para la Región de Murcia, pueden ser utilizados por poblaciones similares a la hora de establecer objetivos de salud.Objective: Questionnaires on perceived health provide information on health results. Reference values are needed to assess these results. Previous studies have provided Spanish population-based norms for the SF-12v1. The aim of this study was to obtain the population-based norms for the Spanish version of the SF-12v2 for

Technology transfer: A cooperative agreement and success story

International Nuclear Information System (INIS)

Reno, H.W.; McNeel, K.; Armstrong, A.T.; Vance, J.K.

1996-01-01

This paper describes the cooperative agreement between the U.S. Department of Energy and Envirocare of Utah, Inc., wherein the former transferred macroencapsulative technology to the latter for purposes of demonstrating commercialization of treatment and disposal of 225, 000 Kg of radioactive lead stored at departmental installations

Regional cooperation based on multilateral international agreements in nuclear field

International Nuclear Information System (INIS)

Valcic, I.

1996-01-01

Multilateral international agreements have defined the framework of behavior and cooperation in various fields and aspects of peaceful use of nuclear energy. Thus, obligations have been defined in the following areas: nonproliferation of nuclear weapons, physical protection of nuclear material, liability for nuclear damage, nuclear safety, early notification about a nuclear accident and assistance in case of nuclear accident. Obligations regarding radioactive waste management should be defined soon. This paper gives a review of obligations from particular agreements with a special emphasis on those which are being realized through mutual cooperation of concerned countries and are important for safe use of nuclear energy. (author)

El rendimiento en el fútbol. Una modelización de las variables determinantes para el F.C. Barcelona

Directory of Open Access Journals (Sweden)

Carlos Lago Peñas

2007-12-01

Full Text Available El objetivo del presente trabajo es explicar las variables que determinan el rendimiento que alcanza el F.C. Barcelona a lo largo de un partido de fútbol. Para ello se han analizado los 38 partidos disputados por el F.C. Barcelona en la Primera División de la Liga Española de Fútbol de la temporada 2004-2005. La variable que mide el rendimiento es la diferencia entre los lanzamientos a favor y los lanzamientos en contra en cada partido. Las variables explicativas que se manejan son: jugar en casa o fuera, posesión del balón, llegadas al área y equipo rival como determinantes del rendimiento. Los resultados de los análisis de regresión lineal permiten explicar el 68 % de la varianza del rendimiento. El segundo objetivo es valorar la homogeneidad del modelo anterior dependiendo del Episodio de Juego que caracteriza al partido en cada momento, esto es, si el F.C. Barcelona tiene la iniciativa o está a la expectativa en el juego. Los resultados indican que cuando el F.C. Barcelona tiene la iniciativa en el partido tiene un rendimiento mejor que cuando se encuentra a la expectativa y que las variables explicativas analizadas tienen diferente importancia bajo estos escenarios de competición.

DIFERENTES MODELOS DE REGRESIÓN PARA DESCRIBIR LA RELACIÓN V.O2-FC Y PARA ESTIMAR EL V.O2 A DIFERENTES INTENSIDADES DE ESFUERZO

Directory of Open Access Journals (Sweden)

Nuria Garatachea Vallejo

2005-01-01

Full Text Available Muchos son los estudios que demuestran el potencial de la frecuencia cardiaca (FC para estimar el coste energético de una actividad física, ya que se relaciona directamente con el consumo de oxígeno (V. O2. La mayoría de estudios describen la relación V. O2- FC como lineal para un amplio rango de esfuerzo, exceptuando los valores de reposo aunque se han propuesto diferentes funciones matemáticas continuas no lineales sin existir todavía un acuerdo en la ecuación más apropiada. También existen estudios que apuntan un cambio en la relación V. O2-FC en función de la intensidad del esfuerzo. Nuestro objetivo fue determinar cuál es la mejor función matemática que describe la relación entre la FC y el V. O2 y decidir cuál es la mejor función matemática para estimar el V. O2 a diferentes intensidades de esfuerzo. Participaron 14 sujetos que realizaron una prueba de esfuerzo máxima sobre cicloergómetro y una prueba que consistía en pedalear a 5 intensidades de esfuerzo (40, 50, 60, 70 y 80% del V. O2max durante 3 minutos. Durante ambas pruebas se midió V. O2 y frecuencia cardiaca. El modelo lineal y potencial fueron los modelos matemáticos más exactos para describir la relación V. O2-FC. El mayor error de estimación se produjo a bajas intensidades de esfuerzo. En conclusión, la elección de un tipo u otro de regresión influye en la exactitud del método de monitorización de la frecuencia cardiaca.

30 CFR 931.30 - State-Federal cooperative agreement.

Science.gov (United States)

2010-07-01

.... 7401, et seq., and implementing regulations. 7. The Federal Water Pollution Control Act, 33 U.S.C. 1251... INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE NEW MEXICO § 931.30 State-Federal cooperative agreement. The State of New Mexico (State) acting through the Governor and the...

EPRI-USDOE COOPERATIVE AGREEMENT: COFIRING BIOMASS WITH COAL; FINAL

International Nuclear Information System (INIS)

David A. Tillman

2001-01-01

The entire Electric Power Research Institute (EPRI) cofiring program has been in existence of some 9 years. This report presents a summary of the major elements of that program, focusing upon the following questions: (1) In pursuit of increased use of renewable energy in the US economy, why was electricity generation considered the most promising target, and why was cofiring pursued as the most effective near-term technology to use in broadening the use of biomass within the electricity generating arena? (2) What were the unique accomplishments of EPRI before the development of the Cooperative Agreement, which made developing the partnership with EPRI a highly cost-effective approach for USDOE? (3) What were the key accomplishments of the Cooperative Agreement in the development and execution of test and demonstration programs-accomplishments which significantly furthered the process of commercializing cofiring?

78 FR 49756 - Notification of a Cooperative Agreement Award to the World Health Organization

Science.gov (United States)

2013-08-15

...: Notification of a sole source Cooperative Agreement Award to the World Health Organization for a grant titled... World Health Organization (WHO) as soon as possible, and any confirmed smallpox case would generate an... DEPARTMENT OF HEALTH AND HUMAN SERVICES Notification of a Cooperative Agreement Award to the World...

A survey of nuclear-related agreements and possibilities for nuclear cooperation in South Asia: Cooperative Monitoring Center Occasional Paper/Draft

International Nuclear Information System (INIS)

Rajen, Gaurav

2000-01-01

Several existing nuclear-related agreements already require India and Pakistan, as members, to share information. The agreements are bilateral, regional, and international. Greater nuclear transparency between India and Pakistan could be promoted by first understanding the information flows required by existing agreements. This understanding is an essential step for developing projects that can incrementally advance the sensitivity of the information being shared. This paper provides a survey of existing nuclear-related agreements involving India and Pakistan, and suggests future confidence-building projects using the frameworks provided by these agreements. The Bilateral Agreement on the Prohibition of Attack against Nuclear Reactors and Nuclear Facilities is discussed as a basis for creating further agreements on restricting the use and deployment of nuclear weapons. The author suggests options for enhancing the value of the list of nuclear facilities exchanged annually as a part of this agreement. The International Atomic Energy Agency's regional cooperation agreement among countries in the Asia-Pacific region is an opportunity for greater subregional nuclear cooperation in South Asia. Linking the regional agreement with South Asian environmental cooperation and marine pollution protection efforts could provide a framework for projects involving Indian and Pakistani coastal nuclear facilities. Programs of the Food and Agriculture Organization of the United Nations that use nuclear techniques to increase food and crop production and optimize water management in arid areas also provide similar opportunities for nuclear cooperation. Other frameworks for nuclear cooperation originate from international conventions related to nuclear safety, transportation of nuclear wastes, worker protection against ionizing radiation, and the nondeployment of nuclear weapons in certain areas. The information shared by existing frameworks includes: laws and regulations (including

A survey of nuclear-related agreements and possibilities for nuclear cooperation in South Asia: Cooperative Monitoring Center Occasional Paper/15

Energy Technology Data Exchange (ETDEWEB)

RAJEN,GAURAV

2000-04-01

Several existing nuclear-related agreements already require India and Pakistan, as members, to share information. The agreements are bilateral, regional, and international. Greater nuclear transparency between India and Pakistan could be promoted by first understanding the information flows required by existing agreements. This understanding is an essential step for developing projects that can incrementally advance the sensitivity of the information being shared. This paper provides a survey of existing nuclear-related agreements involving India and Pakistan, and suggests future confidence-building projects using the frameworks provided by these agreements. The Bilateral Agreement on the Prohibition of Attack against Nuclear Reactors and Nuclear Facilities is discussed as a basis for creating further agreements on restricting the use and deployment of nuclear weapons. The author suggests options for enhancing the value of the list of nuclear facilities exchanged annually as a part of this agreement. The International Atomic Energy Agency's regional cooperation agreement among countries in the Asia-Pacific region is an opportunity for greater subregional nuclear cooperation in South Asia. Linking the regional agreement with South Asian environmental cooperation and marine pollution protection efforts could provide a framework for projects involving Indian and Pakistani coastal nuclear facilities. Programs of the Food and Agriculture Organization of the United Nations that use nuclear techniques to increase food and crop production and optimize water management in arid areas also provide similar opportunities for nuclear cooperation. Other frameworks for nuclear cooperation originate from international conventions related to nuclear safety, transportation of nuclear wastes, worker protection against ionizing radiation, and the nondeployment of nuclear weapons in certain areas. The information shared by existing frameworks includes: laws and regulations

USDOE/EPRI BIOMASS COFIRING COOPERATIVE AGREEMENT

International Nuclear Information System (INIS)

D. Tillman; E. Hughes

1999-01-01

During the period of April 1, 1999 through June 30, 1999, wood cofiring testing at both Seward Generating Station of GPU Genco and Bailly Generating Station of Northern Indiana Public Service Company provided the focus for all activities. In both cases, the testing was directed at the impacts of cofiring on efficiency, operability, and NO(sub x) emissions. This report summarizes the activities during the second calendar quarter in 1999 of the USDOE/EPRI Biomass Cofiring Cooperative Agreement. It focuses upon reporting the results of testing activities at both generating stations

78 FR 17300 - Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and...

Science.gov (United States)

2013-03-21

... and II Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and... Relating to Grants and Cooperative Agreements; Cost Principles and Administrative Requirements (Including...

Evaluación del estado de salud con la Encuesta SF-36: resultados preliminares en México

Directory of Open Access Journals (Sweden)

Zúniga Miguel A.

1999-01-01

Full Text Available Objetivo. Establecer, con la Encuesta SF-36, un perfil multidimensional del estado de salud de una población del sureste de México y analizar las propiedades psicométricas de una traducción de la Encuesta SF-36 autorizada por el Proyecto Internacional de Evaluación de la Calidad de Vida. Material y métodos. La SF-36 se aplicó a 257 participantes voluntarios de una clínica médica y a un grupo control de una institución pública gubernamental. Se utilizó, sin modificar, la metodología de construcción de las escalas de salud propuestas por los autores de la encuesta. Se analizó psicométricamente la validez y la confiabilidad de la adaptación de la SF-36 para su uso en México. Resultados. Se construyeron ocho escalas o conceptos de salud relacionados con función física, rol físico, dolor corporal, salud general, vitalidad, función social, rol emocional y salud mental. En los participantes de los servicios médicos la escala con más bajo promedio fue la de salud general (63, y la más alta, la de rol físico (89. En la población control la escala con promedio más alto fue función física (94.6, y la más baja, salud general (73. La comparación de promedios de escalas en ambos grupos de participantes mostró diferencias estadísticamente significativas en función física, rol físico, dolor corporal, salud general y vitalidad. Conclusiones. Con base en los resultados de la evaluación psicométrica, la SF-36 muestra que es consistente con todos los supuestos de validez y confiabilidad en forma satisfactoria, aunque la traducción de ciertas preguntas se examinará en profundidad para determinar modificaciones subsecuentes.

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations

International Nuclear Information System (INIS)

1969-01-01

The text of the Agency's agreement for co-operation with the Organization of African Unity (OAU) is reproduced in this document for the information of all Members. The agreement entered into force on 26 March 1969

Protocol to co-operation agreement with Iran

CERN Document Server

2001-01-01

A Co-operation Agreement between CERN and Iran will be signed in the coming weeks within the framework of the decisions taken by the Committee of Council and Council in June 1989. In view of implementing this Agreement, a Protocol between CERN and the International Scientific Meetings Office of the Ministry of Science of the Islamic Republic of Iran has been drawn up. It concerns the participation of scientific Institutions of Iran in the CMS Collaboration where CERN is acting on behalf of this Collaboration. This Protocol incorporates the agreement between CMS and ISMO on the Iranese contribution. It does not involve any financial commitment for CERN. The Protocol mainly addresses the status of the Iranese scientists at CERN, the supply by ISMO of the support tables for CMS, as well as the usual provisions concerning delivery and customs, guarantees, responsibilities, intellectual property and disputes. This Protocol is submitted to the Finance Committee for information.

A study on the establishment of a standard nuclear cooperation agreement and the revision of existing nuclear cooperation agreements in Korea

Energy Technology Data Exchange (ETDEWEB)

Oh, Keun Bae; Lee, K S; Lee, D J; Lee, B Y; Cho, I H; Ko, H S

1997-04-01

The objectives of this study are to suggest a standard nuclear cooperation agreement (SNCA) as a model for new nuclear cooperation agreements (NCA`s) which are expected to be concluded in the near future and to suggest a proposal text and strategy for the revision of existing NCA`s with advanced countries such as the United States. To accomplish the objectives, this study: First, establishes a framework for a NCA through clarifying the basic concept of NCA and identifying key elements of NCA. Second, draws implications for a standard NCA and revision of existing NCA`s through analyzing by comparison those NCA`s between other countries. Third, clarifies the purpose and underlying philosophy for the SNCA, determines the elements to be included in the SNCA, and suggests a final draft of the SNCA. And fourth, clarifies general concepts of the revision of NCA`s, analyzes the needs of the revision of the Korea-U.S. NCA, and assesses the position of the United States on the matter. (author). 28 refs., 5 tabs., 2 figs.

Regional cooperative agreement for the Asia and Pacific region

International Nuclear Information System (INIS)

Anon.

1981-01-01

Among the means available to the International Atomic Energy Agency to promote cooperative efforts in the nuclear field is the Regional Cooperative Agreement (RCA) for Research, Development, and Training related to Nuclear Science and Technology for the Asia and Pacific Region. Under the terms of this agreement, which came into force on June 12, 1972, participating countries aim to promote and coordinate research, development, and training projects in nuclear fields through collaborative efforts among relevant national institutions in the region. The Agency's role is to provide organizational, administrative, advisory, technical, and financial assistance when needed to secure successful execution of the projects undertaken within the framework of the RCA. Although this presentation deals primarily with the benefits of regional cooperation under the agreement, a review of the RCA would be somewhat imbalanced without a mention of its shortcomings. One of the principal impediments to more rapid progress, as is the case in many other areas, is financing. There is no stable source of funding outside the research contract program and, the likelihood of large-scale UNDP support notwithstanding, a greater willingness on the part of participating Member States to support the program along with the development of a greater sense of common purpose are called for. In this connection serious consideration is being given to the possibility of establishing an Asian Centre for Research and Training, an institute that would bring together scientists from the region to collaborate on problems common to the RCA countries. A study group has already been convened to investigate the feasibility of this proposal

EPA-WERF Cooperative Agreement: Innovation and Research for Water Infrastructure for the 21st Century

Science.gov (United States)

This is a brief slide presentation that will provide an overview of several projects that are being conducted in EPA-WERF Cooperative Agreement, Innovation and Research for Water Infrastructure for the 21st Century. The cooperative agreement objectives are to produce, evaluate, &...

78 FR 42084 - Cooperative Agreement to Support the World Trade Organization's Standards and Trade Development...

Science.gov (United States)

2013-07-15

...] Cooperative Agreement to Support the World Trade Organization's Standards and Trade Development Facility... The STDF is a unique global partnership established by the Food and Agriculture Organization, World... cooperative agreement in fiscal year 2013 (FY 2013) to the World Trade Organization's (WTO) Standards and...

Chinalco Signed Framework Agreement for Strategic Cooperation with Harbin Municipal Government

Institute of Scientific and Technical Information of China (English)

2014-01-01

<正>Last month,Chinalco signed framework agreement for strategic cooperation with Harbin Municipal Government in Harbin Xiong Weiping,Chairman of Chinalco,said that based on the strategic deployment to build world top-class mining company with the highest growth potential,Chinalco was now concentrating all efforts on making strategic transition and structural adjustment,strategic cooperation with the local governments where

Multivalent Fcγ-receptor engagement by a hexameric Fc-fusion protein triggers Fcγ-receptor internalisation and modulation of Fcγ-receptor functions.

Science.gov (United States)

Qureshi, O S; Rowley, T F; Junker, F; Peters, S J; Crilly, S; Compson, J; Eddleston, A; Björkelund, H; Greenslade, K; Parkinson, M; Davies, N L; Griffin, R; Pither, T L; Cain, K; Christodoulou, L; Staelens, L; Ward, E; Tibbitts, J; Kiessling, A; Smith, B; Brennan, F R; Malmqvist, M; Fallah-Arani, F; Humphreys, D P

2017-12-06

Engagement of Fcγ-receptors triggers a range of downstream signalling events resulting in a diverse array of immune functions. As a result, blockade of Fc-mediated function is an important strategy for the control of several autoimmune and inflammatory conditions. We have generated a hexameric-Fc fusion protein (hexameric-Fc) and tested the consequences of multi-valent Fcγ-receptor engagement in in vitro and in vivo systems. In vitro engagement of hexameric-Fc with FcγRs showed complex binding interactions that altered with receptor density and triggered the internalisation and degradation of Fcγ-receptors. This caused a disruption of Fc-binding and phagocytosis. In vivo, in a mouse ITP model we observed a short half-life of hexameric-Fc but were nevertheless able to observe inhibition of platelet phagocytosis several days after hexameric-Fc dosing. In cynomolgus monkeys, we again observed a short half-life, but were able to demonstrate effective FcγR blockade. These findings demonstrate the ability of multi-valent Fc-based therapeutics to interfere with FcγR function and a potential mechanism through which they could have a sustained effect; the internalisation and degradation of FcγRs.

ENHANCING EU-TAIWAN ECONOMIC COOPERATION AGREEMENT

Directory of Open Access Journals (Sweden)

Chung-hung Cho

2018-01-01

Full Text Available The EU’s 2015 new trade strategy: Trade for all: toward a more responsible trade and investment policy, highlights its key role in keeping markets open worldwide and lists the Asia-Pacific region as the priority party for signing Regional Trade Arrangements (RTAs with the EU. The new strategy allows the EU and its member states to initiate talks on economic cooperation agreement (ECA with Taiwan. This article takes the EU-Asia interregional cooperation as a case study while exploring the role of Taiwan in the region. The first section describes the shift in EU’s trade policies and the special features of the types of interregionalism between the EU and Asia. The second section explores the bilateral trade relations. The third section evaluates the opportunities and the internal and external challenges and limitations of an EU-Taiwan ECA, emphasizing the factor of mainland China. The final section provides conclusions on the influence of an EU-Taiwan ECA on the relations of EUTaiwan considering economic and non-economic factor

48 CFR 252.205-7000 - Provision of information to cooperative agreement holders.

Science.gov (United States)

2010-10-01

... has an agreement with the Defense Logistics Agency to furnish procurement technical assistance to business entities. (b) The Contractor shall provide cooperative agreement holders, upon their request, with... defense contracts. The list shall include the business address, telephone number, and area of...

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations. The Agreement with the League of Arab States

International Nuclear Information System (INIS)

1972-01-01

The text of the Agency's agreement for co-operation with the League of Arab States is reproduced in this document for the information of all Members. The agreement entered into force on 15 December 1971 pursuant to Article IX

A {sup 99m}Tc-labeled dual-domain cytokine ligand for imaging of inflammation

Energy Technology Data Exchange (ETDEWEB)

Liu Zhonglin, E-mail: zliu@radiology.arizona.edu [Department of Radiology, University of Arizona, Tucson, P.O. Box 245067 Tucson, AZ 85724-5067 (United States); Wyffels, Leonie; Barber, Christy [Department of Radiology, University of Arizona, Tucson, P.O. Box 245067 Tucson, AZ 85724-5067 (United States); Hui, Mizhou M. [AmProtein, Inc. San Gabriel, CA (United States); Woolfenden, James M. [Department of Radiology, University of Arizona, Tucson, P.O. Box 245067 Tucson, AZ 85724-5067 (United States)

2011-08-15

Introduction: Interleukin (IL)-1 and IL-18 are potent proinflammatory cytokines in inflammation-related diseases. Their actions are regulated by IL-1 receptor antagonist (IL-1ra) and IL-18 binding protein (IL-18bp). This study was designed to {sup 99m}Tc-radiolabel an IL-1ra and IL-18bp dual-domain cytokine ligand, IL-18bp-Fc-IL-1ra, for specific inflammation targeting. Methods: The {sup 99m}Tc-IL-18bp-Fc-IL-1ra was obtained by direct labeling via 2-iminothiolane reduction. Competitive binding of {sup 99m}Tc-labeled and unlabeled IL-18bp-Fc-IL-1ra to rat polymorphonuclear leukocytes was assessed in vitro. A mouse ear edema model was used to evaluate specific targeting properties of {sup 99m}Tc-IL-18bp-Fc-IL1ra in vivo. The correlation between {sup 99m}Tc-IL-18bp-Fc-IL-1ra uptake and {sup 111}In-labeled polymorphonuclear neutrophil infiltration was studied using ischemic-reperfused rat hearts. Results: Direct {sup 99m}Tc-labeling yielded a stable dual-domain cytokine radioligand with radiochemical purity greater than 95% after gel filtration. Competitive binding studies showed specific targeting of {sup 99m}Tc-IL-18bp-Fc-IL-1ra to inflammatory cells. The {sup 99m}Tc-IL-18bp-Fc-IL-1ra uptake was 1.80{+-}0.17 % injected dose per gram (%ID/g) in the inflamed ear without blocking, whereas uptake in the presence of IL-18bp-Fc-IL-1ra was 1.09{+-}0.08 %ID/g (P<.05). The amounts of IL-1{beta} and IL-18 were significantly increased in the inflamed ears compared to the vehicle controls. A significant correlation of {sup 99m}Tc-IL-18bp-Fc-IL-1ra with {sup 111}In-labeled neutrophil distribution was observed in the ischemic-reperfused hearts (P<.001). Conclusion: Targeting proinflammatory cytokines with {sup 99m}Tc-IL-18bp-Fc-IL-1ra may provide a suitable approach for specific detection of inflammatory sites.

The Text of the Fifth Agreement to Extend the 1987 Regional Cooperative Agreement for Research, Development and Training Related to Nuclear Science and Technology (RCA). Extension of Agreement. Latest Status

International Nuclear Information System (INIS)

2012-01-01

The Text of the Fifth Agreement to Extend the 1987 Regional Cooperative Agreement for Research, Development and Training Related to Nuclear Science and Technology (RCA). Extension of Agreement. Latest Status [es

Preliminary comparison of MP sparking characteristics for SF6 insulating gas mixtures and pure SF6

International Nuclear Information System (INIS)

Lindgren, R.; Wegner, H.E.

1978-01-01

Operation of the Brookhaven MP-7 tandem Van de Graaff accelerator with pure SF 6 insulating gas is described. Sparking and terminal voltage were monitored and are compared for operation with a mixture of SF 6 , N 2 , CO 2 and O 2 . The accelerator was found to be more difficult to operate with pure SF 6

USDOE/EPRI BIOMASS COFIRING COOPERATIVE AGREEMENT

Energy Technology Data Exchange (ETDEWEB)

D. Tillman; E. Hughes

1999-04-01

During the period of January 1, 1999 through March 31, 1999, construction was performed in support of two major demonstrations. Major progress was made on several projects including cofiring at Seward (GPU Genco), and Bailly (NIPSCO). Most of the work was focused on construction and system commissioning activities at the Seward and Bailly Generating Stations. Additionally, petroleum coke cofiring testing was completed at the Bailly Generating Station. This report summarizes the activities during the first calendar quarter in 1999--the fourth contract quarter in 1998--of the USDOE/EPRI Biomass Cofiring Cooperative Agreement. It focuses upon reporting the results of construction activities and related events.

75 FR 47282 - Notice of Amendment No. 003 to the Solicitation for Cooperative Agreement Applications (SCAA...

Science.gov (United States)

2010-08-05

... DEPARTMENT OF DEFENSE Defense Logistics Agency Notice of Amendment No. 003 to the Solicitation for Cooperative Agreement Applications (SCAA) Issued on May 5, 2009 AGENCY: Defense Logistics Agency, DOD. ACTION: Amended solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics...

76 FR 76954 - Notice of Amendment No. 004 to the Solicitation for Cooperative Agreement Applications (SCAA...

Science.gov (United States)

2011-12-09

... Cooperative Agreement Applications (SCAA) Issued on July 7, 2010 AGENCY: Defense Logistics Agency, Department of Defense (DoD). ACTION: Amended solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the Department of Defense (DoD) Procurement Technical...

Cooperation Agreements in Biotechnology Companies: An Advantage for the Acquisition of New Capabilities and Growth?

Directory of Open Access Journals (Sweden)

Tomás Gabriel Bas

2006-08-01

Full Text Available Cooperation agreements in biotechnology allow us to observe the complexity surrounding alliances. The market globalization, the exorbitant costs of R&D and the rapid changes in technology, are arguably amongst the principal reasons that push companies to establish cooperation agreements. Biotechnology companies use this instrument to develop external features in the search for resources and missing expertise. This paper sets out to identify if such cooperation agreements in biotechnology companies are an advantage in themselves, sufficient for the acquisition of new capabilities and if they help the growth of these companies. For this approach, a private database of companies in the two most advanced countries in this sector: United States and United Kingdom, will be used.

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations

International Nuclear Information System (INIS)

1961-01-01

The texts of the Agency's agreements for co-operation with the regional inter-governmental organizations listed below, together with the respective protocols authenticating them, are reproduced in this document in the order in which the agreements entered into force, for the information of all Members of the Agency

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations

Energy Technology Data Exchange (ETDEWEB)

NONE

1961-02-07

The texts of the Agency's agreements for co-operation with the regional inter-governmental organizations listed below, together with the respective protocols authenticating them, are reproduced in this document in the order in which the agreements entered into force, for the information of all Members of the Agency.

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations

International Nuclear Information System (INIS)

1961-01-01

The texts of the Agency's agreements for co-operation with the regional inter-governmental organizations listed below, together with the respective protocols authenticating them, are reproduced in this document in the order in which the agreements entered into force, for the information of all Members of the Agency [es

The text of the third agreement to extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (RCA). Extension of agreement

International Nuclear Information System (INIS)

2002-01-01

The text of the Third Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 'the 1987 RCA', is reproduced herein for the information of all Members. Pursuant to Article 1 of the Third Agreement to Extend the 1987 Regional Co-operative Agreement, the 1987 RCA shall continue in force for a further period of five years with effect from 12 June 2002, i.e., through 11 June 2007. As of 15 May 2002, notifications of acceptance had been received by the Director General from the Governments of Bangladesh, China, India, Indonesia, Republic of Korea, Malaysia, Pakistan, Sri Lanka and Viet Nam. The latest status list is attached

77 FR 15361 - Notice of Amendment No. 001 to the Solicitation for Cooperative Agreement Applications (SCAA...

Science.gov (United States)

2012-03-15

... Cooperative Agreement Applications (SCAA) Issued on April 12, 2011 and Amendment No. 005 to the SCAA Issued on July 7, 2010 AGENCY: Defense Logistics Agency, DoD. ACTION: Amended solicitations for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the Department of...

Cooperative Agreements to Support Communities Affected by the BP Oil Spill

Science.gov (United States)

The environmental justice cooperative agreements are designed to support communities in Alabama, Florida, Louisiana, Mississippi, and Texas that are directly affected by the Deepwater Horizon oil spill in the Gulf of Mexico.

CENTER FOR PULSED POWER DRIVEN HIGH ENERGY DENSITY PLASMA STUDIES

Energy Technology Data Exchange (ETDEWEB)

Professor Bruce R. Kusse; Professor David A. Hammer

2007-04-18

This annual report summarizes the activities of the Cornell Center for Pulsed-Power-Driven High-Energy-Density Plasma Studies, for the 12-month period October 1, 2005-September 30, 2006. This period corresponds to the first year of the two-year extension (awarded in October, 2005) to the original 3-year NNSA/DOE Cooperative Agreement with Cornell, DE-FC03-02NA00057. As such, the period covered in this report also corresponds to the fourth year of the (now) 5-year term of the Cooperative Agreement. The participants, in addition to Cornell University, include Imperial College, London (IC), the University of Nevada, Reno (UNR), the University of Rochester (UR), the Weizmann Institute of Science (WSI), and the P.N. Lebedev Physical Institute (LPI), Moscow. A listing of all faculty, technical staff and students, both graduate and undergraduate, who participated in Center research activities during the year in question is given in Appendix A.

DELTA-DIESEL ENGINE LIGHT TRUCK APPLICATION Contract DE-FC05-97OR22606 Final Report

Energy Technology Data Exchange (ETDEWEB)

Hakim, Nabil Balnaves, Mike

2003-05-27

DELTA Diesel Engine Light Truck Application End of Contract Report DE-FC05-97-OR22606 EXECUTIVE SUMMARY This report is the final technical report of the Diesel Engine Light Truck Application (DELTA) program under contract DE-FC05-97-OR22606. During the course of this contract, Detroit Diesel Corporation analyzed, designed, tooled, developed and applied the ''Proof of Concept'' (Generation 0) 4.0L V-6 DELTA engine and designed the successor ''Production Technology Demonstration'' (Generation 1) 4.0L V-6 DELTA engine. The objectives of DELTA Program contract DE-FC05-97-OR22606 were to: Demonstrate production-viable diesel engine technologies, specifically intended for the North American LDT and SUV markets; Demonstrate emissions compliance with significant fuel economy advantages. With a clean sheet design, DDC produced the DELTA engine concept promising the following attributes: 30-50% improved fuel economy; Low cost; Good durability and reliability; Acceptable noise, vibration and harshness (NVH); State-of-the-art features; Even firing, 4 valves per cylinder; High pressure common rail fuel system; Electronically controlled; Turbocharged, intercooled, cooled EGR; Extremely low emissions via CLEAN Combustion{copyright} technology. To demonstrate the engine technology in the SUV market, DDC repowered a 1999 Dodge Durango with the DELTA Generation 0 engine. Fuel economy improvements were approximately 50% better than the gasoline engine replaced in the vehicle.

Final Report for DOE Grant DE-FG02-03ER25579; Development of High-Order Accurate Interface Tracking Algorithms and Improved Constitutive Models for Problems in Continuum Mechanics with Applications to Jetting

Energy Technology Data Exchange (ETDEWEB)

Puckett, Elbridge Gerry [U.C. Davis, Department of Mathematics; Miller, Gregory Hale [.C. Davis, Department of Chemical Engineering

2012-10-14

published by Dr. Phillip Colella, the head of ANAG, and some of his colleagues. Chris Algieri is now employed as a staff member in Dr. Bill Collins' Climate Science Department in the Earth Sciences Division at LBNL working with computational models of climate change. Finally, it should be noted that the work conducted by Professor Puckett and his students Sarah Williams and Chris Algieri and described in this final report for DOE grant # DE-FC02-03ER25579 is closely related to work performed by Professor Puckett and his students under the auspices of Professor Puckett's DOE SciDAC grant DE-FC02-01ER25473 An Algorithmic and Software Framework for Applied Partial Differential Equations: A DOE SciDAC Integrated Software Infrastructure Center (ISIC). Dr. Colella was the lead PI for this SciDAC grant, which was comprised of several research groups from DOE national laboratories and five university PI's from five different universities. In theory Professor Puckett tried to use funds from the SciDAC grant to support work directly involved in implementing algorithms developed by members of his research group at UCD as software that might be of use to Puckett's SciDAC CoPIs. (For example, see the work reported in Section 2.2.2 of this final report.) However, since there is considerable lead time spent developing such algorithms before they are ready to become `software' and research plans and goals change as the research progresses, Professor Puckett supported each member of his research group partially with funds from the SciDAC APDEC ISIC DE-FC02-01ER25473 and partially with funds from this DOE MICS grant DE-FC02-03ER25579. This has necessarily resulted in a significant overlap of project areas that were funded by both grants. In particular, both Sarah Williams and Chris Algieri were supported partially with funds from grant # DE-FG02-03ER25579, for which this is the final report, and in part with funds from Professor Puckett's DOE SciDAC grant # DE-FC

A Comparative Study on Safeguards Implementation under Bilateral Nuclear Cooperation Agreements and the IAEA Comprehensive Safeguards Agreement

Energy Technology Data Exchange (ETDEWEB)

Jeon, Jihye; Kim, Ki-Hyun; Lee, Young Wook [Korea Institute of Nuclear Nonproliferation and Control, Daejeon (Korea, Republic of)

2016-10-15

A Nuclear Cooperation Agreement (NCA) requires several conditions, so-called obligations, on the items under the agreement such as: 1) peaceful use, 2) retransfer consent, 3) consent prior to reprocessing or enrichment and 4) safeguards and security. These obligations of the NCAs are imposed by the supplier country. The Comprehensive Safeguards Agreement (CSA) between the International Atomic Energy Agency (IAEA) and its member states require similar activities. However, there is a significant gap in nuclear material accountancy between safeguards implementation under the NCA and CSA. The difference of those two frameworks is compared herein, focusing on the unique features of the NCA safeguards and its implications are presented. In this study, the NCAs between the ROK and Canada, Australia and US were analyzed since each of them is one of the ROK’s major nuclear trading partners. The safeguards implementation under the NCA is usually specified in an Administrative Arrangement (AA) under the Agreement. The ROK has two AAs in force with Canada and Australia among 29 countries with NCA. Recently, the AA with Canada was revised in December 2015, with those concepts mentioned above. The AA with the US is currently under discussion. Cooperation in nuclear energy between two countries could be further enhanced through reliable implementation of the NCA undertakings. Taking into account the unique features of the NCA, we need to establish effective strategy for fulfilling the obligation under the Agreement.

Reference Ranges in [(99m)Tc]Mercaptoacetyltriglycerine Renography

DEFF Research Database (Denmark)

Rewers, Kate I; Hvidsten, Svend; Gerke, Oke

2015-01-01

PURPOSE: The purpose of the study was to define reference ranges for quantitative parameters in [(99m)Tc]mercaptoacetyltriglycerine ([(99m)Tc]MAG3) renography to assist interpretation in a semi-automated (Xeleris, GE) compared to a manual (Picker, Odyssey) software package. PROCEDURES: Forty......-eight subjects approved for renal donation were evaluated with [(99m)Tc]MAG3 renography using both the Xeleris and the Picker software. RESULTS: Reference ranges for the two software were comparable regarding the relative function of the two kidneys (the split function, SF) and the residual activities (RA......). The time to peak whole-kidney activities (T max whole-kidney) was more dependent on the type of software. Using Bland-Altman limits, we found good and acceptable agreement between the two methods. CONCLUSIONS: We found good correlation between renography results using the Xeleris and Picker software...

NERI PROJECT 99-119. TASK 2. DATA-DRIVEN PREDICTION OF PROCESS VARIABLES. FINAL REPORT

Energy Technology Data Exchange (ETDEWEB)

Upadhyaya, B.R.

2003-04-10

This report describes the detailed results for task 2 of DOE-NERI project number 99-119 entitled ''Automatic Development of Highly Reliable Control Architecture for Future Nuclear Power Plants''. This project is a collaboration effort between the Oak Ridge National Laboratory (ORNL,) The University of Tennessee, Knoxville (UTK) and the North Carolina State University (NCSU). UTK is the lead organization for Task 2 under contract number DE-FG03-99SF21906. Under task 2 we completed the development of data-driven models for the characterization of sub-system dynamics for predicting state variables, control functions, and expected control actions. We have also developed the ''Principal Component Analysis (PCA)'' approach for mapping system measurements, and a nonlinear system modeling approach called the ''Group Method of Data Handling (GMDH)'' with rational functions, and includes temporal data information for transient characterization. The majority of the results are presented in detailed reports for Phases 1 through 3 of our research, which are attached to this report.

Phase I Report, US DOE GRED II Program

Energy Technology Data Exchange (ETDEWEB)

Fairbank Engineering Ltd.

2003-04-23

Noramex Corporation Inc, a Nevada company, owns a 100% interest in geothermal leases at the Blue Mountain Geothermal Area, Humboldt County, Nevada. The company is exploring the site for a geothermal resource suitable for development for electric power generation or In the spring of 2002, Noramex drilled the first geothermal observation hole at Blue Mountain, under a cost-share program with the U.S Department of Energy (DOE), under the DOE's Geothermal Exploration and Resource Definition (GRED) program, (Cooperative Agreement No. DE-FC04-00AL66972). DEEP BLUE No.1 was drilled to a total depth of 672.1 meters (2205 feet) and recorded a maximum temperature of 144.7 C (292.5 F). Noramex Corporation will now drill a second slim geothermal observation test hole at Blue Mountain, designated DEEP BLUE No.2. The hole will be drilled under a cost-share program with the DOE, under the DOE's Geothermal Exploration and Resource Definition II (GRED II) program, (Cooperative Agreement No. DE-FC04-2002AL68297). This report comprises Phase I of Cooperative Agreement No. DE-FC04-2002AL68297 of the GRED II program. The report provides an update on the status of resource confirmation at the Blue Mountain Geothermal Area, incorporating the results from DEEP BLUE No.1, and provides the technical background for a second test hole. The report also outlines the proposed drilling program for slim geothermal observation test hole DEEP BLUE No.2.

Promotion of cooperation induced by two-sided players in prisoner's dilemma game

Science.gov (United States)

Su, Zhen; Li, Lixiang; Xiao, Jinghua; Podobnik, B.; Stanley, H. Eugene

2018-01-01

We examine how real-world individuals and companies can either reach an agreement or fail to reach an agreement after several stages of negotiation. We use a modified prisoner's dilemma game with two-sided players who can either cooperate or not cooperate with their neighbors. We find that the presence of even a small number of these two-sided players substantially promotes the cooperation because, unlike the rock-paper-scissors scenario, when the cooperators change to the non-cooperators to gain a payoff, they can turn to the two-sided players and continue negotiating. We find that the network structure influences the spread of strategies. Lattice and regular-random (RR) networks benefit the spread of both non-cooperation and two-sided strategies, but scale-free (SF) networks stop both strategies. We also find that the Erdös-R e ´ nyi (ER) network promotes the two-sided strategy and blocks the spread of non-cooperation. As the ER network density decreases, and the network degree is lowered the lifetime of non-cooperators increases. Our results expand our understanding of the role played by the two-sided strategy in the growth of the cooperative behavior in networks.

The negotiation of the new US/EURATOM co-operation agreement

International Nuclear Information System (INIS)

Kraemer, J.

1992-01-01

The current Agreements for Cooperation between the United States (U.S) and the countries of the European Community will expire on December 31, 1995. Several difficult issues concerning, inter alia, the application of U.S. consent rights over reprocessing of spent fuel and storage of plutonium in the Community and transfers of materials and equipment from the Community, stand between the negotiators and a successor agreement. The U.S. negotiators will likely use the recent Agreement with Japan, with its consent right/programmatic approval approach, as their model text. The Community negotiators are averse to accepting Agreement conditions that stem solely from requirements of U.S. legislation, and may seek technical or commercial benefits in return for any concessions they give. Both sides have compelling incentives to conclude a successor agreement, if only because the political and economic consequences of failure would be so severe. (author)

IAEA and International Science and Technology Center sign cooperative agreement

International Nuclear Information System (INIS)

2008-01-01

Full text: The IAEA and the International Science and Technology Center (ISTC) today signed an agreement that calls for an increase in cooperation between the two organizations. The memorandum of understanding seeks to amplify their collaboration in the research and development of applications and technology that could contribute to the IAEA's activities in the fields of verification and nuclear security, including training and capacity building. IAEA Safeguards Director of Technical Support Nikolay Khlebnikov and ISTC Executive Director Adriaan van der Meer signed the Agreement at IAEA headquarters in Vienna on 22 October 2008. (IAEA)

Agreements

International Nuclear Information System (INIS)

2001-01-01

These columns summarize the different bilateral and multilateral agreements concluded recently between the different OECD countries and concerning the nuclear energy domain: Argentina - Australia: Agreement concerning Co-operation in the Peaceful Uses of Nuclear Energy (2001). Argentina - Brazil: Joint Declaration regarding the Creation of the Argentinean-Brazilian Agency for Nuclear Energy Applications (2001). Australia - Czech Republic / Australia - Hungary: Agreements on Co-operation in Peaceful Uses of Nuclear Energy and the Transfer of Nuclear Material (2001). Australia - Indonesia: Arrangement Concerning Co-operation on Nuclear Safeguards and Related Matters (2001). Austria - Switzerland: Agreement on the Early Exchange of Information in the Field of Nuclear Safety and Radiation. Brazil - United States: Extension of the Agreement concerning Research and Development in Nuclear Material Control, Accountancy, Verification, Physical Protection, and Advanced Containment and Surveillance Technologies for International Safeguards Applications (2001). Czech Republic - Republic of Korea: Agreement for Co-operation in the Peaceful Uses of Nuclear Energy (2001). European Union- Russian Federation: Agreements on Nuclear Safety and Controlled Nuclear Fusion (2001). France - United States: Agreement for Co-operation in Advanced Nuclear Reactor Science and Technology (2001). Japan - United Kingdom: Co-operation Agreement on Advanced Nuclear Fuel Cycle, Fast Breeder Reactor and Other Related Technologies (2001). Republic OF Korea - United States: Annex IV Joint Project on Cintichem Technology (2000). Morocco - United States: Protocol amending the Co-operation Agreement on the Peaceful Uses of Nuclear Energy (2001). Multilateral Agreements: Agreement for Information Exchange on Radiological Surveillance in Northern Europe (2001). Status of Conventions in the Field of Nuclear Energy. (author)

The Text of a Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology. Latest Status. Declarations/Reservations; Texto de un Acuerdo de Cooperacion Regional Para la Investigacion, el Desarrollo y la Capacitacion en Materia de Ciencias y Tecnologia Nucleares

Energy Technology Data Exchange (ETDEWEB)

NONE

1972-08-18

The text of a Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology between the Agency and Member States is reproduced herein for the information of all Members. Section 9 thereof specifies the Members that may become party to it [Spanish] Para conocimiento de todos los Estados Miembros en el presente documento se transcribe el texto de un Acuerdo de Cooperacion Regional para la investigacion, el desarrollo y la capacitacion en materia de ciencias y tecnologia nucleares entre el Organismo y los Estados Miembros. En la Seccion 9 se especifican los Estados Miembros que pueden ser partes en el Acuerdo.

77 FR 30294 - Award of a Single Source Cooperative Agreement Grant to the Congressional Hunger Center in...

Science.gov (United States)

2012-05-22

... Source Cooperative Agreement Grant to the Congressional Hunger Center in Washington, DC AGENCY: Office of...) announces the award of a single source cooperative agreement to the Congressional Hunger Center in Washington, DC to support a Bill Emerson National Hunger Fellow. C.F.D.A. Number: 93.647. Statutory Authority...

UTILITY ADVANCED TURBINE SYSTEMS (ATS) TECHNOLOGY READINESS TESTING PHASE 3 RESTRUCTURED (3R)

Energy Technology Data Exchange (ETDEWEB)

Unknown

2000-03-17

This scope document defines the work scope for accomplishing the design of the GE MS7001H and MS9001H (7H and 9H) combined-cycle power systems under the original ATS Phase 3 DOE Cooperative Agreement No. DE-FC21-95MC31176, and incorporates changes in scope required to convert Phase 3 to the ''restructured'' Phase 3R as defined in Amendment A012 to the Cooperative Agreement.

The new U.S.-ROK civil nuclear cooperation agreement

International Nuclear Information System (INIS)

Tazaki, Makiko; Shimizu, Ryo; Suda, Kazunori

2016-10-01

From March 2010, the U.S. and the Republic of Korea (ROK) started a negotiation for revising “Agreement for Cooperation between the Government of the United States of America and the Government of the Republic of Korea Concerning Civil Uses of Atomic Energy” which had entered into force in March 1973. A top priority of their negotiation was whether or not the U.S. grants its advanced consent to the ROK’s engagement in uranium enrichment (less than 20%) and reprocessing (pyroprocessing) of U.S.-origin nuclear material and spent fuel, despite the U.S.’s nonproliferation policy of preventing emergence of new non-nuclear-weapon states with such sensitive capabilities. Under the “Agreement for Cooperation Between the Government of the United States of America and the Government of the Republic of Korea Concerning Peaceful Uses of Nuclear Energy” (“the new agreement”) which entered into force in November 2015, the ROK has been granted to engage in domestic uranium enrichment and reprocessing activities at certain facilities prescribed in Annexes III and II to the Agreed Minute of the new agreement. As of the date of validation of the agreement, however, no facility names have been appeared in both Annexes. Therefore, as a matter of practice, the ROK has not yet been able to engage in those activities, although the new agreement creates options for the future. Such result has not necessarily and directly reflected both states’ intention of the advanced consent, but considering various facts including that 1) ROK’s domestic uranium enrichment and reprocessing capabilities are neither only nor urgent requisites for ROK’s civil nuclear activities, 2) ROK’s acquisition of such sensitive capabilities could further encourage DPRK’s provocative nuclear activities, and 3) the U.S. and the ROK have been in the process of conducting “Joint Fuel Cycle Study”, in order to pursue technical and economic feasibilities as well as nonproliferation

Analysis, simulation and control of electromagnetic transients in gas insulated substations in SF6 by means of grounding grid; Analisis, simulacion y control de transitorios electromagneticos en subestaciones aisladas en SF6 por medio de redes de tierra

Energy Technology Data Exchange (ETDEWEB)

Hernandez Martinez, Gaston

2007-12-15

The use of SF6 substations is actually an extensive practice in industrial countries. Some of they replace conventional air substations and the others are new designs in the range of 34.5 kV to 1000 kV. During the switching events in a GIS substation, very fast transients overvoltage may appear and originate faults, malfunctions in the electronic and control equipment, besides the risk by electrical discharge in the personnel who are working in the substation. These overvoltage are produced by the collapse of the electric field on GIS terminals during switching events originating Very Fast Transient Overvoltage (VFTO) and the increase of the Transient Enclosure Voltage (TEV). This investigation is focused on diminishing the magnitude of the VFTO and TEV by designing and redesigning grounding grids for gas insulated substations in SF6. The objective of this work is to design a grounding grid for an air substation and redesign it for a GIS substation. The computer simulation uses a detailed model of the substation in SF6 interconnected with an aerial grounding grid and by adding methodologically grounding rods, the VFTO and TEV within the GIS are reduced. The results of the computer simulation show that the designed grounding grid allows considerably diminishing the magnitude of the VFTO; nevertheless this design doesn't appropriately attenuate the TEV magnitude. [Spanish] Hoy en dia, el uso de subestaciones GIS se ha generalizado. Algunas reemplazan a las subestaciones aereas y otras son de nueva creacion y se instalan en tensiones de 34.5kV hasta 1000 kV. Durante las operaciones de maniobra de la subestacion GIS, se presentan sobretensiones transitorias ultra rapidas que pueden dar origen a diversas fallas, a un malfuncionamiento del equipo electronico y de control asi como el riesgo por descarga electrica al personal que labora en la subestacion. Estas sobretensiones se producen debido al colapso del campo electrico en terminales del interruptor ante

International cooperation and nuclear development. On the approval of the Argentina - Australia co-operation agreement for the peaceful uses of the nuclear energy

International Nuclear Information System (INIS)

Gasol Varela, Claudia

2005-01-01

Argentina, with its National Atomic Energy Commission, has been maintaining during more than half a century an important activity for the development of nuclear energy and its peaceful applications. As a consequence of this tradition, it has strengthened its experience with the contribution to the international co-operation, as in the case of the Argentina-Australia co-operation agreement for the peaceful uses of nuclear energy, signed on August 8th, 2001 and ratified by the Argentine Law No. 26.014. Both countries are parties of several international treaties and conventions: physical protection of nuclear materials, nuclear non-proliferation, nuclear accidents, fuel and wastes management, and others. These legal instruments are complemented by agreements for the applications of safeguards with the International Atomic Energy Agency. On the basis of these regulations the parties agreed to establish co-operation conditions in accordance with the pledge of non-proliferation. Furthermore the agreement states that the Governments have the power to designate the governmental organizations or individuals, as well as the legal entities, which will carry out the co-operation. The co-operation covers basic and applied research, development, design, construction and operation of nuclear reactors and other installations of the nuclear fuel cycle, its related technology as well as nuclear medicine, radioisotopes, etc [es

Bilateral agreements

International Nuclear Information System (INIS)

1998-01-01

Ten bilateral agreements are presented. These are: 1) Co-operation agreement relating to the peaceful uses of nuclear energy between Argentina and EURATOM (1996); 2) Agreement on co-operation in the peaceful uses of nuclear energy between Argentina and Greece (1997); 3) Implementing arrangement for technical exchange and co-operation in the area of peaceful uses of nuclear energy between Argentina and the United States (1997); 4) Agreement concerning co-operation in nuclear science and technology between Australia and Indonesia (1997); 5) Implementation of the 1985 Agreement for co-operation concerning the peaceful uses of nuclear energy between the People's Republic of China and the United States (1998); 6) Protocol of co-operation between France and Lithuania (1997); 7) Agreement on co-operation in energy research, science and technology, and development between Germany and the United States (1998); 8) Agreement on early notification of a nuclear accident and exchange of information on nuclear facilities between Greece and Romania (1997); 9) Agreement on early notification of nuclear accidents and co-operation in the field of nuclear safety between Hungary and the Ukraine (1997); 10) Agreement in the field of radioactive waste management between Switzerland and the United States (1997). (K.A.)

Phase 2 Reese River Geothermal Project Slim Well 56-4 Drilling and Testing

Energy Technology Data Exchange (ETDEWEB)

Henkle, William R.; Ronne, Joel

2008-06-15

This report covers the drilling and testing of the slim well 56-4 at the Reese River Geothermal Project in Lander County, Nevada. This well was partially funded through a GRED III Cooperative Funding Agreement # DE-FC36-04GO14344, from USDOE.

Regional Cooperation Agreement for Asia and the Pacific (RCA). A mechanism for nuclear technology transfer

International Nuclear Information System (INIS)

Bin Muslim, N.

1993-01-01

The paper presents the regional cooperation programs of the IAEA which have as purpose to promote the applications of peaceful uses of atomic energy and to transfer technology to the developing countries. The paper focusses on the (RCA) program for Asia and the Pacific, it is considered the most important mechanism for genuine technology transfer. The annex no 1 lists the full text of the Regional Cooperative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 1987 (13 articles). The annex no.3 lists also the full text of the African Regional Cooperative Agreement for Research, Development and training Related to Nuclear Science and Technology (14 articles). 11 refs., 17 tabs

Shaanxi Youser Group Signs Strategic Cooperation Agreement with China XD Group

Institute of Scientific and Technical Information of China (English)

2012-01-01

<正>On November 6, the signing ceremony for the strategic cooperation agreement between four provincial enterprises including Shaanxi Youser Group and China XD Group was heldin Xi’an. This was a strategic move taken by the group to carry out the gist of the provincial CPC committee

Valores de referencia de la población diabética para la versión española del SF-12v2 Reference values of the Spanish version of the SF-12v2 for the diabetic population

Directory of Open Access Journals (Sweden)

Olga Monteagudo Piqueras

2009-12-01

Full Text Available Objetivo: Los cuestionarios de salud percibida son instrumentos que proporcionan información importante para la investigación en resultados de salud. La familia de cuestionarios SF requiere valores de referencia para interpretar el impacto en calidad de vida relacionada con la salud. Estudios previos han proporcionado estos valores para la población general española, pero no para condiciones específicas de enfermedad. El objetivo de este trabajo ha sido obtener, para la versión española del SF-12v2, los valores de referencia de la población diabética de la Región de Murcia. Métodos: Estudio transversal con encuesta telefónica a 1.500 personas representativas de los diabéticos tipo 1 y 2, no institucionalizados, de 18 años y más, de la Región de Murcia. Se calcularon medidas de tendencia central, dispersión y percentiles de las ocho dimensiones, e índices resumen (físico y mental, del SF-12v2. Resultados: El índice de salud mental (ISM medio (50,5±12,8 fue superior al físico (ISF (42,5±11,8. En función del sexo, los hombres obtuvieron un ISM (53,6±11,6 y un ISF (44,9±11,2 mejores que las mujeres (ISM: 47,7±13,2; ISF: 40,3±11,9. La dimensión mejor valorada fue la vitalidad (hombres: 57,2±11,1; mujeres: 51,9±12,1, y la peor la salud general (hombres: 39,0±9,7; mujeres: 35,8±10,0. Estratificando por grupos de edad, los hombres seguían presentando mejores puntuaciones que las mujeres. Conclusiones: Estos resultados deben ser considerados como valores de referencia de la población diabética de la Región de Murcia de la versión española del SF-12v2, y pueden ser útiles para establecer objetivos terapéuticos, comparar con población general, sana y con otras enfermedades.Objective: Perceived health status questionnaires provide important information for health outcomes research. Reference measures are required to interpret the health-related quality of life questionnaires belonging to the short form (SF health

The Text of the Fourth Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology (RCA). Extension of Agreement. Latest Status

International Nuclear Information System (INIS)

2007-01-01

The text of the Fourth Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 'the 1987 RCA', is reproduced herein for the information of all Members

A national laboratory/private industry cooperative research and development agreement (CRADA)

International Nuclear Information System (INIS)

Pritchard, D.A.

1996-01-01

This paper provides an overview of the history and process of establishing a cooperative research and development agreement (CRADA) between Sandia National Laboratories and Magnavox Electronic Systems Company for the design, development, and testing of a 360-degree scanning, imaging, intrusion detection sensor. The subject of the CRADA is the Advanced Exterior Sensor (AES). It is intended for exterior use at ranges from 50 to 1,500 meters and uses a combination of three sensing technologies (infrared, visible, and radar) and a new data processing method to provide low false-alarm intrusion detection and tracking combined with immediate visual assessment. The establishment of this CRADA represents a new paradigm in the cooperation between the Department of Defense, the Department of Energy, the National Laboratories and Private Industry. Although a formal document has now been executed, a CRADA is, nonetheless, primarily an agreement to work with each other to achieve goals that might otherwise be unattainable. For the DoD, a program continues in the face of uncertain funding. For the DOE, a CRADA is in place that meets congressionally mandated guidelines. For Sandia, sponsors are in agreement on requirements and synergistic funding. And for Magnavox, an opportunity is in hand to work with researchers in developing advanced security technology

17.879 law approve it integral agreement about Energetic Cooperation between Republic Oriental del Uruguay Government and Republic Bolivariana de Venezuela

International Nuclear Information System (INIS)

2005-01-01

The 17.879 law describe the Uruguay -Venezuela Agreement with the followings items about :main aims and cooperation areas, information uses, budget, competent authorities, mixed commission, labour relationship, controversy solutions, sovereignty, duties, signal with others, duration and force entrance

The Text of the Fourth Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology (RCA). Extension of Agreement. Latest Status

International Nuclear Information System (INIS)

2007-01-01

The text of the Fourth Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 'the 1987 RCA', is reproduced herein for the information of all Members [es

The Text of the Third Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology (RCA). Latest Status. Extension of Agreement

International Nuclear Information System (INIS)

2002-01-01

The text of the Third Agreement to Extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, t he 1987 RCA , is reproduced herein for the information of all Members [es

Substituição da Proteína do Farelo de Soja pela Proteína do Farelo de Canola em Rações para Alevinos de Curimbatá (Prochilodus lineatus V. Replacement of Soybean Meal Protein by Canola Meal Protein in "Curimbatá" (Prochilodus lineatus V. Fingerling Diets

Directory of Open Access Journals (Sweden)

Eliana Maria Galdioli

2002-01-01

Full Text Available Objetivando verificar a influência da substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC, em rações para alevinos de curimbatá, foram utilizados 120 animais com peso médio de 1,88 ± 0,82 g e comprimento total médio de 5,40 ± 0,99 cm, distribuídos em um delineamento inteiramente casualizado com seis tratamentos e quatro repetições em aquários de vidro (50 L, com cinco alevinos por unidade experimental. As rações foram formuladas para serem isoprotéicas (26,00%, isocálcicas (0,90% e isofosfóricas (0,70%, com níveis crescentes de substituição da proteína do FS pela do FC (0,00; 20,00; 40,00; 60,00; 80,00 e 100,00%, o que correspondeu a 0,00; 8,03; 16,10; 24,10; 32,15 e 43,12% de inclusão do FC nas rações e fornecidas por um período de 30 dias. Os parâmetros físico-químicos da água foram medidos a cada sete dias. Observou-se redução linear do ganho de peso e da taxa de eficiência protéica e aumento linear da taxa de conversão alimentar, com aumento da inclusão do FC nas rações. A taxa de sobrevivência e o custo de ração/kg ganho não foram afetados com o uso do FC nas rações. Os valores da temperatura da água, do pH e da condutividade elétrica permaneceram dentro dos níveis adequados. Concluiu-se que o aumento dos níveis de inclusão da proteína do farelo de canola nas rações para alevinos de curimbatá acarretou redução no desempenho dos mesmos.The influence of the substitution of soybean meal protein (SM by canola meal protein (CM in Prochilodus lineatus fingerling diets was verified. One hundred and twenty specimens, averaging weight 1.88±0.82g and total length 5.40±0.99cm, was assigned to a completely randomized randomized design, with six treatments and four replicates, in a 50 L glass aquarium, with five fingerlings in each experimental unit. Isoprotein (26.00%, isocalcium (0.90% and isophosphorus (0.70% diets were formulated with increasing replacement

The Text of the Safeguards Agreement of 26 February 1976 between the Agency, Brazil and the Federal Republic of Germany; Texto Del Acuerdo De 26 De Febrero De 1976 Entre El Organismo, El Brasil Y La Republica Federal De Alemania Para La Aplicacion De Salvaguardias

Energy Technology Data Exchange (ETDEWEB)

NONE

1976-05-27

The text of the Agreement of 26 February 1976 between the Agency, Brazil and the Federal Republic of Germany relating to the agreement of 27 June 1975 between the two Governments for co-operation in the peaceful uses of nuclear energy is reproduced in this document for the information of all Members [Spanish] Para informacion de todos los Estados Miembros, en el presente documento se transcribe el texto del Acuerdo de 26 de febrero de 1976 concertado entre el Organismo, el Brasil y la Republica Federal de Alemania en relacion con el Acuerdo de 27 de junio de 1975 entre los dos Gobiernos relativo a la cooperacion en la esfera de los usos pacificos de la energia nuclear.

The regional co-operative agreement for research, development and training related to nuclear science and technology

International Nuclear Information System (INIS)

Fowler, E.

1978-01-01

The history of the Agreement, known as the RCA, is given and the operation of the Agreement, its achievements and current projects are described. The Agreement entered into force in 1972 for a period of five years and has been extended for an additional five years. Any IAEA Member State in the area of South Asia, South East Asia, the Pacific and the Far East may become a party to the Agreement. The purpose of the Agreement is to promote and co-ordinate research, development and training projects in nuclear science and technology through co-operation between the appropriate national institutions and with the assistance of the IAEA. The current RCA co-operative projects cover a broad spectrum of technologies and interests, among which are: food and agriculture, medicine, environmental research, industrial applications, training, research reactor use including radioisotope production, and physical research such as nuclear data programs

Qualidade de vida entre adolescentes: estudo seccional empregando o SF-12

Directory of Open Access Journals (Sweden)

Marise Fagundes Silveira

2013-07-01

Full Text Available A adolescência é um período em que comportamentos potencialmente lesivos ao estado de saúde podem ser iniciados. A avaliação da qualidade de vida nesse contingente torna-se útil para a identificação de grupos em maior risco para comprometimento do bem estar geral. O presente estudo objetivou avaliar a qualidade de vida e fatores associados em uma amostra de 754 adolescentes, com faixa etária de 15 a 19 anos. Para a mensuração da qualidade de vida foi utilizada a versão na língua portuguesa do questionário 12-Item Short-Form Health Survey (SF 12. Os resultados apontaram níveis satisfatórios de qualidade de vida, sendo estes maiores com a prática frequente de atividade física e a ausência de condições como atividades trabalhistas e consumo de tabaco e bebida alcóolica. O sexo feminino foi correlacionado a menores escores em aspectos mentais da qualidade de vida.

A Fair Cooperative MAC Protocol in IEEE 802.11 WLAN

Directory of Open Access Journals (Sweden)

Seyed Davoud Mousavi

2018-05-01

Full Text Available Cooperative communication techniques have recently enabled wireless technologies to overcome their challenges. The main objective of these techniques is to improve resource allocation. In this paper, we propose a new protocol in medium access control (MAC of the IEEE 802.11 standard. In our new protocol, which is called Fair Cooperative MAC (FC-MAC, every relay node participates in cooperation proportionally to its provided cooperation gain. This technique improves network resource allocation by exploiting the potential capacity of all relay candidates. Simulation results demonstrate that the FC-MAC protocol presents better performance in terms of throughput, fairness, and network lifetime.

An analysis for formats to the cooperative nuclear nonproliferation agreements

International Nuclear Information System (INIS)

Shin, Sung Tack

1998-01-01

A country's nuclear program can be designed to support nuclear research, the production of energy, and the production of nuclear materials for medical and industrial applications or for use in nuclear weapons, or any combination of these objectives. One significant concern is the diversion of nuclear materials from peaceful nuclear activities to convert weapons programs. Other concerns include the accidental release and transport of radionuclides. The framework for cooperative monitoring consists of context, agreement, parameters and monitoring options. Nuclear material and energy production activities provide nuclear materials for medical and industrial applications, produce electrical power or heat for general use, and possibly support the production of nuclear materials for weapons. All types of nuclear agreements could increase transparency and/or reduce tensions in a regional setting. This article explains about nuclear agreements of South Pacific Nuclear-Free Zone, Korean Peace Zone, Intermediate-Range Nuclear Forces Treaty, Convention on Early Notification of a Nuclear Accident and Convention on the Physical Protection of Nuclear Materials. (Yi, J. H.)

Effect of Ponderomotive Terms on Heat Flux in Laser-Produced Plasmas

Science.gov (United States)

Li, G.

2005-10-01

A laser electromagnetic field introduces ponderomotive termsootnotetextV. N. Goncharov and G. Li, Phys. Plasmas 11, 5680 (2004). in the heat flux in a plasma. To account for the nonlocal effects in the ponderomotive terms, first, the kinetic equation coupled with the Maxwell equations is numerically solved for the isotropic part of the electron distribution function. Such an equation includes self-consistent electromagnetic fields and laser absorption through the inverse bremsstrahlung. Then, the anisotropic part is found by solving a simplified Fokker--Planck equation. Using the distribution function, the electric current and heat flux are obtained and substituted into the hydrocode LILAC to simulate ICF implosions. The simulation results are compared against the existing nonlocal electron conduction modelsootnotetextG. P. Schurtz, P. D. Nicola"i, and M. Busquet, Phys. Plasmas 9, 4238 (2000). and Fokker--Planck simulations. This work was supported by the U.S. Department of Energy Office of Inertial Confinement Fusion under Cooperative Agreement No. DE-FC52-92SF19460.

Effects of the Ponderomotive Terms in the Thermal Transport on the Hydrodynamic Flow in Inertial Confinement Fusion Experiments

Science.gov (United States)

Goncharov, V. N.; Li, G.

2004-11-01

Electron thermal transport is significantly modified by the laser-induced electric fields near the turning point and at the critical surface. It is shown that such modifications lead to an additional limitation in the heat flux in laser-produced plasmas. Furthermore, the ponderomotive terms in the heat flux lead to a steepening in the electron-density profile, which is shown to be a larger effect than the profile modification due to the ponderomotive force [W.L. Kruer, The Physics of Laser--Plasma Interactions, Frontiers in Physics, Vol. 73, edited by D. Pines (Addison-Wesley, Redwood City, CA, 1988)]. To take into account the nonlocal effects, the delocalization model developed in Ref. 2 [G.P. Schurtz, Ph.D. Nicolaï, and M. Busquet, Phys. Plasmas 7, 4238 (2000).] has been applied to conditions relevant to ICF experiments. This work was supported by the U.S. Department of Energy Office of Inertial Confinement Fusion under Cooperative Agreement No. DE-FC52-92SF19460.

Relação entre incontinência urinária em mulheres atletas corredoras de longa distância e distúrbio alimentar The relationship between urinary incontinence and eating disorders in female long-distance runners

Directory of Open Access Journals (Sweden)

Maíta Poli de Araújo

2008-04-01

Full Text Available OBJETIVO: Avaliar a ocorrência de incontinência urinária (IU em atletas corredoras de longa distância e associá-la a presença ou não de distúrbios alimentares. MÉTODOS: Um total de 37 corredoras de longa distância completaram os questionários ¨International Consultation on Incontinence Questionnaire-Short Form¨ (ICIQ-SF e o ¨Eating Attitudes Test¨ (EAT-26. O teste do absorvente de uma hora foi realizado para quantificar a perda de urina. A análise estatística das variáveis contínuas foi feita pelo teste t pareado, ou teste de Mann-Whitney. RESULTADOS: 23 atletas (62,2% tinham queixa de perda de urina. A média dos escores do ICIQ-SF neste grupo foi de 4,03 ± 5,06. Houve diferença estatisticamente significante entre o valor do teste do absorvente (p=0,02 e o resultado do questionário EAT-26 (p=0,03 no grupo de atletas incontinentes. CONCLUSÃO: Encontramos IU em atletas corredoras de longa distância e houve correlação com distúrbios alimentar. Técnicos devem estar atentos para a ocorrência de eventuais distúrbios e encaminhar tais atletas para uma equipe multidisciplinar.BACKGROUND: To determine the prevalence of urinary incontinence in female long-distance runners and to compare it with the presence or not of eating disorders. Methods - A total of 37 women have completed the International Consultation on Incontinence Questionnaire-Short Form (ICIQ-SF and the short version of the Eating Attitudes Test (EAT-26. A one-hour pad test was performed to determine urine loss. Mean values of continuous variables were compared using an independent sample t-test or the Mann-Whitney U test. RESULTS: 23 athletes (62.2% reported urine loss. The mean of the ICIQ-SF was 4.03 ± 5.06. There was a significant relation between the 1-hour pad test (p=0.02 and eating disorders (p=0.03. CONCLUSIONS: There was urinary incontinence in female long-distance runners and a correlation with eating disorders. Coaches should improve their knowledge

PONTOS DE TRANSIÇÃO DA FREQUÊNCIA CARDÍACA NA MARCHA ATLÉTICA

Directory of Open Access Journals (Sweden)

Danilo Leonel Alves

Full Text Available RESUMO Introdução: A frequência cardíaca fornece informações úteis para os treinamentos de marcha atlética. Objetivo: O objetivo do estudo foi analisar o comportamento da frequência cardíaca (FC e seus pontos de inflexão (PIFC e deflexão (PDFC em teste progressivo de marcha atlética (TPMA antes e depois de 20 sessões de treinamento. Métodos: Participaram 13 jovens atletas (12,46 ± 1,61 anos, 44,29 ± 10,25 kg, 157,93 ± 12,03 cm, 24,39 ± 7,60 %G. O TPMA foi realizado em uma pista oficial de atletismo, antes e depois do treinamento. Os dados de FC e carga foram plotados a cada minuto para identificação dos PIFC e PDFC. Resultados: A FC apresentou comportamento sigmoide, com identificação dos pontos de transição (PT, sendo no pré-treinamento: a oito sujeitos PIFC (5,31 km·h-1; 125 bpm e PDFC (7,63 km·h-1; 169 bpm; b um sujeito somente PIFC (7,00 km·h-1; 149 bpm; c um sujeito somente PDFC (8,00 km·h-1; 170 bpm; d três sujeitos sem detecção de PT e no pós-treinamento: a em 12 sujeitos PIFC (5,46 km·h-1; 125 bpm e PDFC (7,75 km·h-1; 168 bpm; b um sujeito somente PDFC (7,50 km·h-1; 184 bpm. O PIFC foi encontrado em carga significativamente inferior ao PDFC no pré (p < 0,001 e no pós-treinamento (p < 0,001. Quando comparamos o PIFC e o PDFC pré e pós, não encontramos diferença significativa, seja em relação à carga (p = 0,87 e p = 0,61 ou FC (p = 0,60 e p = 0,99. Conclusão: Conclui-se que a FC tem relação curvilínea com a carga, sendo possível detectar os seus pontos de transição em TPMA.

77 FR 25488 - Cooperative Research and Development Agreement: Federally Integrated Communications System

Science.gov (United States)

2012-04-30

... Cooperative Research and Development Agreement (CRADA) with General Dynamics C4 Systems, Inc. to lab.... The Coast Guard invites public comment on the proposed CRADA, and also invites other potential non... material on the proposed CRADA must either be submitted to our online docket via http://www.regulations.gov...

Continuation of Crosscutting Technology Development at Cast

Energy Technology Data Exchange (ETDEWEB)

Yoon, Roe-Hoan

2012-03-31

This Final Technical Report describes progress made on the sub-projects awarded in the Cooperative Agreement DE-FC26-05NT42457: Continuation of Crosscutting Technology Development at Center for Advanced Separation Technologies (CAST). The final reports for each sub-project are attached in the appendix. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: a) Solid-solid separation b) Solid-liquid separation c) Chemical/Biological Extraction d) Modeling and Control, and e) Environmental Control.

40 CFR 35.6225 - Activities eligible for funding under Core Program Cooperative Agreements.

Science.gov (United States)

2010-07-01

... under a Core Program Cooperative Agreement, activities must develop and maintain a recipient's abilities... safety plans, quality assurance project plans, and community relation plans); (2) Provisions for... staff to manage publicly-funded cleanups, oversee responsible party-lead cleanups, and provide clerical...

The text of the agreement to extend the regional co-operative agreement for research, development and training related to nuclear science and technology, 1987

International Nuclear Information System (INIS)

1992-09-01

The document reproduces the text of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 1987, for a further period of five years with effect from 12 June 1992. Australia, Bangladesh, the People's Republic of China, India, Indonesia, Japan, the Republic of Korea, Malaysia, Pakistan, the Philippines, Singapore, Sri Lanka, Thailand and Viet Nam are parties of this Agreement

Status of {sup 99}Mo-{sup 99m}Tc production development by (n, {gamma}) reaction

Energy Technology Data Exchange (ETDEWEB)

Tsuchiya, Kunihiko; Kaminaga, Masanori; Ishihara, Masahiro; Kawamura, Hiroshi [Japan Atomic Energy Agency, Oarai Research and Development Center, Oarai, Ibaraki (Japan); Mutalib, Abdul [National Nuclear Energy Agency of Indonesia (BATAN), Tangerang (Indonesia); Chakrov, Petr [Institute of Nuclear Physics, National Nuclear Center of Republic of Kazakhstan (INP-NNC-RK), Almaty (Kazakhstan)

2012-03-15

Technetium-99m ({sup 99m}Tc) is one of the most commonly used radioisotopes in the field of nuclear medicine. As one of effective uses of the JMTR, JAEA has a plan to produce {sup 99}Mo by (n, {gamma}) method, a parent nuclide of {sup 99m}Tc. JAEA has performed R and D on production method of {sup 99}Mo-{sup 99m}Tc in JMTR cooperating with foreign organizations and relevant Japanese enterprises under the cooperation programs. In this paper, present status of R and D for production of {sup 99}Mo-{sup 99m}Tc in JMTR under international cooperation is introduced and constructions of the irradiation and PIE facilities at the JMTR site are also described. (author)

Avaliação da qualidade de vida em pacientes com escoliose idiopática do adolescente após tratamento cirúrgico pelo questionário SF-36 Evaluación de la calidad de vida en pacientes con escoliosis idiopática del adolescente después del tratamiento quirúrgico por el cuestionario SF-36 Health-related quality of life in patients with adolescent idiopathic scoliosis after surgical treatment by SF-36

Directory of Open Access Journals (Sweden)

Luciano Temporal Borges Cabral

2009-09-01

Full Text Available OBJETIVO: avaliar os pacientes com escoliose idiopática do adolescente após tratamento cirúrgico, pelo questionário SF-36, comparando-os com questionário realizado no pré-operatório. MÉTODOS: entre Fevereiro de 2004 a Março de 2006 foram selecionados 28 pacientes com escoliose idiopática do adolescente, tratados cirurgicamente pela equipe de cirurgia da coluna do Hospital Mário Covas, em Santo André. Todos os pacientes foram submetidos ao tratamento cirúrgico por via posterior e artrodese com instrumentação de terceira geração. Estes pacientes possuíam descompensação do tronco e mensuração do ângulo de Cobb maior que 50º para indicação cirúrgica. Todos eles foram submetidos ao questionário SF-36 no pré-operatório, este foi repetido em um mês, seis meses, um ano e dois anos após o tratamento cirúrgico. Foi utilizado o programa SPSS (Statistical Package for Social Sciences, versão 13.0, para a análise estatística dos casos. RESULTADOS: houve diferença estatística significante em quatro domínios do SF-36: capacidade funcional, dor, aspecto social e limitação por aspectos físicos. Nos domínios saúde mental, limitação por aspectos emocionais, vitalidade e estado geral de saúde não houve diferença estatística entre os momentos observados. CONCLUSÃO: neste estudo, os pacientes com escoliose idiopática do adolescente, submetidos a tratamento cirúrgico para correção da deformidade, obtiveram melhora da qualidade de vida em aspectos físicos avaliados por meio do questionário SF-36.OBJETIVO: evaluar los pacientes con escoliosis idiopática del adolescente después del tratamiento quirúrgico por medio del cuestionario SF-36, comparándolos con el cuestionario realizado pre operatoriamente. MÉTODOS: entre Febrero de 2004 a Marzo de 2006 fueron seleccionados 28 pacientes con escoliosis idiopática del adolescente tratados quirúrgicamente por el equipo de cirugía de la columna del Hospital M�

The Text of the Second Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology of 1972

International Nuclear Information System (INIS)

1982-12-01

The text of the Second Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology of 1972 the RCA Agreement, fist extended in 1977, for a further period of five years with effect from 12 June 1982, is reproduced herein for the information of all Members

Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

Directory of Open Access Journals (Sweden)

Hye-Ji Choi

Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

Innovation and Research for Water Infrastructure for the 21st Century: Cooperative Agreement

Science.gov (United States)

Through this $10 million cooperative agreement, The U.S. Environmental Protection Agency’s (EPA) Office of Research and Development (ORD) will increase its recognition as an active leader and supporter of research that seeks innovative solutions to problems posed by aging water i...

The text of the second agreement to extend the 1987 Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology

International Nuclear Information System (INIS)

1998-03-01

The document reproduces the text of the Second Agreement to Extend the 1987 Regional Co-operative Agreement for Research, development and Training Related to Nuclear Science and Technology for a further period of five years with effect from 12 june 1997, i.e., through 11 June 2002

76 FR 44592 - Cooperative Agreement With the World Health Organization Department of Food Safety and Zoonoses...

Science.gov (United States)

2011-07-26

... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2011-N-0010] Cooperative Agreement With the World Health Organization Department of Food Safety and Zoonoses in Support of... agreement with the World Health Organization. The document published stating that the total funding...

Variabilidad de la frecuencia cardíaca como indicador de salud en el deporte: validación con un cuestionario de calidad de vida (SF-12)

OpenAIRE

Capdevila Ortís, Lluís; Rodas Font, Gil; Ocaña Mariné, Marta; Parrado Romero, Eva; Pintanel Bassets, Mónica; Valero Herreros, Montserrat

2008-01-01

Introducción y objetivo: El análisis de la variabilidad de la frecuencia cardíaca (VFC) se utiliza cada vez más en el ámbito de la medicina del deporte para evaluar la adaptación al entrenamiento de los deportistas. Nuestro objetivo es validar el análisis de la VFC como indicador de salud, comparando los parámetros de VFC con las puntuaciones del SF-12 en una muestra de personas sanas. Método: Estudio experimental con 32 sujetos sanos, 18 varones y 14 mujeres (26,19 años de promedio). Se util...

Review of occupational safety and health activities in Southern Africa funded under the DANIDA/ILO framework agreement on technical cooperation

DEFF Research Database (Denmark)

Hasle, Peter; Jørgensen, Claus

2003-01-01

A review of occupational safety and health activities in Southern Africa (SADC region) which have been funded under the DANIDA/ILO framework agreement on technical cooperation.......A review of occupational safety and health activities in Southern Africa (SADC region) which have been funded under the DANIDA/ILO framework agreement on technical cooperation....

Talking in Taejon : regional cooperative agreement project formulation meeting

International Nuclear Information System (INIS)

McEwan, A. C.

1997-01-01

The International Atomic Energy Agency as part of its Regional Cooperative Agreement (RCA) with countries in east Asia and the neighboring Pacific, has had a project on strengthening radiation protection infrastructures operating for some years. This project has arranged training courses, workshops and other activities on a range of topics related to establishing or improving radiation protection measures and safety of radiation sources in member states of the region. A second 5 year phase of planned activities is to be concluded during 1997, and the value of the project is such that member coutntries proposed its continuation for a further 5 year period commencing in 1998. For this purpose a Task Group took the lead in assembling and evaluating proposals for consideration and approval at a meeting of national coordinators for the project held in Taejon Korea, 24-28 February. The RCA project for Phase III will be titled Enhancement and Harmonisation of Radiation Protection. The meeting of national coordinators from the region represents a unique opportunity for information sharing and cooperation in radiation protection betweem countries. (author)

TRAC-PF1/MOD 1 independent assessment: Semiscale MOD-2A feedwater-line break (S-SF-3) and steam-line break (S-SF-5) tests

International Nuclear Information System (INIS)

Dobranich, D.

1985-11-01

The TRAC-PF1/MOD1 independent assessment project at Sandia is part of an overall effort funded by the NRC to determine the ability of various systems codes to predict the detailed thermal/hydraulic response of LWRs during accident and off-normal conditions. As part of this effort, calculations for Semiscale Mod-2A test S-SF-3, a feedwater-line break test, and S-SF-5, a steam-line break test, were performed with TRAC-PF1/MOD1. Most aspects of both the S-SF-3 and S-SF-5 steady-state calculations were found to be in good agreement with data. However, the need for a better steam separator model was identified from the S-SF-3 calculation. Overall, the qualitative behavior of both transients was calculated reasonably well; however, there were some discrepancies in the prediction of the quantitative behavior. The results for the S-SF-3 transient calculation indicate that the primary-to-secondary heat transfer degradation began too early. This was possibly due to overprediction of entrainment in the steam generator boiler, leading to an incorrect calculation of the secondary-side fluid distribution during the steady state. However, there was insufficient data to verify this. Results for the S-SF-5 transient calculation indicate that the primary-side fluid temperature response to a steam-line break was in reasonable agreement with data but the pressure response did not coincide with the data. Uncertainties in the data are sufficient to prevent us from determining the exact cause of this discrepancy, but there is indirect evidence that the calculated rate of phase change in the pressurizer was incorrect. 16 refs., 73 figs., 13 tabs

Effect of the percentage of SF sub 6 (100%-10%-5%) on the decomposition of SF sub 6 -N sub 2 mixtures under negative dc coronas in the presence of water vapour or oxygen

CERN Document Server

Díaz, J; Casanovas, J

2003-01-01

Low SF sub 6 content SF sub 6 -N sub 2 mixtures have recently been proposed as a replacement for pure SF sub 6 in the insulation of gas insulated lines (GIL). Among the areas of investigation of such gas mixtures, their electrical decomposition under corona discharges must be studied considering the possible occurrence of such stress in GIL. This paper presents data concerning the decomposition of high-pressure SF sub 6 -N sub 2 (5 : 95) mixtures (400 kPa) submitted to negative dc coronas in the absence or presence of 0.3% H sub 2 O or 0.3% O sub 2. The chemical stability of these mixtures is compared with that of SF sub 6 -N sub 2 (10 : 90) mixtures or undiluted SF sub 6 investigated in the same conditions in a previous paper. The corona discharges were generated with a point-to-plane set-up and the gaseous by-products were assayed by gas chromatography at the end of each run carried out over a range of transported charge covering 0-13 C. The following by-products were detected and assayed: SOF sub 4 , SO su...

The Text of the Third Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology of 1972

International Nuclear Information System (INIS)

1987-09-01

The text of the Third Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology of 1972 the RCA Agreement, extended first in 1977 and then in 1982, for a further period of five years with effect from 12 June 1987, is reproduced herein for the information of all Members [fr

78 FR 35319 - Solicitation for a Cooperative Agreement-Curriculum Development: Planning and Implementing...

Science.gov (United States)

2013-06-12

... jails and extensive experience in working with local jails on issues related to inmate mental health... mental illness. Scope of Work: The cooperative agreement awardee will draft a curriculum on (1) the key...--Curriculum Development: Planning and Implementing Effective Mental Health Services in Jails AGENCY: National...

The Texts of the Agency's Co-operation Agreements with Regional Intergovernmental Organizations. The Agreement with the Agency for the Prohibition of Nuclear Weapons in Latin America

International Nuclear Information System (INIS)

1972-01-01

The text of the Agency's agreement for co-operation with the Agency for the Prohibition of Nuclear Weapons in Latin America is reproduced in this document for the information of all Members. The agreement entered into force on 3 October 1972 pursuant to Article VIII

South Carolina DOE/EPSCOR Research Implementation Proposal Cooperative Agreement. Final Report for October 15, 2000 - October 15, 2001

Energy Technology Data Exchange (ETDEWEB)

Van Zee, John W.

2003-01-15

The final report includes resumes of faculty hired under this cooperative agreement to illustrate the increase in infrastructure and the quality of research performed in the Departments of Chemical Engineering and Chemistry at the University of South Carolina and the Department of Chemistry at Clemson University. In addition, this agreement initiated research that has resulted in the nation's first NSF Industry/University Cooperative Research Center for Fuel Cells and a summary of this Center is included.

Investigating the Interaction between the Neonatal Fc Receptor and Monoclonal Antibody Variants by Hydrogen/Deuterium Exchange Mass Spectrometry

DEFF Research Database (Denmark)

Jensen, Pernille Foged; Larraillet, Vincent; Schlothauer, Tilman

2015-01-01

The recycling of immunoglobulins by the neonatal Fc receptor (FcRn) is of crucial importance in the maintenance of antibody levels in plasma and is responsible for the long half-lives of endogenous and recombinant monoclonal antibodies. From a therapeutic point of view there is great interest...... in understanding and modulating the IgG-FcRn interaction to optimize antibody pharmacokinetics and ultimately improve efficacy and safety. Here we studied the interaction between a full-length human IgG1 and human FcRn via hydrogen/deuterium exchange mass spectrometry and targeted electron transfer dissociation...... to map sites perturbed by binding on both partners of the IgG-FcRn complex. Several regions in the antibody Fc region and the FcRn were protected from exchange upon complex formation, in good agreement with previous crystallographic studies of FcRn in complex with the Fc fragment. Interestingly, we found...

An extract of a formula used in the traditional chinese medicine (Buzhong Yi Qi Wan alters the labeling of blood constituents with technetium-99m

Directory of Open Access Journals (Sweden)

Tania Santos Giani

2007-09-01

Full Text Available Buzhong Yi Qi Wan (Buzhong is a medicinal herb widely used in Traditional Chinese Medicine to treat the digestive and circulatory systems. Red blood cell and plasma proteins labeled with technetium-99m (99mTc are used in nuclear medicine. The aim of this work was to investigate the effects of an aqueous Buzhong extract on the labeling of blood constituents with 99mTc. Heparinized blood (Wistar rats was incubated in vitro with different Buzhong extract concentrations and 99mTc-labeling was performed. Plasma (P and blood cells (BC were separated and soluble (SF-P, SF-BC and insoluble (IF-P, IF-BC fractions were isolated. The radioactivity on blood constituents was determined and the percentage of incorporated radioactivity (%ATI was calculated. Buzhong extract at the highest concentrations used altered significantly (pBuzhong Yi Qi Wan (Buzhong é uma fórmula utilizada na Medicina Tradicional Chinesa para tratamento de distúrbios nos sistemas digestório e circulatório. Constituintes sangüíneos marcados com tecnécio-99m (99mTc são usados na medicina nuclear. O objetivo deste estudo foi investigar os efeitos do extrato de Buzhong na marcação de constituintes sangüíneos com 99mTc. Amostras de sangue de ratos Wistar foram incubadas com diferentes concentrações do extrato de Buzhong e a marcação de constituintes sangüíneos com 99mTc foi realizado. Plasma e células sangüíneas foram separados, frações solúveis e insolúveis do plasma e das células sangüíneas foram isoladas. A radioatividade nos constituintes sangüíneos foi contada e as porcentagens de radioatividade incorporada (%ATI, determinada. Extrato de Buzhong nas maiores concentrações utilizadas altera significativamente (p<0.05 a %ATI nos constituintes sangüíneos. Substâncias presentes no extrato de Buzhong poderiam alterar a membrana celular e/ou gerar radicais livres, que têm propriedades oxidantes, modificando a marcação dos constituintes sangüíneos com

A Scientific Calculator for Exact Real Number Computation Based on LRT, GMP and FC++

Directory of Open Access Journals (Sweden)

J. A. Hernández

2012-03-01

Full Text Available Language for Redundant Test (LRT is a programming language for exact real number computation. Its lazy evaluation mechanism (also called call-by-need and its infinite list requirement, make the language appropriate to be implemented in a functional programming language such as Haskell. However, a direction translation of the operational semantics of LRT into Haskell as well as the algorithms to implement basic operations (addition subtraction, multiplication, division and trigonometric functions (sin, cosine, tangent, etc. makes the resulting scientific calculator time consuming and so inefficient. In this paper, we present an alternative implementation of the scientific calculator using FC++ and GMP. FC++ is a functional C++ library while GMP is a GNU multiple presicion library. We show that a direct translation of LRT in FC++ results in a faster scientific calculator than the one presented in Haskell.El lenguaje de verificación redundante (LRT, por sus siglas en inglés es un lenguaje de programación para el cómputo con números reales exactos. Su método de evaluación lazy (o mejor conocido como llamada por necesidad y el manejo de listas infinitas requerido, hace que el lenguaje sea apropiado para su implementación en un lenguaje funcional como Haskell. Sin embargo, la implementación directa de la semántica operacional de LRT en Haskell así como los algoritmos para funciones básicas (suma, resta, multiplicación y división y funciones trigonométricas (seno, coseno, tangente, etc hace que la calculadora científica resultante sea ineficiente. En este artículo, presentamos una implementación alternativa de la calculadora científica usando FC++ y GMP. FC++ es una librería que utiliza el paradigma Funcional en C++ mientras que GMP es una librería GNU de múltiple precisión. En el artículo mostramos que la implementación directa de LRT en FC++ resulta en una librería más eficiente que la implementada en Haskell.

Co-operation Agreement between the Ministry of Science, Technology and Environment of the Republic of Cuba (CITMA) and CERN concerning The Further Development of Scientific and Technical Co-operation

CERN Document Server

2003-01-01

In the framework of the CERN collaboration with Latin America, co-operation agreements have been established with Argentina, Brazil, Colombia, Chile, Mexico and Peru. They have made possible a growing participation by Latin American particle physicists in the CERN programme, which has important potential for the future. The Cuban particle physics community is highly motivated and relatively advanced, both scientifically and technologically, since many of its members have been trained in installations of the former Soviet Union, many of which now participate in CERN's cooperation with Russia. In addition, Cuba has a good number of experienced computer scientists. A group from the Cuban Institute CEADEN (Centro de Aplicaciones Tecnológicas y Desarollo Nuclear) has recently been accepted unanimously into the ALICE collaboration, with agreed contributions to off-line software and Grid middlewave. Additional Cuban contributions to show controls, data acquisition and testing electronics for the Silicon drift decte...

BUILDING STRONGER STATE ENERGY PARTNERSHIPS WITH THE U.S. DEPARTMENT OF ENERGY

Energy Technology Data Exchange (ETDEWEB)

Kate Burke

2002-11-01

This technical progress report includes an update of the progress during the second year of cooperative agreement DE-FC26-00NT40802, Building Stronger State Energy Partnerships with the U.S. Department of Energy. The report also describes the barriers in conduct of the effort, and our assessment of future progress and activities.

Influência do sexo e faixas de peso ao abate nas características físico-químicas da carne de capivara Effect of the factors sex and different slaughter weight in the physico-chemical characteristics of capybara meat (Hydrochaeris hydrochaeris

Directory of Open Access Journals (Sweden)

Maria C. Bressan

2004-09-01

Full Text Available Este trabalho objetivou avaliar o efeito dos fatores sexo e faixas de peso ao abate (30-40, 40-50, 50-60kg sobre o declínio de pH, pH final, cor, capacidade de retenção de água (CRA, perda de peso por cozimento (PPC e força de cisalhamento (FC da carne de capivara (Hydrochaeris hydrochaeris. As amostras do músculo longissimus dorsi (LD foram obtidas de 28 capivaras (16 machos e 12 fêmeas, provenientes de um zoocriadouro. Não houve influência dos fatores sexo e faixas de peso ao abate sobre o pH as 2h (6,29, 5h (6,29, 8h (6,25 e 24h (6,01 post mortem; na cor (Sistema CIE LAB para luminosidade (34,28, teor de vermelho (10,74 e teor de amarelo (1,74; CRA (0,47, PPC (32,27% e FC (5,20kgf/g. Comparando com espécies domésticas, a carne de capivara apresentou pH final elevado; índice de luminosidade baixo e teor de vermelho elevado, assemelhando-se à carnes de bovinos e ovinos (carnes vermelhas; CRA e PPC dentro dos limites considerados normais; e, textura (FC considerada macia.The aim of this work was to evaluate the effects of the factors sex and different slaughter weight groups (30-40, 40-50, 50-60kg in the pH decline, ultimate pH, colour, water holding capacity (WHC, cooking loss (CL and shear force (SF of capybara (Hydrochaeris hydrochaeris meat. Samples were constituted of longissimus dorsi (LD muscle of 28 capybaras (16 males and 12 females from the same farm. There were no effect of the factors sex and slaughter weight groups on the pH values at 2h (6.29, 5h (6.29, 8h (6.25 and 24h (6.01 post mortem; on colour values (CIE LAB System for brightness (34.28, redness (10.74 and yellowness (1.74; WHC (0.47, CL (32.27% and SF (5.20kgf/g. Comparing to livestock species, capybara meat had a high ultimate pH value, low values of brightness and high values of redness, looking like bovine and ovine meats (red meats; WHC and CL inside limits considered normal; and SF considered soft.

75 FR 27581 - Solicitation for a Cooperative Agreement-Lesbian, Gay, Bisexual, Transgender, and Intersex...

Science.gov (United States)

2010-05-17

... DEPARTMENT OF JUSTICE National Institute of Corrections Solicitation for a Cooperative Agreement--Lesbian, Gay, Bisexual, Transgender, and Intersex Guidance Project AGENCY: National Institute of... result in a policy guide for corrections practitioners charged with the care and custody of lesbian, gay...

Supershort avalanche electron beam in SF6 and krypton

Science.gov (United States)

Zhang, Cheng; Tarasenko, Victor F.; Gu, Jianwei; Baksht, Evgeni Kh.; Beloplotov, Dmitry V.; Burachenko, Alexander G.; Yan, Ping; Lomaev, Mikhail I.; Shao, Tao

2016-03-01

Runaway electrons play an important role in the avalanche formation in nanosecond- and subnanosecond- pulse discharges. In this paper, characteristics of a supershort avalanche electron beam (SAEB) generated at the subnanosecond and nanosecond breakdown in sulfur hexafluoride (SF6 ) in an inhomogeneous electric field were studied. One pulser operated at negative polarity with voltage pulse amplitude of ˜130 kV and rise time of 0.3 ns. The other pulser operated at negative polarity with voltage pulse amplitude of 70 kV and rise time of ˜1.6 ns . SAEB parameters in SF6 are compared with those obtained in krypton (Kr), nitrogen (N2 ), air, and mixtures of SF6 with krypton or nitrogen. Experimental results showed that SAEB currents appeared during the rise-time of the voltage pulse for both pulsers. Moreover, amplitudes of the SAEB current in SF6 and Kr approximately ranged from several to tens of milliamps at atmospheric pressure, which were smaller than those in N2 and air (ranging from hundreds of milliamps to several amperes). Furthermore, the concentration of SF6 additive could significantly reduce the SAEB current in N2-SF6 mixture, but it slightly affected the SAEB current in Kr -SF6 mixture because of the atomic/molecular ionization cross section of the gas had a much greater impact on the SAEB current rather than the electronegativity.

Clean Coal Power at Toms Creek

International Nuclear Information System (INIS)

Schmid, M.R.

1993-01-01

On October 20, 1992 the US Department of Energy (DOE), through the Morgantown Energy Technology Center, entered into Cooperative Agreement DE-FC-21-93MC92444 with TAMCO Power Partners to implement the Toms Creek Integrated Gasification Combined - Cycle Demonstration Project. The process design is proceeding as scheduled, and a draft Environmental Information Volume has been produced. The overall project schedule, however, may have to be adjusted when the Power Sales Agreement has been finalized

75 FR 36695 - Solicitation for a Cooperative Agreement: Meetings of the Institutional Corrections Research...

Science.gov (United States)

2010-06-28

... under this cooperative agreement will organize and coordinate all logistical details for all four... in arranging travel and lodging and in reimbursing costs in conformity with Federal guidelines. With...), an outline explaining projected costs, and the following forms: OMB Standard Form 424, Application...

78 FR 42532 - Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of...

Science.gov (United States)

2013-07-16

... DEPARTMENT OF HOMELAND SECURITY Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of Homeland Security for the Development of a Foot-and-Mouth Disease 3ABC ELISA Diagnostic Kit; Correction AGENCY: Science and Technology Directorate, Plum Island Animal Disease Center...

CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

Energy Technology Data Exchange (ETDEWEB)

Christopher E. Hull

2005-11-04

This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

Crosscutting Technology Development at the Center for Advanced Separation Technologies

Energy Technology Data Exchange (ETDEWEB)

Christopher E. Hull

2006-09-30

This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

Energy Technology Data Exchange (ETDEWEB)

Christopher E. Hull

2006-05-15

This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

The text of the third agreement to extend the regional co-operative agreement for research, development and training related to nuclear science and technology of 1972

International Nuclear Information System (INIS)

1987-09-01

The full text of the third agreement to extend the regional co-operative agreement for research, development and training related to nuclear science and technology of 1972 (INFCIRC/167) (extended first in 1977 and then in 1982) for a further period of five years with effect from 12 June 1987, is reproduced

A Comparison of SF-36 and SF-12 Composite Scores and Subsequent Hospitalization and Mortality Risks in Long-Term Dialysis Patients

Science.gov (United States)

Xu, Jianglin; Lin, Shu-Fang; Dean, Sandie Guerra; Lazarus, J. Michael; Hakim, Raymond M.

2010-01-01

Background and objectives: The Short Form 12 (SF-12) has not been validated for long-term dialysis patients. The study compared physical and mental component summary (PCS/MCS) scores from the SF-36 with those from the embedded SF-12 in a national cohort of dialysis patients. Design, setting, participants, & measurements: All 44,395 patients who had scorable SF-36 and SF-12 from January 1, 2006, to December 31, 2006, and were treated at Fresenius Medical Care, North America facilities were included. Death and first hospitalization were followed for up to 1 year from the date of survey. Correlation and agreement were obtained between PCS-36 and PCS-12 and MCS-36 and MCS-12; then Cox models were constructed to compare associated hazard ratios (HRs) between them. Results: Physical and mental dimensions both exhibited excellent intraclass correlation coefficients of 0.94. Each incremental point for both PCS-12 and PCS-36 was associated with a 2.4% lower adjusted HR of death and 0.4% decline in HR for first hospitalization (both P < 0.0001). Corresponding improvement in HR of death for each MCS point was 1.2% for MCS-12 and 1.3% for MCS-36, whereas both had similar 0.6% lower HR for hospitalization per point (all P < 0.0001). Conclusions: The use of the SF-12 alone or as part of a larger survey is valid in dialysis patients. Composite scores from the SF-12 and SF-36 have similar prognostic association with death and hospitalization risk. Prospective longitudinal studies of SF-12 surveys that consider responsiveness to specific clinical, situational, and interventional changes are needed in this population. PMID:20019120

FcγRll: Characterisation of novel Fc receptor interactions and a new receptor form.

OpenAIRE

JESSICA CLAIRE ANANIA

2018-01-01

Leukocyte Fc receptors (FcR) bind to immunogloulins (Ig) to link the innate and humoral immune system to help balance the immune system and clear infections. We have characterised a novel FcR for IgG (FcγR) form, designated FcγRIIa3, which contains a 19 amino acid insert. This insert interacts with cytoskeletal structures allowing the receptor to be retained for longer periods of time at the cells surface upon activation, higher cell signalling which causes greater cellular activation. Theref...

The Text of a Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology. Acceptance of the Agreement by Bangladesh

International Nuclear Information System (INIS)

1974-01-01

On 23 October 1974 the Government of Bangladesh notified the Agency of its acceptance of the Regional Cooperative Agreement for Research, Development and Training Related to Nuclear Science and Technology between the Agency and Member States, in accordance with Section 9 thereof. Pursuant to Section 10, the Agreement consequently entered into force with respect to the Government of Bangladesh on that date

Co-operation agreement between the European Organization for Nuclear Research (CERN) and the Government of People's Republic of Bangladesh concerning Education, Scientific and Technical Co-operation in High-Energy Physics

CERN Document Server

2014-01-01

Co-operation agreement between the European Organization for Nuclear Research (CERN) and the Government of People's Republic of Bangladesh concerning Education, Scientific and Technical Co-operation in High-Energy Physics

Cooperation Agreement between the European Organization for Nuclear Research (CERN) and The Qatar Foundation for Education, Science and Community Development concerning Scientific and Technical Co-operation in High Energy Physics

CERN Document Server

2016-01-01

Cooperation Agreement between the European Organization for Nuclear Research (CERN) and The Qatar Foundation for Education, Science and Community Development concerning Scientific and Technical Co-operation in High Energy Physics

The Asia-Pacific Region on the Paris Agreement against Climate Change: Geopolitics and Cooperation

Directory of Open Access Journals (Sweden)

Ana Bertha Cuevas Tello

2017-11-01

Full Text Available Given the complexity surrounding climate change, it is argued that the willingness to cooperate on the part of the States is based on one of the faces that, for the climate field, can offer geopolitics: strengths or weaknesses (understood as vulnerability of geographical conditions, location and territory. That is, the physical, geographic, economic and demographic factors of each State influence the decision making of the foreign climate policy, which induces them to cooperate or the abstention of it. This paper will address, broadly speaking, the participation of the main economies of the Asia-Pacific region in the institutionalization of climate change in the International Agenda; the importance of the economies of the Asia-Pacific region with regard to the Paris Agreement; and the geopolitical strengths and weaknesses that explain the cooperative or non-cooperative behavior of the region in the fight against climate change.

Quantitative studies of transfer in vivo of low density, Sf 12-60, and Sf 60-400 lipoproteins between plasma and arterial intima in humans

International Nuclear Information System (INIS)

Shaikh, M.; Wootton, R.; Nordestgaard, B.G.; Baskerville, P.; Lumley, J.S.; La Ville, A.E.; Quiney, J.; Lewis, B.

1991-01-01

To assess the potential of various plasma lipoprotein classes to contribute to the lipid content of the arterial intima, influx and efflux of these plasma lipoprotein fractions into and from the intima of human carotid arteries were measured in vivo. While low density lipoprotein (LDL) is known to transfer from plasma into the arterial wall, there is less information on the atherogenic potential of lipoproteins of intermediate density (Sf 12-60) or of very low density (Sf 60-400). Aliquots of the same lipoprotein (LDL, Sf 12-60 lipoprotein particles, or Sf 60-400 lipoprotein particles) iodinated with iodine-125 and iodine-131 were injected intravenously 18-29 hours and 3-6 hours, respectively, before elective surgical removal of atheromatous arterial tissue, and the intimal clearance of lipoproteins, lipoprotein influx, and fractional loss of newly entered lipoproteins were calculated. Intimal clearance of Sf 60-400 particles was not detectable (less than 0.3 microliter x hr-1 x cm-2), whereas the average value for both LDL and Sf 12-60 lipoprotein particles was 0.9 microliter x hr-1 x cm-2. Since the fractional loss of newly entered LDL and Sf 12-60 lipoprotein particles was also similar, the results suggest similar modes of entry and exit for these two particles. However, due to lower plasma concentrations of Sf 12-60 lipoproteins as compared with LDL, the mass influx of cholesterol in the Sf 12-60 particles was on the order of one 10th of that in LDL, and that of apolipoprotein B was about one 20th

Supershort avalanche electron beam in SF_{6} and krypton

Directory of Open Access Journals (Sweden)

Cheng Zhang (章程

2016-03-01

Full Text Available Runaway electrons play an important role in the avalanche formation in nanosecond- and subnanosecond- pulse discharges. In this paper, characteristics of a supershort avalanche electron beam (SAEB generated at the subnanosecond and nanosecond breakdown in sulfur hexafluoride (SF_{6} in an inhomogeneous electric field were studied. One pulser operated at negative polarity with voltage pulse amplitude of ∼130  kV and rise time of 0.3 ns. The other pulser operated at negative polarity with voltage pulse amplitude of 70 kV and rise time of ∼1.6  ns. SAEB parameters in SF_{6} are compared with those obtained in krypton (Kr, nitrogen (N_{2}, air, and mixtures of SF_{6} with krypton or nitrogen. Experimental results showed that SAEB currents appeared during the rise-time of the voltage pulse for both pulsers. Moreover, amplitudes of the SAEB current in SF_{6} and Kr approximately ranged from several to tens of milliamps at atmospheric pressure, which were smaller than those in N_{2} and air (ranging from hundreds of milliamps to several amperes. Furthermore, the concentration of SF_{6} additive could significantly reduce the SAEB current in N_{2}-SF_{6} mixture, but it slightly affected the SAEB current in Kr-SF_{6} mixture because of the atomic/molecular ionization cross section of the gas had a much greater impact on the SAEB current rather than the electronegativity.

Tracking the maximum efficiency point for the FC system based on extremum seeking scheme to control the air flow

International Nuclear Information System (INIS)

Bizon, Nicu

2014-01-01

Highlights: • The Maximum Efficiency Point (MEP) is tracked based on air flow rate. • The proposed Extremum Seeking (ES) control assures high performances. • About 10 kW/s search speed and 99.99% stationary accuracy can be obtained. • The energy efficiency increases with 3–12%, according to the power losses. • The control strategy is robust based on self-optimizing ES scheme proposed. - Abstract: An advanced control of the air compressor for the Proton Exchange Membrane Fuel Cell (PEMFC) system is proposed in this paper based on Extremum Seeking (ES) control scheme. The FC net power is mainly depended on the air and hydrogen flow rate and pressure, and heat and water management. This paper proposes to compute the optimal value for the air flow rate based on the advanced ES control scheme in order to maximize the FC net power. In this way, the Maximum Efficiency Point (MEP) will be tracked in real time, with about 10 kW/s search speed and a stationary accuracy of 0.99. Thus, energy efficiency will be close to the maximum value that can be obtained for a given PEMFC stack and compressor group under dynamic load. It is shown that the MEP tracking allows an increasing of the FC net power with 3–12%, depending on the percentage of the FC power supplied to the compressor and the level of the load power. Simulations shows that the performances mentioned above are effective

Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.

Science.gov (United States)

Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide

2010-02-15

The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.

Comparison of D2 receptor binding (123I-IBZM) and rCBF (99mTc-HMPAO) in extrapyramidal disorders

International Nuclear Information System (INIS)

Saur, H.B.; Bartenstein, P.; Schober, O.; Oberwittler, C.; Lerch, H.; Masur, H.

1994-01-01

The aim of this SPECT study was to determine whether there is a correlation between rCBF ( 99m Tc-HMPAO) and D2 receptor binding ( 123 I-IBZM) in disorders of the extrapyramidal system and in which situation the 99 MTc-HMPAO scan could predict the outcome of the 123 I-IBZM study. 13 patients with Parkinson's syndrome and 13 patients with hyperkinetic extrapyramidal disorders were studied. In all patients the two SPECT studies were performed within 2-7 days. ROIs were placed over the basal ganglia (BG), the frontal cortex (FC) and the cerebellum (CE). The ratios BG/FC and BG/CE were calculated. In both groups the scatter was lower when the frontal cortex was used as reference region. Among the patients with hyperkinetic extrapyramidal hyperkinetic extrapyramidal disorders the two patients with Huntington's chorea had lower rCBF and D2 receptor binding compared to other hyperkinetic extrapyramidal disorders. There was no correlation between D2 receptor binding and rCBF in the basal ganglia. The 99 MTc-HMPAO studies did not provide clinically useful information, except in Huntington's chorea. (orig.) [de

WVU cooperative agreement, decontamination systems information and research program, deployment support leading to implementation

International Nuclear Information System (INIS)

Cook, E.E.

1996-01-01

This program at West Virginia University is a Cooperative Agreement that focuses on R ampersand D associated with hazardous waste remediation problems existing at DOE, Corps of Engineers, and private sector sites. The Agreement builds on a unique combination of resources coupling university researchers with DOE sponsored small businesses, leading toward field tests and large scale technology demonstrations of environmental technologies. Most of the Agreement's projects are categorized in the Technology Maturity Levels under Gates 3-Advanced Development, Gate 4-Engineering Development, and Gate 5-Demonstration. The program includes a diversity of projects: subsurface contaminants; mixed wastes; mixed wastes/efficient separations; mixed wastes/characterization, monitoring, and sensor technologies; and decontamination and decommissioning/efficient separations

77 FR 43120 - Solicitation for a Cooperative Agreement-Dosage-Based Probation as an Effective Intervention

Science.gov (United States)

2012-07-23

... and organizational capacity to meet the goals of the project? Program Management/Administration: (25... offenders in their communities for positive reinforcement of desired new behaviors. (7) Measure Relevant... DEPARTMENT OF JUSTICE National Institute of Corrections Solicitation for a Cooperative Agreement...

77 FR 59402 - Announcement of Supplemental Funding for Cooperative Agreements to the New Mexico Department of...

Science.gov (United States)

2012-09-27

...), in collaboration with the U.S. Department of Health and Human Services, works toward creating... cooperative agreements, OGA/ HHS will support and/or stimulate awardees activities by working with them in a...

Usefulness of FC-TRIPLEX Chagas/Leish IgG1 as confirmatory assay for non-negative results in blood bank screening of Chagas disease.

Science.gov (United States)

Campos, Fernanda Magalhães Freire; Repoles, Laura Cotta; de Araújo, Fernanda Fortes; Peruhype-Magalhães, Vanessa; Xavier, Marcelo Antônio Pascoal; Sabino, Ester Cerdeira; de Freitas Carneiro Proietti, Anna Bárbara; Andrade, Mariléia Chaves; Teixeira-Carvalho, Andréa; Martins-Filho, Olindo Assis; Gontijo, Célia Maria Ferreira

2018-04-01

A relevant issue in Chagas disease serological diagnosis regards the requirement of using several confirmatory methods to elucidate the status of non-negative results from blood bank screening. The development of a single reliable method may potentially contribute to distinguish true and false positive results. Our aim was to evaluate the performance of the multiplexed flow-cytometry anti-T. cruzi/Leishmania IgG1 serology/(FC-TRIPLEX Chagas/Leish IgG1) with three conventional confirmatory criteria (ELISA-EIA, Immunofluorescence assay-IIF and EIA/IIF consensus criterion) to define the final status of samples with actual/previous non-negative results during anti-T. cruzi ELISA-screening in blood banks. Apart from inconclusive results, the FC-TRIPLEX presented a weak agreement index with EIA, while a strong agreement was observed when either IIF or EIA/IIF consensus criteria were applied. Discriminant analysis and Spearman's correlation further corroborates the agreement scores. ROC curve analysis showed that FC-TRIPLEX performance indexes were higher when IIF and EIA/IIF consensus were used as a confirmatory criterion. Logistic regression analysis further demonstrated that the probability of FC-TRIPLEX to yield positive results was higher for inconclusive results from IIF and EIA/IIF consensus. Machine learning tools illustrated the high level of categorical agreement between FC-TRIPLEX versus IIF or EIA/IIF consensus. Together, these findings demonstrated the usefulness of FC-TRIPLEX as a tool to elucidate the status of non-negative results in blood bank screening of Chagas disease. Copyright © 2018. Published by Elsevier B.V.

Self-focusing in SF6

International Nuclear Information System (INIS)

Ackerhalt, J.R.; Galbraith, H.W.

1981-01-01

It is shown by explicit calculation of previously published quasicontinuum model that the molecular susceptibility rapidly approaches zero as higher excited states of the molecule become populated. Hence the overtones of the ν 3 -pumped mode are totally responsible for the self focusing effects in SF 6 . The ν 3 ladder contribution to the susceptibility is calculated. The vibrational model is a classical triply degenerate anharmonic oscillator in the Cartesian basis with the anharmonicity parameters chosen to be consistent with the latest spectroscopic analysis of the 3ν 3 overtone spectrum. The rotational structure is represented by a distribution of these oscillators where the distribution is chosen to correspond to the spectrum of the ν 3 fundamental. Good agreement is found with the 300 0 in self-focusing data of Nowak and Ham at CO 2 P(28), P(20) and P(10) in SF 6

Modifications to Langley 0.3-m TCT adaptive wall software for heavy gas test medium, phase 1 studies

Science.gov (United States)

Murthy, A. V.

1992-01-01

The scheme for two-dimensional wall adaptation with sulfur hexafluoride (SF6) as test gas in the NASA Langley Research Center 0.3-m Transonic Cryogenic Tunnel (0.3-m TCT) is presented. A unified version of the wall adaptation software has been developed to function in a dual gas operation mode (nitrogen or SF6). The feature of ideal gas calculations for nitrogen operation is retained. For SF6 operation, real gas properties have been computed using the departure function technique. Installation of the software on the 0.3-m TCT ModComp-A computer and preliminary validation with nitrogen operation were found to be satisfactory. Further validation and improvements to the software will be undertaken when the 0.3-m TCT is ready for operation with SF6 gas.

Establishment of the Center for Advanced Separation Technologies

Energy Technology Data Exchange (ETDEWEB)

Christopher E. Hull

2006-09-30

This Final Technical Report covers the eight sub-projects awarded in the first year and the five projects awarded in the second year of Cooperative Agreement DE-FC26-01NT41091: Establishment of the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

Technical cooperation for the pacific uses of nuclear technology in Latin America and Caribbean: the experience of regional agreement ARCAL

International Nuclear Information System (INIS)

Rondinelli Junior, Francisco

2017-01-01

This thesis studies the international technical cooperation in the field of peaceful applications of the nuclear technology, focusing on the experience of Latin American countries, where the Cooperation Agreement for the Promotion of Nuclear Science and Technology in Latin America and the Caribbean, also known as ARCAL, is in force. The study adopts as theoretical approach the concept of state capacities, particularly with regard to the institutional capacities applicable to the ARCAL Agreement. Within this approach, three dimensions of analysis are adopted: the institutional dimension, the governance dimension and the focus on outcomes. The evaluation of the ARCAL Agreement is carried out in order to confirm if the intended role to promote regional technical cooperation in the nuclear sector is being implemented. The methodological approach adopted the case study model. It starts with the analysis of the institutional evolution of the Agreement, and identifies variables articulating with the three dimensions above mentioned. The empirical data were collected in two stages. In the first stage it were performed 29 interviews carried out by the author with the technical and staff members of the Department of Technical Cooperation of IAEA, in Vienna, Austria, headquarter of IAEA. The other stage involved an electronic questionnaire submitted to the national coordinator of ARCAL in 14 countries, in a universe of 21 member states. The conclusion of the research points to the fact that the ARCAL Agreement has incorporated, throughout its trajectory, elements of the institutional capacities which are still in the process of development. They give to the Agreement the potential to induce the development of the state capacities of the respective countries in the field of peaceful applications of nuclear technology. (author)

Cooperative measures to support the Indo-Pak Agreement Reducing Risk from Accidents Relating to Nuclear Weapons.

Energy Technology Data Exchange (ETDEWEB)

Mishra, Sitakanta [Centre for Air Power Studies, New Delhi (India); Ahmed, Mansoor [Quaid-i-Azam Univ., Islamabad (Pakistan)

2014-04-01

In 2012, India and Pakistan reaffirmed the Agreement on Reducing the Risk from Accidents Relating to Nuclear Weapons. Despite a history of mutual animosity and persistent conflict between the two countries, this agreement derives strength from a few successful nuclear confidence building measures that have stood the test of time. It also rests on the hope that the region would be spared a nuclear holocaust from an accidental nuclear weapon detonation that might be misconstrued as a deliberate use of a weapon by the other side. This study brings together two emerging strategic analysts from South Asia to explore measures to support the Agreement and further develop cooperation around this critical issue. This study briefly dwells upon the strategic landscape of nuclear South Asia with the respective nuclear force management structures, doctrines, and postures of India and Pakistan. It outlines the measures in place for the physical protection and safety of nuclear warheads, nuclear materials, and command and control mechanisms in the two countries, and it goes on to identify the prominent, emerging challenges posed by the introduction of new weapon technologies and modernization of the respective strategic forces. This is followed by an analysis of the agreement itself leading up to a proposed framework for cooperative measures that might enhance the spirit and implementation of the agreement.

The neonatal Fc receptor, FcRn, as a target for drug delivery and therapy.

Science.gov (United States)

Sockolosky, Jonathan T; Szoka, Francis C

2015-08-30

Immunoglobulin G (IgG)-based drugs are arguably the most successful class of protein therapeutics due in part to their remarkably long blood circulation. This arises from IgG interaction with the neonatal Fc receptor, FcRn. FcRn is the central regulator of IgG and albumin homeostasis throughout life and is increasingly being recognized as an important player in autoimmune disease, mucosal immunity, and tumor immune surveillance. Various engineering approaches that hijack or disrupt the FcRn-mediated transport pathway have been devised to develop long-lasting and non-invasive protein therapeutics, protein subunit vaccines, and therapeutics for treatment of autoimmune and infectious disease. In this review, we highlight the diverse biological functions of FcRn, emerging therapeutic opportunities, as well as the associated challenges of targeting FcRn for drug delivery and disease therapy. Copyright © 2015 Elsevier B.V. All rights reserved.

The European Window: Challenges in the Negotiation of Mexico's Free Trade Agreement with the European Union

OpenAIRE

Sergio Gómez Lora; Jaime Zabludovsky

2005-01-01

On 1 July 2000 regulations to liberalize trade flows between Mexico and the European Union came into force, after more than six years of diplomatic work and complex negotiations. These regulations are part of the ¿Tratado de Libre Comercio (TLCUEM), which is also one of the components of the Agreement on Economic Association, Political Concertation and Cooperation (¿Global Agreement¿). The Global Agreement through its three components ¿ political dialogue, trade liberalization and cooperation...

Low energy electron attachment to SF6 in N2, Ar, and Xe buffer gases

International Nuclear Information System (INIS)

Hunter, S.R.; Carter, J.G.; Christophorou, L.G.

1989-01-01

The electron attachment rate constants k/sub a/ for SF 6 have been measured in dilute mixtures of SF 6 in high pressure (>1 atm) N 2 , Ar, and Xe buffer gases at room temperature (T≅300 K) over a wide E/N range (electric field strength to gas number density ratio), corresponding to mean electron energies from near thermal electron energies (≅0.04 eV) to ≅4.3 eV. Particular attention has been paid to the effects of space charge distortion, molecular impurities, and changes in the electron energy distribution function on the measured electron attachment rate constant values at the lower E/N values in these mixtures. The present measured thermal electron attachment rate constants in SF 6 /N 2 and SF 6 /Xe gas mixtures are in excellent agreement with recent accurate measurements of these parameters in several SF 6 /buffer gas mixtures. At higher values, the present SF 6 /N 2 measurements are in fair agreement with previous measurements, while no previous measurements using Ar and Xe buffer gases have been published. These measurements have been used in numerical two term, spherical harmonic Boltzmann equation analyses of the electron motion in these gas mixtures to obtain the low energy ( 6 . The present derived electron attachment cross sections are compared with recently measured and derived nondissociative and dissociative electron attachment cross sections for SF 6

ADVANCED COMPRESSOR ENGINE CONTROLS TO ENHANCE OPERATION, RELIABILITY AND INTEGRITY

Energy Technology Data Exchange (ETDEWEB)

Gary D. Bourn; Jess W. Gingrich; Jack A. Smith

2004-03-01

This document is the final report for the ''Advanced Compressor Engine Controls to Enhance Operation, Reliability, and Integrity'' project. SwRI conducted this project for DOE in conjunction with Cooper Compression, under DOE contract number DE-FC26-03NT41859. This report addresses an investigation of engine controls for integral compressor engines and the development of control strategies that implement closed-loop NOX emissions feedback.

The text of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 1987. Status of acceptances as of 28 February 1993

International Nuclear Information System (INIS)

1993-04-01

The document gives the status of acceptances as of 28 February 1993 of the agreement to extend regional co-operative agreement for research, development and training related to nuclear science and technology from 1987

Field flow fractionation for assessing neonatal Fc receptor and Fcγ receptor binding to monoclonal antibodies in solution.

Science.gov (United States)

Pollastrini, Joey; Dillon, Thomas M; Bondarenko, Pavel; Chou, Robert Y-T

2011-07-01

Analysis of the strength and stoichiometry of immunoglobulin G (IgG) binding to neonatal Fc receptor (FcRn) and Fcγ receptor (FcγR) is important for evaluating the pharmacokinetics and effector functions of therapeutic monoclonal antibody (mAb) products, respectively. The current standard for assessing FcγR and FcRn binding is composed of cell-based and surface plasmon resonance (SPR) assays. In this work, asymmetrical flow field flow fractionation (AF4) was evaluated to establish the true stoichiometry of IgG binding in solution. AF4 and liquid chromatography-mass spectrometry (LC-MS) were applied to directly observe IgG/FcγR and IgG/FcRn complexes, which were not observed using nonequilibrium size exclusion chromatography (SEC) analysis. Human serum albumin (HSA), an abundant component of human blood and capable of binding FcRn, was studied in combination with FcRn and IgG. AF4 demonstrated that the majority of large complexes of IgG/FcRn/HSA were at an approximate 1:2:1 molar ratio. In addition, affinity measurements of the complex were performed in the sub-micromolar affinity range. A significant decrease in binding was detected for IgG molecules with increased oxidation in the Fc region. AF4 was useful in detecting weak binding between full-length IgG/Fc fragments and Fc receptors and the effect of chemical modifications on binding. AF4 is a useful technique in the assessment of mAb product quality attributes. Copyright © 2011 Elsevier Inc. All rights reserved.

Mecanismos de movilidad de dislocaciones a temperaturas medias en plomo de muy alta pureza (99.9999 %

Directory of Open Access Journals (Sweden)

Gallego, I.

1998-05-01

Full Text Available The internal friction spectrum of high purity lead (99.9999 % at medium temperatures has been studied. A new peak (P₁ has been found at 240 K, which has not been studied up to now. The activation energy of the process associated with F, has been determined and its experimental behaviour has also been systematically studied. The comparison between the results and the theoretical predictions of the models of dislocation mobility allows us to attribute the P₁ peak to the sliding of dislocations, controlled by the climbing of jogs induced by the diffusion of vacancies along the dislocation line. This conclusion is analogue to that obtained in previous works for the P₁v peak in very high purity aluminium (99.9999 %.

Se ha realizado un estudio sistemático del espectro de fricción interna del plomo de muy alta pureza (99,9999 % a temperaturas medias, encontrándose un pico a 240 K (P₁ que no ha sido estudiado en la bibliografía hasta el momento. Los análisis mediante fricción interna nos han permitido evaluar la energía de activación del proceso ligado a P₁ y determinar el comportamiento de este pico en función de diversos parámetros. La comparación de los resultados experimentales con las predicciones teóricas de varios modelos microscópicos de movilidad de dislocaciones nos ha permitido concluir que el pico P₁ está asociado con el deslizamiento de dislocaciones controlado por la escalada de escalones mediante la difusión de vacantes a lo largo de, la línea de dislocación. Esta interpretación es análoga a la realizada en trabajos previos para el pico P₁ del aluminio de muy alta pureza (99,9999 %.

Dicty_cDB: FC-BS11 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS...11Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS

Agreement between the Government of Canada and the Government of the Republic of Turkey for co-operation in the peaceful uses of nuclear energy

International Nuclear Information System (INIS)

1985-01-01

By Act No. 3258 of 11 February 1986 the Turkish National Assembly approved ratification of the Agreement of 18 June 1985 between the Government of Turkey and the Government of Canada for Co-operation in the Peaceful Uses of Nuclear Energy. The Agreement covers nuclear co-operation in industry agriculture, electricity generation, etc, and provides the legal framework for such co-operation. It lays down the general provisions for transfer of nuclear facilities, materials and technology between the two Parties and specifies the areas concerned. The Agreement provides that all the activities within its scope shall be carried out for exclusively peaceful purposes. (NEA) [fr

Dicty_cDB: FC-BS10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/

Dicty_cDB: FC-BS21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS21 (Link to dictyBase) - - - Contig-U15764-1 FC-BS21Z (Li...nk to Original site) - - FC-BS21Z 723 - - - - Show FC-BS21 Library FC (Link to library) Clone ID FC-BS21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS21Q.Seq.d/ Representative seq. ID FC-BS...21Z (Link to Original site) Representative DNA sequence >FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.Seq.... Score E Sequences producing significant alignments: (bits) Value FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.

Dicty_cDB: FC-BS19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Análisis de la respuesta cardiaca de árbitros de fútbol en competición: estudio de caso.

Directory of Open Access Journals (Sweden)

Daniel Castillo Alvira

2015-05-01

Full Text Available Los objetivos de este estudio fueron, por un lado, examinar la respuesta cardiaca de un árbitro de fútbol tanto durante un test de campo incremental como durante dos partidos en un torneo nacional de categoría cadete, y por otro lado, determinar las zonas de intensidad del árbitro durante los partidos atendiendo a su FCmax individual. Un árbitro de fútbol de categoría nacional fue equipado con un pulsómetro (Polar Electro Oy, Kempele, Finlandia y su FC fue monitorizada durante la realización del Yo-Yo de recuperación intermitente nivel 1 (YYIR1 y durante dos partidos de un Torneo de Fútbol de categoría cadete. Las zonas de intensidad se establecieron atendiendo a la clasificación de Edwards (1993. La FCmax obtenida en el YYIR1 y en los partidos fue de 178 ppm y 161 ppm, respectivamente. Durante los partidos la FCmed registrada fue de 127 ± 1,03 ppm que corresponde a un 71,3% de la FCmax obtenida en el YYIR1. La distribución de la frecuencia cardiaca atendiendo a las zonas establecidas es la siguiente: 10 ± 1,95% (zona 1, 32 ± 1,65% (zona 2, 38 ± 5,14% (zona 3, 19 ± 4,31% (zona 4 y 1 ± 0,53% (zona 5. Los resultados obtenidos nos muestran que la FC más alta alcanzada en partidos de categoría cadete es inferior a la alcanzada en el YYIR1. Además, se observa que la carga interna, medida mediante FC obtenida en partidos, es inferior a la reportada en otros estudios con árbitros en partidos de categoría sénior.

Validade concorrente da versão Brasileira do SRS-22r com o Br-SF-36 Concurrent validity of the Brazilian version of SRS-22r with Br-SF-36

Directory of Open Access Journals (Sweden)

Giselle C. L. Rosanova

2010-04-01

Full Text Available CONTEXTUALIZAÇÃO: A validade concorrente, relevante na adaptação transcultural, refere-se à relação entre o desempenho do instrumento de interesse e o desempenho de instrumento semelhante com validade conhecida. OBJETIVO: Realizar a validação concorrente da versão brasileira do questionário revisado da Scoliosis Research Society (Br-SRS-22r com a versão brasileira do Short Form-36 (Br-SF-36. MÉTODOS: Foram selecionados 54 pacientes com escoliose idiopática com média de 19,9 anos (±7,7 e curvaturas com média de 31,6° (±20,5° graus Cobb, variando entre 10º e 92º. Os questionários tiveram seus resultados convertidos em escores, e a análise estatística correlacionou os domínios concorrentes utilizando o cálculo de coeficiente de Spearman. RESULTADOS: Os domínios de melhor correlação foram função do Br-SRS-22r com função física do Br-SF-36 (r=0,83 e dor do Br-SRS-22r com dor do Br-SF-36 (r=0,86. Entretanto, os domínios autoimagem e satisfação com o tratamento do Br-SRS-22r apresentaram baixa correlação com seus domínios concorrentes do Br-SF-36. DISCUSSÃO: Houve uma correlação satisfatória entre os questionários, sendo que as melhores correlações indicam maior semelhança nos parâmetros avaliados entre os respectivos instrumentos. As melhores correlações foram as dos domínios função e dor, não ocorrendo em saúde mental, possivelmente devido às dificuldades de interpretação de suas questões no Br-SF-36. Para os domínios autoimagem e satisfação com o tratamento do Br-SRS-22r, a correlação é pouco satisfatória por não serem especificamente abordados pelo SF-36. CONCLUSÃO: A versão brasileira do SRS-22r apresentou resultados satisfatórios para a validação concorrente com o Br-SF-36, sendo considerada válida para a versão adaptada à cultura brasileira.BACKGROUND: An important parameter in cross-cultural adaptations, and concurrent validity are the relationships between the

Genome-wide identification of SF1 and SF2 helicases from archaea.

Science.gov (United States)

Chamieh, Hala; Ibrahim, Hiba; Kozah, Juliana

2016-01-15

Archaea microorganisms have long been used as model organisms for the study of protein molecular machines. Archaeal proteins are particularly appealing to study since archaea, even though prokaryotic, possess eukaryotic-like cellular processes. Super Family I (SF1) and Super Family II (SF2) helicase families have been studied in many model organisms, little is known about their presence and distribution in archaea. We performed an exhaustive search of homologs of SF1 and SF2 helicase proteins in 95 complete archaeal genomes. In the present study, we identified the complete sets of SF1 and SF2 helicases in archaea. Comparative analysis between archaea, human and the bacteria E. coli SF1 and SF2 helicases, resulted in the identification of seven helicase families conserved among representatives of the domains of life. This analysis suggests that these helicase families are highly conserved throughout evolution. We highlight the conserved motifs of each family and characteristic domains of the detected families. Distribution of SF1/SF2 families show that Ski2-like, Lhr, Sfth and Rad3-like helicases are ubiquitous among archaeal genomes while the other families are specific to certain archaeal groups. We also report the presence of a novel SF2 helicase specific to archaea domain named Archaea Specific Helicase (ASH). Phylogenetic analysis indicated that ASH has evolved in Euryarchaeota and is evolutionary related to the Ski2-like family with specific characteristic domains. Our study provides the first exhaustive analysis of SF1 and SF2 helicases from archaea. It expands the variety of SF1 and SF2 archaeal helicases known to exist to date and provides a starting point for new biochemical and genetic studies needed to validate their biological functions. Copyright © 2015 Elsevier B.V. All rights reserved.

Dicty_cDB: FC-BS09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

The text of the Agreement establishing the Asian Regional Co-operative Project on Medical and Biological Applications of Nuclear Techniques

International Nuclear Information System (INIS)

1987-04-01

The full text of the Agreement establishing the Asian Regional Co-operative Project on Medical and Biological Applications of Nuclear Techniques between the Agency and Member States is reproduced. The Agreement entered into force on 20 May 1986 after the Governments of Japan, Bangladesh and the Philippines had notified the Agency of their acceptance of the Agreement

Dicty_cDB: FC-BR23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

Dicty_cDB: FC-BS14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS...14E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI05 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

76 FR 25362 - Cooperative Research and Development Agreement: Butanol Fuel Blend Usage With Marine Outboard...

Science.gov (United States)

2011-05-04

... participants would identify and investigate the advantages, disadvantages, required technology enhancements... Development Agreements (CRADAs), are authorized by the Federal Technology Transfer Act of 1986 (Pub. L. 99- 502, codified at 15 U.S.C. 3710(a)). A CRADA promotes the transfer of technology to the private sector...

Bill authorizing the approval of the cooperation agreement between the French Republic Government and the Indian Republic Government for the development of peaceful uses of nuclear energy

International Nuclear Information System (INIS)

2009-04-01

After having recalled the context of this cooperation agreement (increasing energy needs of India, enabling the Indian economical growth not to contribute to global warming, agreement between India and the IAEA), this text comments the bill content, i.e. the cooperation field and modalities, and the various opportunities, obligations, constraints, commitments, and guarantees of this cooperation. These aspects are concerning the industrial relationship between France and India as well as the compliance with international agreements and controls. After a list of the different existing agreements between French and Indian nuclear institutions, the actual bill text is given

Co-operation Agreement. The Text of the Agreement of 25 May 1998 between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials

International Nuclear Information System (INIS)

1998-01-01

The text of the Co-operation Agreement between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials is reproduced herein for the information of all Members. The Agreement entered into force on 25 May 1998, pursuant to Article 8 [fr

Co-operation Agreement. The Text of the Agreement of 25 May 1998 between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials

International Nuclear Information System (INIS)

1998-01-01

The text of the Co-operation Agreement between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials is reproduced herein for the information of all Members. The Agreement entered into force on 25 May 1998, pursuant to Article 8 [es

Revisiting Field Capacity (FC: variation of definition of FC and its estimation from pedotransfer functions

Directory of Open Access Journals (Sweden)

Theophilo Benedicto Ottoni Filho

2014-12-01

Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

Substratos renováveis na produção de mudas de Ficus enormis proveniente de jardim clonal

Directory of Open Access Journals (Sweden)

Rosimeri de Oliveira Fragoso

2017-01-01

Full Text Available Objetivou-se avaliar substratos renováveis à base de casca de arroz carbonizada (CAC e fibra de coco (FC sobre o enraizamento e qualidade final de mudas de Ficus enormis Mart. ex Miq. via estaquia caulinar de plantas provenientes de jardim clonal. Foram avaliados seis substratos: comercial (controle, composto por casca de arroz carbonizada (CAC, fibra de coco (FC e vermiculita (S1; 100% FC (S2; 100% CAC (S3; 50% FC e 50% CAC (S4; 30% (FC e 70% CAC (S5; 70% FC e 30% CAC (S6. O substrato comercial (S1 e as composições com maior proporção de FC apresentam qualificação superior para a produção de mudas de F. enormis.

77 FR 11778 - Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and...

Science.gov (United States)

2012-02-28

... and II Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and... available on OMB's Web site at http://www.whitehouse.gov/omb/circulars_default/ . The Cost Principles for... E (Principles for Determining Costs Applicable to Research and Development Under Grants and...

78 FR 7282 - Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and...

Science.gov (United States)

2013-02-01

... II Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles and... further review, the Cost Principles for Hospitals at 45 CFR Part 74, Appendix E. The proposal consolidates... instructed the OMB Director to ``review and where appropriate revise guidance concerning cost principles...

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Analysis of Precursor Properties of mixed Al/Alumel Cylindrical Wire Arrays*

Science.gov (United States)

Stafford, A.; Safronova, A. S.; Kantsyrev, V. L.; Esaulov, A. A.; Weller, M. E.; Shrestha, I.; Osborne, G. C.; Shlyaptseva, V. V.; Keim, S. F.; Coverdale, C. A.; Chuvatin, A. S.

2012-10-01

Previous studies of mid-Z (Cu and Ni) cylindrical wire arrays (CWAs) on Zebra have found precursors with high electron temperatures of >300 eV. However, past experiments with Al CWAs did not find the same high temperature precursors. New precursor experiments using mixed Al/Alumel (Ni 95%, Si 2%, and Al 2%) cylindrical wire arrays have been performed to understand how the properties of L-shell Ni precursor will change and whether Al precursor will be observed. Time gated spectra and pinholes are used to determine precursor plasma conditions for comparison with previous Alumel precursor experiments. A full diagnostic set which included more than ten different beam-lines was implemented. Future work in this direction is discussed. [4pt] *This work was supported by NNSA under DOE Cooperative Agreements DE-FC52-06NA27588, and in part by DE-FC52-06NA27586, and DE-FC52-06NA27616. Sandia is a multi-program laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy under Contract DE-AC04-94AL85000.

Role of activatory Fc gamma RI and Fc gamma RIII and inhibitory Fc gamma RII in inflammation and cartilage destruction during experimental antigen-induced arthritis.

NARCIS (Netherlands)

Lent, P.L.E.M. van; Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Sloetjes, A.W.; Putte, L.B.A. van de; Verbeek, S.; Berg, W.B. van den

2001-01-01

IgG-containing immune complexes, which are found in most RA joints, communicate with hematopoietic cells using three classes of Fc receptors(Fc gamma RI, -II, -III). In a previous study we found that if a chronic T-cell-mediated antigen-induced arthritis (AIA) was elicited in knee joints of FcR

Technology Cooperation Agreement Pilot Project: Development-Friendly Greenhouse Gas Reduction

Energy Technology Data Exchange (ETDEWEB)

Keegan, P.

1998-10-30

This paper provides an overview of TCAPP, including the methodology, the results to date, and proposed future activities. It includes a detailed description of the technology cooperation frameworks completed by each country, the process that produced them and the plans for how TCAPP will help to implement the directions articulated by the country teams. The US Government initiated the Technology Cooperation Agreement Pilot Project (TCAPP) in August 1997 in recognition of the need to establish a mechanism for implementing Article 4.5 of the Framework Convention on Climate Change. ''The developed country partners shall take all practicable steps to promote, facilitate and finance, as appropriate, the transfer of, or access to, environmentally sound technologies and know-how to other Parties, particularly developing country Parties, to enable them to implement the provisions of the Convention.'' TCAPP builds support for implementing clean energy technologies by facilitating collaboration among the participating countries, the US and other OECD countries, international donors, and the private sector. The governments of Brazil, China, Kazakhstan, Mexico and the Philippines are currently participating and helping to shape this initiative. International donors and the private sector have also been actively engaged in the design and implementation of this pilot program.

Dielectric properties for SF6 and SF6 mixtures predicted from basic data

International Nuclear Information System (INIS)

Kline, L.E.; Davies, D.K.; Chen, C.L.; Chantry, P.J.

1979-01-01

We have calculated α and eta, the ionization and attachment coefficients, and (E/N) *, the limiting breakdown electric-field--to--gas-density ratio, in SF 6 and SF 6 mixtures by numerically solving the Boltzmann equation for the electron energy distribution. The calculations require a knowledge of several electron collision cross sections. Published momentum transfer and ionization cross sections for SF 6 were used. We measured various attachment cross sections for SF 6 using electron-beam techniques with mass spectrometric ion detection. We determined a total cross section for electronic excitation of SF 6 by comparing the predicted values of α, eta, and (E/N) * with our measured values obtained from spatial current growth experiments in SF 6 in uniform fields over an extended range of E/N. With this self-consistent set of SF 6 cross sections, together with published He and N 2 cross sections, it was then possible to predict the dielectric properties of SF 6 -He and SF 6 -N 2 mixtures. Published experimental values of α for the SF 6 -He mixtures lie between the values of α calculated with and without ionization of SF 6 by excited He atoms. Published experimental values of (E/N) * agree with our calculations to within 5% in both the SF 6 -He and the SF 6 -N 2 mixtures

Validation of the SF-6D Health State Utilities Measure in Lower Extremity Sarcoma

Directory of Open Access Journals (Sweden)

Kenneth R. Gundle

2014-01-01

Full Text Available Aim. Health state utilities measures are preference-weighted patient-reported outcome (PRO instruments that facilitate comparative effectiveness research. One such measure, the SF-6D, is generated from the Short Form 36 (SF-36. This report describes a psychometric evaluation of the SF-6D in a cross-sectional population of lower extremity sarcoma patients. Methods. Patients with lower extremity sarcoma from a prospective database who had completed the SF-36 and Toronto Extremity Salvage Score (TESS were eligible for inclusion. Computed SF-6D health states were given preference weights based on a prior valuation. The primary outcome was correlation between the SF-6D and TESS. Results. In 63 pairs of surveys in a lower extremity sarcoma population, the mean preference-weighted SF-6D score was 0.59 (95% CI 0.4–0.81. The distribution of SF-6D scores approximated a normal curve (skewness = 0.11. There was a positive correlation between the SF-6D and TESS (r=0.75, P<0.01. Respondents who reported walking aid use had lower SF-6D scores (0.53 versus 0.61, P=0.03. Five respondents underwent amputation, with lower SF-6D scores that approached significance (0.48 versus 0.6, P=0.06. Conclusions. The SF-6D health state utilities measure demonstrated convergent validity without evidence of ceiling or floor effects. The SF-6D is a health state utilities measure suitable for further research in sarcoma patients.

Rapid desensitization of mice with anti-FcγRIIb/FcγRIII mAb safely prevents IgG-mediated anaphylaxis.

Science.gov (United States)

Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D

2013-12-01

Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.

76 FR 61597 - Grants and Cooperative Agreements to State and Local Governments: DOT Amendments on Regulations...

Science.gov (United States)

2011-10-05

... organization or a Principles and Procedures, or non-profit organization listed in 2 uniform cost accounting CFR... Principles and Procedures, or non-profit organization listed in 2 uniform cost accounting CFR part 230... to applicable cost principles for grants and cooperative agreements with State and Local Governments...

77 FR 17360 - Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles And...

Science.gov (United States)

2012-03-26

... II Reform of Federal Policies Relating to Grants and Cooperative Agreements; Cost Principles And...; cost principles and administrative requirements (including Single Audit Act). The original comment...-idx?c=ecfr&tpl=/ecfrbrowse/Title02/2cfrv1_02.tpl . The Cost Principles for Hospitals are in the...

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

Cooperative study with sup(99m)Tc diisopropil-IDA on biliary tract diseases

International Nuclear Information System (INIS)

Mitta, A.E.A.; Mollerach, F; Almeida, C.A.

1982-01-01

The results of a cooperative study on the investigation of the biliary tract with sup(99m)Tc diisopropyl-IDA are presented. 15 normal volunteers and 75 patients with acute cholecystitis (AC), chronic cholecystitis (CC), hepatocellular jaundice (HCJ), incomplete extrahepatic biliary obstruction (IEBO) and complete extrahepatic biliary obstruction (CEBO) were studied. The biological behaviour of the radiopharmaceutical in the two groups was determined through the measurement of the uptake times and of the times of arrival in the hepatic parenchyma, in the intra and extrahepatic bile ducts, in the gallbladder, in the duodenum and in the kidneys. The pathophysiologic features found in the AC, CC, HCJ, IEBO and CEBO are described. It is concluded that the procedure has a selective indication in the AC, that its value is limited in the CC, and that in jaundice, except in very special situations, the method gives very little information of clinic value. The possibility of performing cooperative scientific studies between Latin-American Departments, increasing their efficiency, is emphasized. (author) [es

Fc-fusion Proteins in Therapy: An Updated View.

Science.gov (United States)

Jafari, Reza; Zolbanin, Naime M; Rafatpanah, Houshang; Majidi, Jafar; Kazemi, Tohid

2017-01-01

Fc-fusion proteins are composed of Fc region of IgG antibody (Hinge-CH2-CH3) and a desired linked protein. Fc region of Fc-fusion proteins can bind to neonatal Fc receptor (FcRn) thereby rescuing it from degradation. The first therapeutic Fc-fusion protein was introduced for the treatment of AIDS. The molecular designing is the first stage in production of Fc-fusion proteins. The amino acid residues in the Fc region and linked protein are very important in the bioactivity and affinity of the fusion proteins. Although, therapeutic monoclonal antibodies are the top selling biologics but the application of therapeutic Fc-fusion proteins in clinic is in progress and among these medications Etanercept is the most effective in therapy. At present, eleven Fc-fusion proteins have been approved by FDA. There are novel Fc-fusion proteins which are in pre-clinical and clinical development. In this article, we review the molecular and biological characteristics of Fc-fusion proteins and then further discuss the features of novel therapeutic Fc-fusion proteins. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

The "11K" gene family members sf68, sf95 and sf138 modulate transmissibility and insecticidal properties of Spodoptera frugiperda multiple nucleopolyhedrovirus.

Science.gov (United States)

Beperet, Inés; Simón, Oihane; Williams, Trevor; López-Ferber, Miguel; Caballero, Primitivo

2015-05-01

The "11K" gene family is notable for having homologs in both baculoviruses and entomopoxviruses and is classified as either type 145 or type 150, according to their similarity with the ac145 or ac150 genes of Autographa californica multiple nucleopolyhedrovirus (AcMNPV). One homolog of ac145 (sf138) and two homologs of ac150 (sf68 and sf95) are present in Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV). Recombinant bacmids lacking sf68, sf95 or sf138 (Sf68null, Sf95null and Sf138null, respectively) and the respective repair bacmids were generated from a bacmid comprising the complete virus genome. Occlusion bodies (OBs) of the Sf138null virus were ∼15-fold less orally infective to insects, which was attributed to a 100-fold reduction in ODV infectious titer. Inoculation of insects with Sf138null OBs in mixtures with an optical brightener failed to restore the pathogenicity of Sf138null OBs to that of the parental virus, indicating that the effects of sf138 deletion on OB pathogenicity were unlikely to involve an interaction with the gut peritrophic matrix. In contrast, deletion of sf68 and sf95 resulted in a slower speed-of-kill by 9h, and a concurrent increase in the yield of OBs. Phylogenetic analysis indicated that sf68 and sf95 were not generated after a duplication event of an ancestral gene homologous to the ac150 gene. We conclude that type 145 genes modulate the primary infection process of the virus, whereas type 150 genes appear to have a role in spreading systemic infection within the insect. Copyright © 2015 Elsevier Inc. All rights reserved.

Dicty_cDB: FC-BR21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

The Text of the Agreement of 22 July 1977 between Argentina and the Agency for the Application of Safeguards in Connection with a Co-operation Agreement between Argentina and Canada

Energy Technology Data Exchange (ETDEWEB)

NONE

1977-11-28

The text of the Agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with the Agreement of 30 January 1976 between the Governments of Argentina and Canada for co-operation in the development and application of atomic energy for peaceful purposes is reproduced in this document for the information of all Members. The Agreement entered into force, pursuant to Section 31, on 22 July 1977.

The Text of the Agreement of 22 July 1977 between Argentina and the Agency for the Application of Safeguards in Connection with a Co-operation Agreement between Argentina and Canada

International Nuclear Information System (INIS)

1977-01-01

The text of the Agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with the Agreement of 30 January 1976 between the Governments of Argentina and Canada for co-operation in the development and application of atomic energy for peaceful purposes is reproduced in this document for the information of all Members. The Agreement entered into force, pursuant to Section 31, on 22 July 1977.

77 FR 28883 - Cooperative Agreement To Support Innovation in Vaccine Clinical Trial Design and Collaboration in...

Science.gov (United States)

2012-05-16

... statistical and mathematical algorithms), and other approaches would be considered. b. Improvements in the... consider a single source application for an award of a cooperative agreement to the World Health...: Important dates are as follows: 1. The application due date is June 15, 2012. 2. The anticipated start date...

76 FR 45618 - Solicitation for a Cooperative Agreement-Two Hearings of the National Institute of Corrections...

Science.gov (United States)

2011-07-29

... on the subject of organizational culture (hearing 1) and cost containment (hearing 2). The first... under this cooperative agreement will organize and coordinate all logistical details for two hearings of... or NIC staff travel, lodging, or per diem costs. Arrangements should allow for up to 25 observers who...

76 FR 54235 - Supplement to the FY2010 Single-Source Cooperative Agreement With the World Health Organization...

Science.gov (United States)

2011-08-31

...''. BARDA currently funds the development of vaccine manufacturing capacity in ten developing and emerging-economy countries worldwide via a cooperative agreement with the World Health Organization (WHO). The... Research and Development Authority was developed and has been operational [[Page 54236

Cross-Linking GPVI-Fc by Anti-Fc Antibodies Potentiates Its Inhibition of Atherosclerotic Plaque- and Collagen-Induced Platelet Activation

Directory of Open Access Journals (Sweden)

Janina Jamasbi, RPh

2016-04-01

Full Text Available To enhance the antithrombotic properties of recombinant glycoprotein VI fragment crystallizable (GPVI-Fc, the authors incubated GPVI-Fc with anti-human Fc antibodies to cross-link the Fc tails of GPVI-Fc. Cross-linking potentiated the inhibition of human plaque- and collagen-induced platelet aggregation by GPVI-Fc under static and flow conditions without increasing bleeding time in vitro. Cross-linking with anti-human-Fc Fab2 was even superior to anti-human-Fc immunoglobulin G (IgG. Advanced optical imaging revealed a continuous sheath-like coverage of collagen fibers by cross-linked GPVI-Fc complexes. Cross-linking of GPVI into oligomeric complexes provides a new, highly effective, and probably safe antithrombotic treatment as it suppresses platelet GPVI-plaque interaction selectively at the site of acute atherothrombosis.

The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.

Science.gov (United States)

Abdiche, Yasmina Noubia; Yeung, Yik Andy; Chaparro-Riggers, Javier; Barman, Ishita; Strop, Pavel; Chin, Sherman Michael; Pham, Amber; Bolton, Gary; McDonough, Dan; Lindquist, Kevin; Pons, Jaume; Rajpal, Arvind

2015-01-01

The neonatal Fc receptor (FcRn) is expressed by cells of epithelial, endothelial and myeloid lineages and performs multiple roles in adaptive immunity. Characterizing the FcRn/IgG interaction is fundamental to designing therapeutic antibodies because IgGs with moderately increased binding affinities for FcRn exhibit superior serum half-lives and efficacy. It has been hypothesized that 2 FcRn molecules bind an IgG homodimer with disparate affinities, yet their affinity constants are inconsistent across the literature. Using surface plasmon resonance biosensor assays that eliminated confounding experimental artifacts, we present data supporting an alternate hypothesis: 2 FcRn molecules saturate an IgG homodimer with identical affinities at independent sites, consistent with the symmetrical arrangement of the FcRn/Fc complex observed in the crystal structure published by Burmeister et al. in 1994. We find that human FcRn binds human IgG1 with an equilibrium dissociation constant (KD) of 760 ± 60 nM (N = 14) at 25°C and pH 5.8, and shows less than 25% variation across the other human subtypes. Human IgG1 binds cynomolgus monkey FcRn with a 2-fold higher affinity than human FcRn, and binds both mouse and rat FcRn with a 10-fold higher affinity than human FcRn. FcRn/IgG interactions from multiple species show less than a 2-fold weaker affinity at 37°C than at 25°C and appear independent of an IgG's variable region. Our in vivo data in mouse and rat models demonstrate that both affinity and avidity influence an IgG's serum half-life, which should be considered when choosing animals, especially transgenic systems, as surrogates.

Marijuana Craving Questionnaire (MCQ-SF/Versão Brasil: validação semântica Marijuana Craving Questionnaire (MCQ-SF/Brazil Version: semantic validation

Directory of Open Access Journals (Sweden)

Rosemeri Siqueira Pedroso

2009-01-01

Full Text Available OBJETIVO: O objetivo deste estudo foi realizar tradução e adaptação transcultural do Marijuana Craving Questionnaire (MCQ-SF10, que avalia o craving por maconha em uma amostra brasileira. MÉTODO: O MCQ-SF foi traduzido do inglês para o português, aplicado em 10 sujeitos, submetido ao brainstorming num grupo de três indivíduos para reprodução individual e verbal, item a item. Realizou-se o back-translation, uma versão para o idioma de origem, a partir da primeira tradução e do brainstorming. Logo após, traduziu-se novamente para o português. Um comitê de juízes especialistas analisou todas as traduções. RESULTADOS: Após as considerações do comitê e um estudo-piloto com 30 sujeitos, a versão final do MCQ-SF/Versão Brasil foi construída. CONCLUSÃO: Os resultados demonstraram uma equivalência semântica satisfatória entre as versões. O MCQ-SF/Versão Brasil pode ser útil para avaliar o craving pela maconha nos dependentes dessa substância.OBJECTIVE: The aim of this study was to translate and adapt culturally the Marijuana Craving Questionnaire (MCQ-SF10 which evaluates the craving for marijuana in a Brazilian sample. METHOD: The Marijuana Craving Questionnaire (MCQ-SF was translated from English to Portuguese, administered to 10 subjects, submitted to a brainstorming in a group of three people for individual and verbal reproduction, item by item. Back-translation was executed, a translation for the original language, based on first translation and from brainstorming. Soon after, it was translated again into Portuguese. A committee of specialists analyzed all translations. RESULTS: After the committee considerations and a pilot study with 30 subjects, the final version of MCQ-SF/Versão Brasil was built. CONCLUSION: The results showed a satisfactory semantic equivalence between versions. The MCQ/Versão Brasil can be useful to evaluate the craving for marijuana on the dependents of this substance.

Immunoglobulin Fc receptors in clinical strains of Staphylococcus aureus do not confer resistance to Phagocytosis in an in vitro assay Los receptores Fc para inmunoglobulinas en cepas clínicas de Staphylococcus aureus no confieren resistencia a la fagocitosis in vitro

Directory of Open Access Journals (Sweden)

Benito VEGA

1999-05-01

Full Text Available Staphylococcus aureus binds Immunoglobulin G (IgG on its external surface due to the presence of specific receptors for the Fc domain of this immunoglobulin. This mechanism represents a kind of camouflage against phagocytic cells. In order to confirm that possibility an in vitro evaluation of the phagocytic activity of leukocytes polymorpho-nuclear (PMN against strains of Staphylococcus aureus was done, comparing 18 strains isolated from clinical samples and 16 from healthy individuals. The presence of Fc receptors was evaluated by haemagglutination (HA with erythrocytes group A after incubation of the strains with IgG anti blood group A. Phagocytosis of S. aureus was carried out by mixing live bacteria with a suspension of human PMN and incubating at 37 °C for 1 h; survivors were counted as colony forming units by plating. The strains from clinical specimens showed higher HA than those from healthy individuals (p = 0.01; but the former were killed more efficiently than the latter (80-90% and 40%, respectively. It is may be possible that S. aureus showed different behavior in vivo, where could express other virulence factors to prevent the action of phagocytes.Staphylococcus aureus liga inmunoglobulinas G (IgG a su superficie externa debido a la presencia de receptores para el dominio Fc de esas inmunoglobulinas. Este mecanismo representa una clase de camuflage contra células fagocíticas. Para confirmar tal posibilidad se realizó una evaluación in vitro de la actividad fagocítica de leucocitos polimorfonucleares (PMN contra cepas de Staphylococcus aureus, comparando 18 cepas aisladas de casos clínicos y 16 de individuos sanos. La presencia de receptores fue evaluada por hemaglutinación (HA con eritrocitos grupo A luego que las cepas fueron incubadas con IgG anti grupo sanguíneo A. La fagocitosis de S. aureus fue realizada mezclando células vivas con una suspensión de PMN e incubada a 37 °C por una hora; las bacterias sobrevivientes

The text of the agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with a co-operation agreement between Argentina and Canada

International Nuclear Information System (INIS)

1995-01-01

The Agreement between the Republic of Argentina, the Federative Republic of Brazil, the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials and the International Atomic Energy Agency for the Application of Safeguards came into force on 4 March 1994. As a result of the coming into force of the aforesaid Agreement for Argentina, the application of safeguards under the Agreement of 22 July 1977 between Argentina and the IAEA for the application of safeguards in connection with a co-operation agreement between Argentina and Canada has been suspended

SF12: Stata module to alidate sf12 input and calculate sf12 version 2 t scores

DEFF Research Database (Denmark)

2015-01-01

sf12 takes 12 variables in correct order (i1 i2a i2b i3a i3b i4a i4b i5 i6a i6b i6c i7), validate the variables with respect to sf12 requirements. Only rows that are correct are used for calculating the sf12 t scores....

An Industrial-Based Consortium to Develop Premium Carbon Products from Coal, Annual Progress Report, October 1, 2004 through September 30, 2005

Energy Technology Data Exchange (ETDEWEB)

Miller, Bruce G

2006-03-01

Since 1998, The Pennsylvania State University (PSU) has been successfully operating the Consortium for Premium Carbon Products from Coal (CPCPC), which is a vehicle for industry-driven research on the promotion, development, and transfer of innovative technology on premium carbon produces from coal to the U.S. industry. The CPCPC is an initiative being led by PSU, its co-charter member West Virginia University (WVU), and the U.S. Department of Energy's (DOE) National Energy Technology Laboratory (NETL), who also provides the base funding for the program, with PSU responsible for consortium management. CPCPC began in 1998 under DOE Cooperative Agreement No. DE-FC26-98FT40350. This agreement ended November 2004 but the CPCPC activity has continued under the present cooperative agreement, No. DE-FC26-03NT41874, which started October 1, 2003. The objective of the second agreement is to continue the successful operation of the CPCPC. The CPCPC has enjoyed tremendous success with its organizational structure, that includes PSU and WVU as charter members, numerous industrial affiliate members, and strategic university affiliate members together with NETL, forming a vibrant and creative team for innovative research in the area of transforming coal to carbon products. The key aspect of CPCPC is its industry-led council that selects proposals submitted by CPCPC members to ensure CPCPC target areas have strong industrial support. A second contract was executed with DOE NETL starting in October 2003 to continue the activities of CPCPC. An annual funding meeting was held in October 2003 and the council selected ten projects for funding. Base funding for the projects is provided by NETL with matching funds from industry. Subcontracts were let from Penn State to the subcontractors on March 1, 2004. Nine of the ten projects have been completed and the final reports for these 2004 projects are attached. An annual funding meeting was held in November 2004 and the council

77 FR 38640 - Cooperative Agreements for the Office of Direct Service and Contracting Tribes Under the National...

Science.gov (United States)

2012-06-28

... the target population. Include a strategic plan and business plan currently in place that are being.../AIDS Strategic Plan. II. Award Information Type of Award Cooperative Agreements. Estimated Funds... with Tribal Leaders as appropriate to address effective prevention interventions for AI/AN populations...

FISCALIDAD DE LAS SOCIEDADES COOPERATIVAS DE SEGUNDO GRADO./SECOND DEGREE COOPERATIVES FROM A TAX POINT OF VIEW

Directory of Open Access Journals (Sweden)

Emilio NAVARRO HERAS

2007-01-01

Full Text Available Este artículo trata de mostrar la especial tributación de las sociedades cooperativas de segundo grado, como instrumento de integración tradicionalmente utilizado por las sociedades cooperativas para emprender procesos de concentración. Centraremos el estudio de su fiscalidad en el Impuesto sobre Sociedades por las particularidades tributarias que presenta el mismo en este tipo societario. Respecto a este impuesto las sociedades cooperativas de segundo grado pueden optar por tributar como simples sociedades cooperativas, acogiéndose a la Ley 20/1990, de 19 de diciembre, sobre Régimen Fiscal de Cooperativas, o hacerlo como grupo cooperativo, amparándose en el régimen especial de tributación consolidada establecido para este tipo social. Al igual que las sociedades de primer grado éstas disfrutan de una serie de beneficios fiscales tanto en la imposición directa como en la indirecta, como consecuencia de la naturaleza social de las mismas./In this paper we show the special tax system of the second degree cooperatives, as a mean of integration used by them for concentration processes. We focus on the income tax for its legal peculiarities for this kind of firms. In relation to this same tax, second degree cooperatives can choose between to pay their taxes as simple cooperatives (Law 20/1990, December 19th or as cooperative groups (Consolidation taxation. As first degree cooperatives, these ones have some tax profits in direct and indirect taxation due to their social nature.

78 FR 49757 - Notification of an Expansion to the Cooperative Agreement Award to the World Health Organization

Science.gov (United States)

2013-08-15

... Award to the World Health Organization AGENCY: Biomedical Advanced Research and Development Authority... requires notification to World Health Organization (WHO) as soon as possible, and any confirmed smallpox... Services (HHS). ACTION: Notification of an expansion to the Cooperative Agreement Award to the World Health...

Annual Program Progress Report under DOE/PHRI Cooperative Agreement: (July 1, 2001-June 30, 2002)

Energy Technology Data Exchange (ETDEWEB)

Palafox, Neal A., MD, MPH

2002-07-31

OAK B188 DOE/PHRI Special Medical Care Program in the Republic of the Marshall Islands (RMI)Annual Program Progress Report. The DOE Marshall Islands Medical Program continued, in this it's 48th year, to provide medical surveillance for the exposed population from Rongelap and Utrik and the additional DOE patients. The program was inaugurated in 1954 by the Atomic Energy Commission following the exposure of Marshallese to fallout from a nuclear test (Castle Bravo) at Bikini Atoll. This year marks the fourth year in which the program has been carried out by PHRI under a cooperative agreement with DOE. The DOERHRI Special Medical Care Program, awarded the cooperative agreement on August 28, 1998, commenced its health care program on January 15, 1999, on Kwajalein and January 22, 1999, on Majuro. This report details the program for the July 1, 2001, through the June 30, 2002, period. The program provides year-round, on-site medical care to the DOE patient population residing in the Republic of the Marshall Islands (RMI) and annual examinations to those patients living in Hawaii and on the Continental U.S.

Dielectric properties for SF6 and SF6 mixtures predicted from basic data

International Nuclear Information System (INIS)

Kline, L.E.; Davies, D.K.; Chen, C.L.; Chantry, P.J.

1978-01-01

α and eta, the ionization and attachment coefficients, and (E/N)*, the limiting breakdown electric field-to-gas density ratio, in SF 6 and SF 6 mixtures were calculated by numerically solving the Boltzmann equation for the electron energy distribution. The calculations require a knowledge of several electron collision cross sections. Published momentum transfer and ionization cross sections for SF 6 were used. Various attachment cross sections for SF 6 were measured by using electron beam techniques with mass spectrometric ion detection. A total cross section for electronic excitation of SF 6 was determined by comparing the predicted values of α, eta, and (E/N)* with measured values obtained from spatial current growth experiments in SF 6 in uniform fields over an extended range of E/N. With this self-consistent set of SF 6 cross sections, together with published He cross sections, it was then possible to predict the dielectric properties of SF 6 --He mixtures. Published experimental values of α for these mixtures lie between the values of α calculated with and without ionization of SF 6 by excited He atoms. Published experimental values of (E/N)* agree with the calculations to within 5%. 11 figures

Coal-Based Oxy-Fuel System Evaluation and Combustor Development; Oxy-Fuel Turbomachinery Development for Energy Intensive Industrial Applications

Energy Technology Data Exchange (ETDEWEB)

Hollis, Rebecca

2013-03-31

Clean Energy Systems, Inc. (CES) partnered with the U.S. Department of Energy’s National Energy Technology Laboratory in 2005 to study and develop a competing technology for use in future fossil-fueled power generation facilities that could operate with near zero emissions. CES’s background in oxy-fuel (O-F) rocket technology lead to the award of Cooperative Agreement DE-FC26-05NT42645, “Coal-Based Oxy-Fuel System Evaluation and Combustor Development,” where CES was to first evaluate the potential of these O-F power cycles, then develop the detailed design of a commercial-scale O-F combustor for use in these clean burning fossil-fueled plants. Throughout the studies, CES found that in order to operate at competitive cycle efficiencies a high-temperature intermediate pressure turbine was required. This led to an extension of the Agreement for, “Oxy-Fuel Turbomachinery Development for Energy Intensive Industrial Applications” where CES was to also develop an intermediate-pressure O-F turbine (OFT) that could be deployed in O-F industrial plants that capture and sequester >99% of produced CO2, at competitive cycle efficiencies using diverse fuels. The following report details CES’ activities from October 2005 through March 2013, to evaluate O-F power cycles, develop and validate detailed designs of O-F combustors (main and reheat), and to design, manufacture, and test a commercial-scale OFT, under the three-phase Cooperative Agreement.

Comparação das formas de aplicação papel e caneta e eletrônica do índice de estresse parental versão reduzida (PSI-SF

Directory of Open Access Journals (Sweden)

Camila Piccini Aiello

2014-04-01

Full Text Available Objetivo avaliar se a aplicação eletrônica do Índice de Estresse Parental – versão reduzida (PSI-SF é comparável à aplicação em formato papel e caneta. Verificar o estresse em pais de crianças com desenvolvimento normal. Métodos quarenta adultos, pais de crianças entre seis meses e 10 anos, foram divididos em quatro grupos, sendo pareados por idade, sexo, escolaridade e idade da criança. Cada participante completou o questionário em duas ocasiões, com intervalo de sete a dez dias, nas versões: papel-caneta/papel-caneta (PP, papel-caneta/eletrônico (PE, eletrônico/eletrônico (EE, eletrônico/papel-caneta (EP. O PSI-SF apresenta 36 afirmações, divididas em três subescalas: Sofrimento Parental (SP; Interações Disfuncionais entre Pai e Criança (IDPC e Criança Difícil (CD. Para análise dos dados foram realizadas as correlações (Pearson e comparação da pontuação do PSI-SF intra e inter-grupos. Resultados foram obtidas correlações positivas fortes e médias e significantes entre a pontuação total e das subescalas do PSI-SF na primeira e segunda aplicação, para todos os grupos. Diferenças significantes foram observadas entre as médias das pontuações para o grupo PP (subescala “Criança Difícil”; e grupo EE (subescala “Criança Difícil”; e pontuação total. No entanto, tais diferenças de pontuação não alteraram a interpretação do resultado do questionário. Não houve diferença significante entre os grupos para as quatro subescalas analisadas, confirmando equivalência da variância entre os grupos. O estresse dos participantes, em todas as subescalas, recaiu dentro da normalidade. Conclusão a aplicação no formato eletrônico do questionário PSI-SF apresenta resultados semelhantes à aplicação papel e caneta. Os níveis de estresse observados foram considerados normais.

Divertor extreme ultraviolet (EUV) survey spectroscopy in DIII-D

Science.gov (United States)

McLean, Adam; Allen, Steve; Ellis, Ron; Jarvinen, Aaro; Soukhanovskii, Vlad; Boivin, Rejean; Gonzales, Eduardo; Holmes, Ian; Kulchar, James; Leonard, Anthony; Williams, Bob; Taussig, Doug; Thomas, Dan; Marcy, Grant

2017-10-01

An extreme ultraviolet spectrograph measuring resonant emissions of D and C in the lower divertor has been added to DIII-D to help resolve an 2X discrepancy between bolometrically measured radiated power and that predicted by boundary codes for DIII-D, JET and ASDEX-U. With 290 and 450 gr/mm gratings, the DivSPRED spectrometer, an 0.3 m flat-field McPherson model 251, measures ground state transitions for D (the Lyman series) and C (e.g., C IV, 155 nm) which account for >75% of radiated power in the divertor. Combined with Thomson scattering and imaging in the DIII-D divertor, measurements of position, temperature and fractional power emission from plasma components are made and compared to UEDGE/SOLPS-ITER. Mechanical, optical, electrical, vacuum, and shielding aspects of DivSPRED are presented. Work supported under USDOE Cooperative Agreement DE-FC02-04ER54698 and DE-AC52-07NA27344, and by the LLNL Laboratory Directed R&D Program, project #17-ERD-020.

The Text of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology, 1987. Status of Acceptances as of 28 February 1993

International Nuclear Information System (INIS)

1993-04-01

As of 28 February 1993, notifications of acceptance of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 1987 (See INFCIRC/ 167/Add.15), in accordance with Article 2 thereof, had been received by the Director General from the Governments [ru

The Text of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training related to Nuclear Science and Technology, 1987. Status of Acceptances as of 28 February 1993

International Nuclear Information System (INIS)

1993-04-01

As of 28 February 1993, notifications of acceptance of the Agreement to Extend the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology, 1987 (See INFCIRC/ 167/Add.15), in accordance with Article 2 thereof, had been received by the Director General from the Governments [es

Human FcγRIIA induces anaphylactic and allergic reactions.

Science.gov (United States)

Jönsson, Friederike; Mancardi, David A; Zhao, Wei; Kita, Yoshihiro; Iannascoli, Bruno; Khun, Huot; van Rooijen, Nico; Shimizu, Takao; Schwartz, Lawrence B; Daëron, Marc; Bruhns, Pierre

2012-03-15

IgE and IgE receptors (FcεRI) are well-known inducers of allergy. We recently found in mice that active systemic anaphylaxis depends on IgG and IgG receptors (FcγRIIIA and FcγRIV) expressed by neutrophils, rather than on IgE and FcεRI expressed by mast cells and basophils. In humans, neutrophils, mast cells, basophils, and eosinophils do not express FcγRIIIA or FcγRIV, but FcγRIIA. We therefore investigated the possible role of FcγRIIA in allergy by generating novel FcγRIIA-transgenic mice, in which various models of allergic reactions induced by IgG could be studied. In mice, FcγRIIA was sufficient to trigger active and passive anaphylaxis, and airway inflammation in vivo. Blocking FcγRIIA in vivo abolished these reactions. We identified mast cells to be responsible for FcγRIIA-dependent passive cutaneous anaphylaxis, and monocytes/macrophages and neutrophils to be responsible for FcγRIIA-dependent passive systemic anaphylaxis. Supporting these findings, human mast cells, monocytes and neutrophils produced anaphylactogenic mediators after FcγRIIA engagement. IgG and FcγRIIA may therefore contribute to allergic and anaphylactic reactions in humans.

A meta-analytic review of measurement equivalence study findings of the SF-36® and SF-12® Health Surveys across electronic modes compared to paper administration.

Science.gov (United States)

White, Michelle K; Maher, Stephen M; Rizio, Avery A; Bjorner, Jakob B

2018-04-16

Patient-reported outcome (PRO) measures originally developed for paper administration are increasingly being administered electronically in clinical trials and other health research studies. Three published meta-analyses of measurement equivalence among paper and electronic modes aggregated findings across hundreds of PROs, but there has not been a similar meta-analysis that addresses a single PRO, partly because there are not enough published measurement equivalence studies using the same PRO. Because the SF-36 (R) Health Survey (SF-36) is a widely used PRO, the aim of this study was to conduct a meta-analysis of measurement equivalence studies of this survey. A literature search of several medical databases used search terms for variations of "SF-36" or "SF-12" and "equivalence" in the title or abstract of English language publications. The eight scale scores and two summary measures of the SF-36 and SF-12 were transformed to norm-based scores (NBS) using developer guidelines. A threshold of within ± 2 NBS points was set as the margin of equivalence. Comprehensive meta-analysis software was used. Twenty-five studies were included in the meta-analysis. Results indicated that mean differences across domains and summary scores ranged from 0.01 to 0.39 while estimates of agreement ranged from 0.76 to 0.91, all well within the equivalence threshold. Moderator analyses showed that time between administration, survey language, and type of electronic device did not influence equivalence. The results of the meta-analysis support equivalence of paper-based and electronic versions of the SF-36 and SF-12 across a variety of disease populations, countries, and electronic modes.

SUBTASK 6.1 – STRATEGIC STUDIES

Energy Technology Data Exchange (ETDEWEB)

Erickson, Thomas; Harju, John; Steadman, Edward; Holmes, Michael

2015-05-31

The Energy & Environmental Research Center (EERC) has recently completed 7 years of research through the Cooperative Agreement with the U.S. Department of Energy (DOE) National Energy Technology Laboratory (NETL) focused on fossil energy technology development and demonstration. To support a significant number of the different activities being considered within all of our research contracts with NETL, a subtask (6.1 – Strategic Studies) was created to focus on small research efforts that came up throughout the year that would support an existing EERC–NETL project or would help to develop a new concept for inclusion in future efforts. This subtask was funded through the EERC–DOE Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26- 08NT43291

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

International Nuclear Information System (INIS)

1999-01-01

The document presents the status of acceptances as of 16 March 1999 of the extension of the African Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) which entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000. There are 25 States which notified the acceptance of the Agreement extension

Extension of the African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA)

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-11-23

The document presents the status of acceptances as of 6 October 1999 of the extension of the African Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) which entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000. There are 26 States which notified the acceptance of the Agreement extension.

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-04-19

The document presents the status of acceptances as of 16 March 1999 of the extension of the African Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) which entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000. There are 25 States which notified the acceptance of the Agreement extension

The Text of the Agreement between the Agency and Sweden for Co-Operation in the Provision of Assistance to Developing Countries

Energy Technology Data Exchange (ETDEWEB)

NONE

1970-02-05

The text of the Agreement between the Agency and the Government of Sweden relating to Co-operation in the Provision of Assistance to Developing Countries is reproduced in this document for the information of all Members. The Agreement entered into force on 18 January 1970 pursuant to Section 27 thereof.

The Text of the Agreement between the Agency and Sweden for Co-Operation in the Provision of Assistance to Developing Countries

International Nuclear Information System (INIS)

1970-01-01

The text of the Agreement between the Agency and the Government of Sweden relating to Co-operation in the Provision of Assistance to Developing Countries is reproduced in this document for the information of all Members. The Agreement entered into force on 18 January 1970 pursuant to Section 27 thereof.

Cooperation agreement between the Technical University Dresden and AREVA NP GmbH

International Nuclear Information System (INIS)

Hurtado, A.; Hansen, V.; Druschel, R.; Heyer, J.

2008-01-01

As a result of the complete refurbishment of the Technical University Dresden (TUD) training reactor AKR and its equipment with the digital safety system TELEPERM XS by AREVA NP it is actually the most advanced facility in this category in Germany. Following the positive experience gained during project execution an agreement between AREVA NP and TUD was signed to bundle each organizations competence's in the interest of new recruits in the field of nuclear technology in 2006. The content and the experience with the cooperation are described in this paper. Conclusions show that both parties found an attractive way to support fellow young nuclear engineers. (authors)

Estudi empíric sobre els efectes de l’aplicació de la NIC 32 a les cooperatives Empirical study about the effects of the application of IAS 32 in Cooperatives Empirical study about the effects of the application of IAS 32 in Cooperatives

Directory of Open Access Journals (Sweden)

Lluís Carreras

2013-09-01

Full Text Available Objecte: L'aplicació de la NIC 32 en les cooperatives ha generat una important controvèrsia en els últims anys. Fins al moment, s'han realitzat diversos treballs que intenten preveure els possibles efectes de la seva aplicació. Aquest treball pretén analitzar l'impacte de la primera aplicació de la NIC 32 en el sector cooperatiu. Disseny/metodologia/enfocament: S'ha seleccionat una mostra de 98 cooperatives, i s'ha realitzat una anàlisi comparativa de la seva informació financera presentada abans i després de l'aplicació de la NIC 32, per a determinar les diferències existents. S’ha utilitzat la prova de la suma de rangs de Wilcoxon per comprovar si aquestes diferències són significatives. També s’ha utilitzat la prova de la U de Mann Whitney per comprovar si existeixen diferències significatives en l’impacte relatiu de l’aplicació de la NIC 32 entre diversos grups de cooperatives. Finalment, s'ha realitzat una anàlisi dels efectes de l'aplicació de la NIC 32 en la situació patrimonial i econòmica de les cooperatives, i en l'evolució dels seus actius intangibles, mitjançant l’ús de tècniques d’anàlisi econòmico-financera. Aportacions i resultats: Els resultats obtinguts confirmen que l'aplicació de la NIC 32 provoca diferències significatives en algunes partides del balanç de situació i el compte de pèrdues i guanys, així com en les ràtios analitzades. Les principals diferències es concreten en una reducció del nivell de capitalització i un augment de l'endeutament de les cooperatives, així com un empitjorament general dels ràtios de solvència i autonomia financera. Limitacions: Cal tenir en compte que el treball s'ha realitzat amb una mostra de cooperatives que estan obligades a auditar els seus comptes anuals. Per tant, els resultats obtinguts han d'interpretar-se en un context de cooperatives de tamany elevat. També cal tenir en compte que hem realitzat una anàlisi comparativa dels comptes

The Text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Physics

International Nuclear Information System (INIS)

1964-01-01

The text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Physics (the 'NPY Agreement') is reproduced in this document for the information of all Members

The Text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Physics

Energy Technology Data Exchange (ETDEWEB)

NONE

1964-05-14

The text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Physics (the 'NPY Agreement') is reproduced in this document for the information of all Members.

Intercommunal cooperation for the purpose of satisfying local power demand

International Nuclear Information System (INIS)

Kieres, L.

1992-01-01

The article deals with the following: communal competences in the area of the power economy; forms of communal activity in the area of power supply; specific forms of communal cooperation; the procedure of communal cooperation; legal personality and internal organization; the local administration union as an instrument of power supply; categorization of the local administration union with respect to the legal system; the communal administrative agreement. (HSCH) [de

US/FRG umbrella agreement for cooperation in GCR Development. Fuel, fission products, and graphite subprogram. Quarterly status report, July 1, 1982-September 30, 1982

International Nuclear Information System (INIS)

Turner, R.F.

1982-10-01

This report describes the status of the cooperative work being performed in the Fuel, Fission Product, and Graphite Subprogram under the HTR-Implementing Agreement of the United States/Federal Republic of Germany Umbrella Agreement for Cooperation in GCR Development. The status is described relative to the commitments in the Subprogram Plan for Fuel, Fission Products, and Graphite, Revision 5, April 1982. The work described was performed during the period July 1, 1982 through September 30, 1982 in the HTGR Base Technology Program at Oak Ridge National Laboratory, the HTGR Fuel and Plant Technology Programs at General Atomic Company (GA), and the Project HTR-Brennstoffkreislauf of the Entwicklungsgemeinschaft HTR at KFA Julich, HRB Mannheim, HOBEG Hanau, and SIGRI Meitingen. The requirement for and format of this quarterly status report are specified in the HTR Implementing Agreement procedures for cooperation. Responsibility for preparation of the quarterly report alternates between GA and KFA

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Brain Tumour Scintigraphy with {sup 99m}Tc-Pertechnetate, {sup 99m}Tc-Fe(II) Complex and {sup 131}I-Labelled Macroaggregated Albumin - Comparison of Results; La Scintigraphie des Tumeurs Cerebrales a l'Aide de Pertechnetate Marque au {sup 99m}Tc, de Complexe {sup 99m}Tc-Fe-II et de Macroagregats d'Albumine Marques au {sup 131}I. Comparaison des Resultats

Energy Technology Data Exchange (ETDEWEB)

Haas, J. P.; Dietz, H.; Schmidt, K. J.; Doerr, F.; Brod, K. H.; Wolf, R. [Institut de Radiologie Clinique et Clinique de Neurochirurgie, Universite de Mayence, Federal Republic of Germany (Germany)

1969-05-15

from a wide selection of case studies. (author) [French] Aujourd'hui le {sup 99m}Tc, sous forme de pertechnetate, a trouve sa place dans la scintigraphie cerebrale.' Selon les experiences des auteurs du memoire ainsi que celles d'autres auteurs, sa valeur diagnostique est egale a celle des substances marquees au mercure ou a l'iode. Tout en utilisant le pertechnetate marque au {sup 99m}Tc les auteurs ont cherche a elargir le diagnostic isotopique par deux methodes; l'injection intra-arterielle de macro-agregats d'albumine, et l'injection, par voie intraveineuse, d'une nouvelle substance, le complexe {sup 99m}Tc-Fe-II. Les auteurs ont publie en 1966 les resultats obtenus a l'aide de la premiere methode; ils presentent maintenant le bilan de leurs experiences sur un grand nombre de patients, plus de cent, souffrant de tumeurs cerebrales. Comparee a la scintigraphie au pertechnetate marque au {sup 99m}Tc apres injection par voie intraveineuse, la nouvelle methode donne des informations complementaires qui facilitent souvent grandement le diagnostic neuroradiologique clinique. La plupart des cas furent verifies par l'operation ou l'autopsie. La methode donne pour la premiere fois la possibilite de visualiser par la scintigraphie le reseau arteriel du cerveau. Les auteurs ont ete amenes a utiliser la deuxieme methode pour la detection des tumeurs cerebrales en raison de la facilite de mise en oeuvre de la scintigraphie cerebrale apres injection par voie intraveineuse, et parce qu'ils disposaient des resultats d'experiences effectuees avec le complexe {sup 99m}Tc-Fe-H sur la scintigraphie des reins ainsi que d'une breve communication parue dans la litterature americaine. Les premieres experiences montrent que cette substance est nettement superieure a toutes celles qui ont ete utilisees jusqu'ici par voie intraveineuse. Elle unit les avantages incontestables du {sup 99m}Tc, en ce qui concerne surtout la dose d'irradiation du patient, a la nettete extraordinaire de

Production of MO-99 from LEU targets-base-side processing

International Nuclear Information System (INIS)

Vandegrift, George F.; Koma, Yoshikazu; Cols, Hector; Conner, Cliff; Aase, Scott; Peter, Magdalin; Walker, David; Leonard, Ralph A.; Snelgrove, James L.

2000-01-01

Argonne National Laboratory (ANL) is cooperating with the Argentine Comision Nacional de Energia Atomica (CNEA) to convert their 99 Mo production process, which uses high enriched uranium (HEU), to low-enriched uranium (LEU). Progress discussed in this year's paper includes optimization of (1) the digestion of LEU foil by sodium hydroxide solution and (2) the primary recovery of molybdenum by anion exchange. Also discussed are ANL/CNEA plans for demonstrating the irradiation and digestion of LEU-foil targets and recovering 99 Mo in Argentina later this year. Our results show that, up to this point in our study, conversion of the CNEA process to LEU appears viable. (author)

Comparison of the Fc fragment from a human IgG1 and its CH2, pFc', and tFc' subfragments. A study using reductive methylation and 13C NMR

International Nuclear Information System (INIS)

Jentoft, J.E.; Rayford, R.

1989-01-01

The Fc fragment of a human monoclonal IgG1 was compared with subfragments containing (a) the intact CH2 domain (CH2 fragment) or (b) the intact CH3 domain (pFc' and tFc' fragments). All fragments were reductively 13 C-methylated and their resulting dimethyllysyl resonances characterized in 0.1 M KCl as a function of pH by 13 C NMR spectroscopy. Seven resonances were characterized for the 18 lysine residues of the Fc fragment, eight for the 12 lysines of the CH2 fragment, and five each for the 9 lysines of the pFc' and the 6 lysines of the tFc' fragments, respectively. The multiplicity of resonances indicates that the lysine residues in each fragment exist in a variety of microenvironments and that the fragments are all highly structured. The correspondence between 6 of the 12 or 13 perturbed lysine residues in the Fc fragment and the smaller subfragments indicates that the conformation of the CH2 and CH3 domains is largely unchanged in the smaller fragments. However, in addition to three lysines at the CH2-CH3 domain interface, whose environments were known to be disrupted in the smaller fragments, three or four lysine residues have somewhat different properties in the Fc fragment and in the subfragments, indicating that some local perturbations are included in the domain structure in the subfragments

Co-operation agreement. The text of the agreement of 25 May 1998 between the International Atomic Energy Agency and the Brazilian-Argentine Agency for accounting and control of nuclear materials

International Nuclear Information System (INIS)

1998-01-01

The document reproduces the text of the Co-operation Agreement between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials which entered into force on 25 May 1998

Co-operation agreement. The text of the agreement of 25 May 1998 between the International Atomic Energy Agency and the Brazilian-Argentine Agency for accounting and control of nuclear materials

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-06-25

The document reproduces the text of the Co-operation Agreement between the International Atomic Energy Agency and the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials which entered into force on 25 May 1998

Dicty_cDB: FC-AY04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e

Dicty_cDB: FC-AK01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s

Electron-transport, ionization, attachment, and dissociation coefficients in SF6 and its mixtures

International Nuclear Information System (INIS)

Phelps, A.V.; Van Brunt, R.J.

1988-01-01

An improved set of electron-collision cross sections is derived for SF 6 and used to calculate transport, ionization, attachment, and dissociation coefficients for pure SF 6 and mixtures of SF 6 with N 2 , O 2 , and Ne. The SF 6 cross sections differ from previously published sets primarily at very low and high electron energies. At energies below 0.03 eV the attachment cross section is adjusted to fit recent electron swarm experiments, while the elastic momentum transfer cross section is increased to the theoretical limit. At high energies an allowance is made for the excitation of highly excited levels as observed in electron beam experiments. The cross-section sets used for the admixed gases have previously been published. Electron kinetic energy distributions computed from numerical solutions of the electron-transport (Boltzmann) equation using the two-term, spherical harmonic expansion approximation were used to obtain electron-transport and reaction coefficients as functions of E/N and the fractional concentration of SF 6 . Here E is the electric field strength and N is the gas number density. Attachment rate data for low concentrations of SF 6 in N 2 are used to test the attachment cross sections. Particular attention is given to the calculation of transport and reaction coefficients at the critical E/N = (E/N)/sub c/ at which the ionization and attachment rates are equal

Mac-1 (CD11b/CD18) is essential for Fc receptor-mediated neutrophil cytotoxicity and immunologic synapse formation.

Science.gov (United States)

van Spriel, A B; Leusen, J H; van Egmond, M; Dijkman, H B; Assmann, K J; Mayadas, T N; van de Winkel, J G

2001-04-15

Receptors for human immunoglobulin (Ig)G and IgA initiate potent cytolysis of antibody (Ab)-coated targets by polymorphonuclear leukocytes (PMNs). Mac-1 (complement receptor type 3, CD11b/CD18) has previously been implicated in receptor cooperation with Fc receptors (FcRs). The role of Mac-1 in FcR-mediated lysis of tumor cells was characterized by studying normal human PMNs, Mac-1-deficient mouse PMNs, and mouse PMNs transgenic for human FcR. All PMNs efficiently phagocytosed Ab-coated particles. However, antibody-dependent cellular cytotoxicity (ADCC) was abrogated in Mac-1(-/-) PMNs and in human PMNs blocked with anti-Mac-1 monoclonal Ab (mAb). Mac-1(-/-) PMNs were unable to spread on Ab-opsonized target cells and other Ab-coated surfaces. Confocal laser scanning and electron microscopy revealed a striking difference in immunologic synapse formation between Mac-1(-/-) and wild-type PMNs. Also, respiratory burst activity could be measured outside membrane-enclosed compartments by using Mac-1(-/-) PMNs bound to Ab-coated tumor cells, in contrast to wild-type PMNs. In summary, these data document an absolute requirement of Mac-1 for FcR-mediated PMN cytotoxicity toward tumor targets. Mac-1(-/-) PMNs exhibit defective spreading on Ab-coated targets, impaired formation of immunologic synapses, and absent tumor cytolysis.

Enresa International Cooperation

International Nuclear Information System (INIS)

Rodriguez Beceiro, A.

1998-01-01

The Empresa Nacional de Residuos Radiactivos, S.A. (ENRESA) was set up in 1984 with the mandate to undertake responsibility for radioactive waste management in Spain. From the very beginning, ENRESA was fully aware of the fact that international cooperation plays a very important role in the development of national programmes. Aspects such as the setting up of international databases, the development and validation of models or site characterization technique such enormous efforts and amounts of resources that they could hardly be undertaken individually. Furthermore, joint participation in research, development and demonstration projects reinforces the level of confidence, not only in the decision-making process but also in the technologies, techniques and practices used. ENRESA's participation in the international contexts is largely defined, on the one hand, by the needs arising from its technical programme, as reflected in the General Radioactive Waste Plan and in the Research and Development Plan, and on the other by the need to support spanish governmental institutions in their participation in inter-governmental institutions in their participation in inter-governmental forums. The formula for cooperation varies according to needs, this cooperation generally being accomplished by means of bilateral agreements with other institutions having similar competence or by participating in the programmes of inter-governmental organizations. In particular, ENRESA has reached cooperation agreements with most of the agencies with similar responsibilities in other countries and participates very actively in the programmes of the European Union, the Nuclear energy Agency (NEA/OECD) and the International Atomic Energy Agency (IAEA). (Author)

The text of an African regional co-operative agreement for research, development and training related to nuclear science and technology

International Nuclear Information System (INIS)

1993-02-01

The document informs that as of 31 January 1993, the following states sent to the Director General notifications of acceptance of the African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology: Tunisia, Egypt, Algeria, Nigeria, Madagascar, Libyan Arab Jamahiriya, Morocco, Kenya, Sudan, Ghana, Tanzania, Mauritius, Cameroon, South Africa and Zaire. The Agreement entered into force on 4 April 1990

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

International Nuclear Information System (INIS)

1998-01-01

The document presents the status of acceptances as of 21 September 1998 of the extension of the African Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) which entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-11-13

The document presents the status of acceptances as of 21 September 1998 of the extension of the African Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) which entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000

Dicty_cDB: FC-BF01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BF01 (Link to dictyBase) - - - Contig-U15105-1 FC-BF01Z (Li...nk to Original site) - - FC-BF01Z 674 - - - - Show FC-BF01 Library FC (Link to library) Clone ID FC-BF01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 260 3e-68 AJ783868_1( AJ783868 |pid:none...lasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-BF01 is cyt 5' end seq. ID - 5' end seq. - L

Dicty_cDB: FC-BC16 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BC16 (Link to dictyBase) - - - Contig-U15105-1 FC-BC16Z (Li...nk to Original site) - - FC-BC16Z 620 - - - - Show FC-BC16 Library FC (Link to library) Clone ID FC-BC16 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...4 2e-66 AY961522_1( AY961522 |pid:none) Lysiphlebus testaceipes ribosomal ... 254 2e-66 AF402813_1( AF402813 |pid:none) Ict...hondrial 4.0 %: nuclear >> prediction for FC-BC16 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq

Study of liquid and steam tracers at the Maritaro - La Cumbre area of the Los Azufres geothermal field, Mich.; Estudio con trazadores de liquido y vapor en la zona Maritaro - La Cumbre del campo geotermico de Los Azufres, Mich.

Energy Technology Data Exchange (ETDEWEB)

Iglesias, Eduardo R [Instituto de Investigaciones Electricas, Cuernavaca, Morelos, (Mexico)]. E-mail: iglesias@iie.org.mx; Flores Armenta, Magaly; Quijano Leon, Jose Luis; Torres Rodriguez, Marco A [Comision Federal de Electricidad, Morelia, Michoacan (Mexico); Torres, Rodolfo J; Reyes Picasso, Neftali [Instituto de Investigaciones Electricas, Cuernavaca, Morelos, (Mexico)

2008-01-15

We ran two simultaneous tracer tests in the Maritaro-La Cumbre area of the Los Azufres geothermal field in Mexico. We wished to determine whether or not fluids injected in well Az-15 recharged the productive areas of six production wells and to estimate the fractions of injected fluid recovered in them, if any. Because only three of the wells produce water and all of them produce steam, two tracers were used, sulfur hexafluoride (SF{sub 6}) for the gas phase and 1,3,6 naphthalene trisulfonate (1,3,6-nts) for the liquid phase. All of the observation wells recorded SF{sub 6}, and the three water-producing wells recorded 1,3,6-nts, proving that fluids injected in well Az-15 do recharge the area of interest. When sampling was suspended, the three water-producing wells were still producing 1,3,6-nts at significant rates. The total recovery of 1,3,6-nts at wells Az-65D, Az-04 and Az-28, 279 days after injection when sampling was halted, were, respectively, 6.1%, 0.90% y 0.16%, for a total of 7.61%. We concluded that these quantities constitute the lower boundaries for the respective recovery factors. When sampling was halted, wells Az-65D, Az-66D and Az-30 were still producing some SF{sub 6} at lower rates, and the rest of the wells were no longer recording the gas phase tracer. The total recovery of SF{sub 6} at wells Az-65D, Az-04, Az-41, Az-30, Az-28 and Az-66D were, respectively, 4.82 e-02%, 1.37 e-03%, 1.48 e-03%, 6.38 e-04%, 1.38 e-03% y 4.31 e-04%, for a total of 5.35 e-02%. The liquid recharge occurred in orders of magnitude greater than the steam. [Spanish] Se efectuaron dos pruebas simultaneas en la zona Maritaro-La Cumbre del campo geotermico de Los Azufres, Mich., Mexico. Los objetivos de estas pruebas fueron determinar si la salmuera de desecho inyectada en el pozo Az-15 recarga las zonas de alimentacion de seis pozos productores designados por CFE, y estimar que fraccion de lo inyectado recarga dichos pozos productores. Debido a que solo tres de los pozos

Co-operation Agreement for the promotion of nuclear science and technology in Latin America and the Caribbean (ARCAL)

International Nuclear Information System (INIS)

1999-01-01

The document reproduces the text of the Co-operation Agreement for the Promotion of Nuclear Science and Technology in Latin America and the Caribbean (ARCAL) which was opened for signature on 25 September 1998 and shall come into force after deposit of the instrument of ratification by ten Member States. It shall remain in force for ten years, and may be extended by periods of five years if the Member States so agree. By 15 september 1999, there were 14 Signatories to the above Agreement

HAL/S-FC compiler system specifications

Science.gov (United States)

1976-01-01

This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.

ESTABLISHMENT OF THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

Energy Technology Data Exchange (ETDEWEB)

Hugh W. Rimmer

2003-07-01

Technical Progress Report describes progress made on the eight sub-projects awarded in the first year of Cooperative Agreement DE-FC26-01NT41091: Establishment of the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices. Due to the time taken up by the solicitation/selection process, these cover the initial 6-month period of activity only.

POTÊNCIA E CAPACIDADE ANAERÓBIA EM ATLETAS DE KARATE

Directory of Open Access Journals (Sweden)

Keith Sato Urbinati

2011-01-01

Full Text Available O objetivo do presente estudo foi verificar o nível de potência muscular, bem como a intensidade de esforço durante prova de potência e capacidade anaeróbia em atletas de Karate. Participaram do estudo treze karatekas especialistas em prova de kumitê (luta,sexo masculino, idade média de 20,7±3,79 anos. Realizou-se a avaliação de potência e capacidade anaeróbia (Wingate test, com coleta das variáveis fisiológicas:frequência cardíaca (FC, pressão arterial (PA e lactato sanguíneo (LAC de repouso, imediatamente após e em 5 min de recuperação. Para verificar se ocorrem diferenças nas variáveis fisiológicas durante o teste, realizou-se análise de variância, post hoc de Bonferronie (p?0,05. Verificou-se potência de pico(PP de 8,77 ± 0,99 W/kg-1, potência média (PM de 5,13± 0,49 W.kg-1 e % de fadiga de 50,5 ± 6,45%. Para as variáveis fisiológicas,a FC (F=9,79; p=0,00 pós-teste de Wingate foi estatisticamente maior e diferenteda FC de repouso e recuperação. Não foram encontradas diferenças nos níveis pressatórios e nas concentrações de LAC. Em relação aos valores de FC e LAC tais variáveis pós-teste não se apresentaram elevados. Os valores de potência anaeróbia estão de acordo com a necessidade da modalidade esportiva. Assim, verificou-se menores intensidades de esforço em teste de Wingate quando comparados a de situação real de competição. O nível de potência muscular parece estar adequado ao kumitê.

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha Tomato seedlings production using substrates with coconut fiber and rock waste

Directory of Open Access Journals (Sweden)

Regynaldo A Sampaio

2008-12-01

Full Text Available Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC e pó de rocha de granito (RG como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC e pó de rocha de granito (RG: T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. O cultivo foi feito em bandeja de poliestireno expandido com células de 3,5 x 3,5 x 5,0 cm. Foram avaliados o diâmetro do coleto, a altura da planta, o índice de velocidade de emergência, a percentagem de emergência e a massa fresca e seca da parte aérea e da raiz. Em praticamente todas as características avaliadas o substrato comercial foi superior aos substratos contendo fibra de coco e pó de rocha. Considerando-se apenas os substratos contendo fibra de coco e pó de rocha, as mudas com melhores características foram obtidas com a mistura de aproximadamente 70% em volume de fibra de coco.A greenhouse experiment was carried out to evaluate the ratio of coconut fiber and rock waste, in the tomato seedling production (cultivar Kada Gigante, in Montes Claros, Brazil. The experimental design was of randomized complete blocks with four replicates. The treatments were composed of a control and six ratios of coconut fiber (FC and rock waste (RG: T1 - Commercial Substrate Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. The cultivation was done in polystyrene trays with cells of 3.5 x 3.5 x 5,0 cm. Stem diameter, seedling height, emergency speed index, emergency percentage, root and aerial part of fresh and dry matter were evaluated. In

Agreement between the Swiss Federal Council and the Government of Canada for cooperation in the peaceful uses of nuclear energy

International Nuclear Information System (INIS)

1987-12-01

This Agreement replaces an Agreement concluded in 1958 and revised several times. It contains no obligations regarding purchase or sale, but establishes non-proliferation safeguards respecting co-operation between private or public undertakings in both States. In particular, the Parties undertake to use the goods exchanged solely for peaceful and non-explosive purposes and entrust the IAEA with verifying this use. Retransfer of such goods to a third country is also subject to very specific conditions. Finally, the Parties undertake to apply adequate security measures to the nuclear goods subject to the Agreement. (NEA) [fr

Anàlisi de les modificacions estatutàries per adaptar el règim de reemborsament del capital social a les normes comptables de les cooperatives

Directory of Open Access Journals (Sweden)

Yolanda Montegut

2014-12-01

Full Text Available Objecte: L’objectiu del treball és analitzar les modificacions realitzades en els Estatuts de les cooperatives per adaptar el capital social a les normes comptables i veure quins han estats els efectes econòmics de l’adaptació del capital social en la situació patrimonial i econòmica de les cooperatives. Disseny/metodologia: Per dur a terme l’estudi s’ha demanat al Registre de Cooperatives  els Estatuts i els comptes anuals, per al període 2010-2011, de les cooperatives objecte de l’estudi. En primer lloc s’han revisat els Estatuts per veure quins articles han modificat o han introduït en relació a la nova normativa comptable. En segon lloc s’ha creat una base de dades amb els comptes anuals de les cooperatives per tal d’analitzar la situació econòmica i financera de les mateixes a través d’un anàlisi de les masses del balanç i de ràtios. Aportacions i resultats: S’ha identificat el percentatge de cooperatives que han decidit adaptar els Estatuts a la reforma comptable i el criteri adoptat per les mateixes. Els resultats mostren que les cooperatives han adaptat majoritàriament els seus Estatuts i que els efectes de l’aplicació de les normes comptables adaptades a la NIC 32 consisteixen en una disminució del patrimoni net i un augment de l’endeutament. Limitacions: La dificultat temporal per anar obtenint els comptes anuals i els Estatuts de les diferents cooperatives existents a Catalunya. Implicacions pràctiques i socials: Degut a que des de 2011 totes les cooperatives espanyoles han d'aplicar les normes comptables adaptades a la NIC 32, els resultats d'aquest treball de recerca poden ser útils per a diferents grups d'interès, no solament per a les pròpies cooperatives, sinó també per altres organismes cooperatius per a què puguin realitzar les valoracions que creguin convenients i per a les entitats financeres, per tal que puguin tenir-los en compte a l'hora de prendre decisions. Valor afegit

Qualidade de Vida de pacientes hipertensos e comparação entre dois instrumentos de medida de QVRS

Directory of Open Access Journals (Sweden)

Michelle Adler Normando Carvalho

2012-05-01

Full Text Available FUNDAMENTO: Medir Qualidade de Vida (QV relacionada à saúde auxilia na avaliação da eficiência de um tratamento e identifica problemas de maior impacto na QV do paciente. No entanto, essas medidas são mais seguras se avaliadas por instrumentos genéricos e específicos conjuntamente, fazendo-se necessário verificar se há compatibilidade entre esses e evitar repetições e contradições entre os domínios. OBJETIVO: Descrever o perfil de qualidade de vida de pacientes hipertensos e avaliar a compatibilidade de um instrumento específico (MINICHAL e outro genérico (SF-36. MÉTODOS: Cem pacientes hipertensos adultos em tratamento ambulatorial entrevistados. A média da QVRS medida pelo MINICHAL foi de 6,64 (DP 6,04 no estado mental e média de 5,03 (DP 4,11 no estado manifestações somáticas. As médias para o instrumento SF-36 foram por ordem de classificação: limitação por aspectos físicos 47,3 (DP 42,9, vitalidade 57,4 (DP 19,7, limitação por aspectos emocionais 58 (DP 44,7, capacidade funcional 58,7 (DP 27,8, dor 60,4 (DP 26,3, estado geral de saúde 60,7 (DP 22,7, saúde mental 66,8 (DP 22,1 e aspectos sociais 78 (DP 26,1. RESULTADOS: O MINICHAL apresentou correlação significativa (p < 0,001 com o SF-36 em todos os domínios. CONCLUSÃO: O MINICHAL provou ser um instrumento útil na avaliação da QVRS em pacientes hipertensos. (Arq Bras Cardiol. 2012; [online].ahead print, PP.0-0

Dicty_cDB: FC-IC0102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g

Dicty_cDB: FC-AA02 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285

Assessing the Heterogeneity of the Fc-Glycan of a Therapeutic Antibody Using an engineered FcγReceptor IIIa-Immobilized Column.

Science.gov (United States)

Kiyoshi, Masato; Caaveiro, Jose M M; Tada, Minoru; Tamura, Hiroko; Tanaka, Toru; Terao, Yosuke; Morante, Koldo; Harazono, Akira; Hashii, Noritaka; Shibata, Hiroko; Kuroda, Daisuke; Nagatoishi, Satoru; Oe, Seigo; Ide, Teruhiko; Tsumoto, Kouhei; Ishii-Watabe, Akiko

2018-03-02

The N-glycan moiety of IgG-Fc has a significant impact on multifaceted properties of antibodies such as in their effector function, structure, and stability. Numerous studies have been devoted to understanding its biological effect since the exact composition of the Fc N-glycan modulates the magnitude of effector functions such as the antibody-dependent cell mediated cytotoxicity (ADCC), and the complement-dependent cytotoxicity (CDC). To date, systematic analyses of the properties and influence of glycan variants have been of great interest. Understanding the principles on how N-glycosylation modulates those properties is important for the molecular design, manufacturing, process optimization, and quality control of therapeutic antibodies. In this study, we have separated a model therapeutic antibody into three fractions according to the composition of the N-glycan by using a novel FcγRIIIa chromatography column. Notably, Fc galactosylation was a major factor influencing the affinity of IgG-Fc to the FcγRIIIa immobilized on the column. Each antibody fraction was employed for structural, biological, and physicochemical analysis, illustrating the mechanism by which galactose modulates the affinity to FcγRIIIa. In addition, we discuss the benefits of the FcγRIIIa chromatography column to assess the heterogeneity of the N-glycan.

Agreement for cooperation between the Government of Australia and the Government of the United States of America concerning technology for the separation of isotopes of uranium by laser excitation (SILEX agreement). Australian Treaty Series 2000 No. 19

International Nuclear Information System (INIS)

2000-01-01

This agreement between the Government of Australia and the Government of the USA (the Parties) stipulate that the Parties shall cooperate in research on and development and utilization of SILEX technology for peaceful purposes in accordance with the provisions of this Agreement and their applicable treaties, national laws, regulations and license requirements. Transfers under this Agreement of Restricted Data, sensitive nuclear technology, sensitive nuclear facilities and major critical components related to SILEX technology may be undertaken directly between the Parties or through authorized persons. Such transfers shall be subject to this Agreement and to such additional terms and conditions as may be agreed by the Parties. No such transfers shall take place except as may be authorized in Articles 3 and 4 of this Agreement. Cooperation under this Agreement within the territory of Australia shall not be for the purpose of constructing a uranium enrichment facility in Australia unless provided for by an amendment to this Agreement. Each Party retains its right to develop. or to continue to develop, outside the scope of this Agreement, enrichment technologies similar to SILEX technology, provided that the Party does not use information or data provided by the other Party pursuant to this Agreement. Copyright (2000) Commonwealth of Australia

INTERNATIONAL ENVIRONMENTAL TECHNOLOGY IDENTIFICATION, DEVELOPMENT, DEMONSTRATION, DEPLOYMENT AND EXCHANGE

Energy Technology Data Exchange (ETDEWEB)

Roy C. Herndon

2001-02-28

Cooperative Agreement (DE-FC21-95EW55101) between the U.S. Department of Energy (DOE) and the Florida State University's Institute for International Cooperative Environmental Research (IICER) was designed to facilitate a number of joint programmatic goals of both the DOE and the IICER related to international technology identification, development, demonstration and deployment using a variety of mechanisms to accomplish these goals. These mechanisms included: laboratory and field research; technology demonstrations; international training and technical exchanges; data collection, synthesis and evaluation; the conduct of conferences, symposia and high-level meetings; and other appropriate and effective approaches. The DOE utilized the expertise and facilities of the IICER at Florida State University to accomplish its goals related to this cooperative agreement. The IICER has unique and demonstrated capabilities that have been utilized to conduct the tasks for this cooperative agreement. The IICER conducted activities related to technology identification, development, evaluation, demonstration and deployment through its joint centers which link the capabilities at Florida State University with collaborating academic and leading research institutions in the major countries of Central and Eastern Europe (e.g., Czech Republic, Hungary, Poland) and Russia. The activities and accomplishments for this five-year cooperative agreement are summarized in this Final Technical Report.

Cultura Organizacional e Gestão de Equipes de Alto Rendimento: Os Casos FC Barcelona, Sporting Club de Portugal e AFC Ajax

Directory of Open Access Journals (Sweden)

Ary José Rocco Júnior

2015-01-01

Full Text Available 800x600 Em todo o mundo, a chamada Indústria do Esporte vêm experimentando vertiginoso crescimento financeiro. Com isso, o papel das agremiações esportivas adquiriu especial importância dentro da sociedade contemporânea global. A relevância do planejamento estratégico dessas organizações fez crescer a necessidade dos clubes esportivos investirem em estratégias que permitam o seu correto posicionamento no mercado e as suas conquistas no campo esportivo. A implantação e o desenvolvimento de uma cultura organizacional que permita o desenvolvimento de uma identidade do clube que agregue todos os seus stakeholders – atletas, torcedores, patrocinadores, marcas, investidores e outros -, é uma dessas estratégias. A criação estratégica e planejada de valores e princípios organizacionais que equilibrem resultados econômicos, mercadológicos e financeiros, com a performance esportiva, colabora para o desenvolvimento e implantação de uma cultura, que gera receita e traz conquistas no campo esportivo. O objetivo deste artigo é analisar três casos de sucesso – FC Barcelona, da Espanha; Sporting Club de Portugal; e, AFC Ajax, da Holanda -, de organizações esportivas que implantaram estratégias dessa natureza na Europa. Pretendemos, com isso, estimular agremiações esportivas do Brasil a adotarem estratégias semelhantes. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4

Agreement between the Government of the Kingdom of Belgium and the Government of the Peoples' Republic of China on Cooperation in the Peaceful Uses of Atomic Energy

International Nuclear Information System (INIS)

1985-01-01

Under the Agreement both Parties agree in particular to co-operate on reactor research, construction and design, nuclear fuel fabrication and technology, nuclear safety and radiation protection, R and D in nuclear science and technology, etc. The Agreement specifies that co-operation shall be for exclusively peaceful purposes and that the security measures applied for the nuclear materials and equipment as well as for the technical information covered by the Agreement shall be those defined by the International Atomic Energy Agency (IAEA). The Agreement entered into force on the date of its signature for a period of fifteen years and may subsequently be extended for five-year periods successively. (NEA) [fr

Achados oculares em pacientes com mais de 99 anos Ocular findings in patients older than 99 years

Directory of Open Access Journals (Sweden)

Marcela Colussi Cypel

2006-10-01

Full Text Available OBJETIVO: Determinar as condições visuais e oculares em indivíduos com mais de 99 anos. MÉTODO: Estudo prospectivo e descritivo de série casos. Trinta idosos com mais de 99 anos se inscreveram no Instituto da Visão da Universidade Federal de São Paulo, de forma voluntária, respondendo à busca ativa. O exame oftalmológico constou de anamnese, ectoscopia, acuidade visual, exame refracional, citologia e cultura de cílios e conjuntiva com antibiograma, teste de Schirmer basal, tempo de ruptura do filme lacrimal, coloração com Rosa Bengala da conjuntiva e córnea, exame de biomicroscopia, tonometria de aplanação e fundoscopia direta e indireta. Foram realizados exames complementares, como retinografia e tomografia de coerência óptica, quando indicados. RESULTADOS: Trinta pacientes acima de 99 anos (média de 101,5±1,8 anos, dos quais, 25 mulheres e 5 homens, foram examinados; destes, 10 não tinham condições de exame completo, em razão de limitações de saúde e mobilidade. A doença sistêmica mais encontrada foi hipertensão arterial (8 pacientes = 40%. Cinco pacientes (25% negaram qualquer doença ou uso de medicação. A melhor acuidade visual corrigida para longe foi de 20/100 ou melhor em 11 pacientes (55% e para perto variou de J4 ou melhor também em 11 pacientes (55%, sendo que sete destes idosos (63% não haviam sido submetidos à cirurgia de catarata. A principal queixa foi dificuldade para leitura em 55% e 40% demonstrou estar satisfeito com a sua visão. A melhora da acuidade com prescrição de óculos novos ocorreu em 4 casos (20%. Catarata foi identificada como comprometendo a visão de forma significativa em 5 casos (25%; porém, apenas 2 concordaram com a cirurgia. A principal causa de baixa visão foi a degeneração macular relacionada à idade, presente em todos os casos; na maioria da vezes (95%, na forma seca. CONCLUSÃO: As necessidades da população nessa faixa etária devem ser entendidas para o

Dicty_cDB: FC-BS24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN

Development of fission Mo-99 production technology

International Nuclear Information System (INIS)

Park, Jin Ho; Choung, W. M.; Lee, K. I. and others

2000-05-01

Fission Mo-99 is the only parent nuclide of Tc-99m, an extremely useful tool for mdeical diagnosis, with an estimated usage of greater than 80% of nuclear medicine applicatons. HEU and LEU targets to optimize in HANARO irradiation condition suggested and designed for domestic production of fission Mo-99. The optimum process conditions are established in each unit process to meet quality requirements of fission Mo-99 products, and the results of performance test in combined process show Mo separation and purification yield of the above 97%. The concept of Tc generator production process is established, and the result of performance test show Tc production yield of 98.4% in Tc generator procuction process. The drafts is prepared for cooperation of technical cooperation and business investment with foreign country. Evaluation on economic feasibility is accompanied for fission Mo-99 and Tc-99m generator production

Development of fission Mo-99 production technology

Energy Technology Data Exchange (ETDEWEB)

Park, Jin Ho; Choung, W. M.; Lee, K. I. and others

2000-05-01

Fission Mo-99 is the only parent nuclide of Tc-99m, an extremely useful tool for mdeical diagnosis, with an estimated usage of greater than 80% of nuclear medicine applicatons. HEU and LEU targets to optimize in HANARO irradiation condition suggested and designed for domestic production of fission Mo-99. The optimum process conditions are established in each unit process to meet quality requirements of fission Mo-99 products, and the results of performance test in combined process show Mo separation and purification yield of the above 97%. The concept of Tc generator production process is established, and the result of performance test show Tc production yield of 98.4% in Tc generator procuction process. The drafts is prepared for cooperation of technical cooperation and business investment with foreign country. Evaluation on economic feasibility is accompanied for fission Mo-99 and Tc-99m generator production.

Development and Validation of the Drinking Motive Questionnaire Revised Short Form (DMQ-R SF)

Science.gov (United States)

Kuntsche, Emmanuel; Kuntsche, Sandra

2009-01-01

A short form of the Drinking Motive Questionnaire Revised (DMQ-R; Cooper, 1994) was developed, using different item selection strategies based on a national representative sample of 5,617 12- to 18-year-old students in Switzerland. To confirm the concurrent validity of the short-form questionnaire, or DMQ-R SF, data from a second national sample…

[Survey on the applicability of SF-36 version-2 (SF-36v2) in assessment quality of life among urban residents in Chengdu city].

Science.gov (United States)

Zhao, Longchao; Liu, Zhijun; He, Yan; Li, Ningxiu; Liu, Danping

2014-05-01

To explore the psychometric performances and applicability of SF-36v2 in assessment quality of life among urban residents in Chengdu. During Oct. to Dec., 2012, 2 186 adult urban residents with clear mind and well self-express were recruited in the study by multistage stratified cluster sampling method in Chengdu urban area. The survey questionnaires included general health condition and quality of life, which was adopted the SF-36v2. Internal consistency reliability, test-retest reliability and construct validity were all analyzed as indicators of the psychometric performance. The survey released 2 186 questionnaires, with 2 182 ones returned and 2 178(99.8%) met the data standard. The scores of 8 scales in SF-36v2, including physical function (PF), role-physical (RP), bodily pain (BP), general health (GH), vitality (VT), social function (SF), role-emotion (RE) and mental health (MH), were 89.15 ± 17.56, 85.18 ± 22.52, 76.64 ± 17.80, 64.13 ± 19.56, 70.39 ± 17.31, 86.43 ± 17.35, 87.79 ± 19.24 and 80.61 ± 13.49, respectively; the floor effects were 0.28%, 0.41%, 0.23%, 0.28%, 0.09%, 0.05%, 0.14% and 0.23%, respectively; and the ceiling effects were 51.38%, 60.60%, 58.08%, 0.83%, 2.94%, 50.32%, 64.00% and 3.95%, respectively. The item-convergent validities were all achieved the standard (r = 0.40) except the item MH5 (Have you been happy?), and the total scaling success rate of item-convergent validity was 97.14%. The scales' success rates of item-discriminant validities for the SF, VT and MH scales were 93.75%, 56.25% and 97.50% respectively, while the rates of others were 100.00% and the total success rate was 96.43%. The internal reliability ranged from 0.724 to 0.974 across all the scales, except for SF (r = 0.603) and VT (r = 0.697). The two-week test-retest reliability ranged from 0.610 to 0.845. Within factor analysis, two common factors were confirmed, separately representing physical health and mental health, altogether contributing 64.4% of the

Psychometric properties of the French Canadian version of the Geriatric Anxiety Inventory.

Science.gov (United States)

Champagne, Alexandra; Landreville, Philippe; Gosselin, Patrick; Carmichael, Pierre-Hugues

2018-01-01

The Geriatric Anxiety Inventory (GAI) and a short form of this instrument (GAI-SF) were developed to assess the severity of anxiety symptoms in older adults in order to compensate for the lack of validated screening tools adapted to the elderly population. This study examined the psychometric properties of the French Canadian version of the GAI, in its complete (GAI-FC) and short form (GAI-FC-SF). A total of 331 community-dwelling seniors between 65 and 92 years old participated in this study. Both the GAI-FC and the GAI-FC-SF have sound psychometric properties with, respectively, a high internal consistency (α = .94 and .83), an adequate convergent validity (r = .50 to .86 with instruments known to evaluate constructs similar to the GAI or related to anxiety), a good test-retest reliability (r = .89 and .85), in addition to a single-factor structure. The results support the use of both the GAI-FC and the GAI-FC-SF. The GAI-FC-SF seems to be an interesting alternative to the GAI-FC as a screening tool when time available for assessment is limited.

Decontamination systems information and research program. Quarterly report, October 1995--December 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-12-01

West Virginia University (WVU) and the U.S. Department of Energy Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement on August 29, 1992 titled {open_quotes}Decontamination Systems Information and Research programs{close_quotes} (DOE Instrument No. DE-FC21-92MC29467) This report contains the efforts of the research projects comprising the Agreement for the 4th calendar quarter of 1995, and is the final quarterly report deliverable required for the period ending 31 December 1995. The projects reported for the WVU Cooperative Agreement are categorized into the following three areas: 1.0 In Situ Remediation Process Development, 2.0 Advanced Product Applications Testing, and 3.0 Information Systems, Public Policy, Community Outreach, and Economics. Summaries of the significant accomplishments for the projects reported during the period 1 October 95 through 31 December 95 are presented in the following discussions.

SF6 and the greenhouse effect

International Nuclear Information System (INIS)

Gjaerde, Anne Cathrine; Rein, Asgaut; Hegerberg, Rolf; Kulsetaas, John

1997-01-01

The gas SF 6 (sulfur hexafluoride) is much used as an insulation medium in electric switchgear and breakers. However, there has been some recent concern about the possible contribution of SF 6 to the global greenhouse effect. This report presents some collected facts about SF 6 emission. The concentration of SF 6 in the atmosphere is very low and will probably remain so until the end of the next century. Hence the contribution of SF 6 to the greenhouse effect is negligible. Most of the SF 6 emission comes from the magnesium and aluminium industries. In 1993, SF 6 emission from switchgear in the Norwegian distribution grid corresponded to only 0.2 per million of the CO 2 emission in Norway. But the quantity of SF 6 accumulated in electric switchgear is considerable. However, losing it to the atmosphere can be avoided by using recirculation or destruction systems for SF 6 in connection with maintenance and replacement of components. Norwegian climate policy aims at taking measures against SF 6 and other climate gases on a par with CO 2 . Taxation measures have been suggested for SF 6 . Atmospheric SF 6 does not influence the ozone layer. 3 refs., 8 figs

The Text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Science

International Nuclear Information System (INIS)

1971-01-01

The texts of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Science, and of the Minutes of Signature thereof are reproduced herein for the information of all Members. This Agreement entered into force on 10 April 1970.

The Text of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Science

Energy Technology Data Exchange (ETDEWEB)

NONE

1971-03-18

The texts of the Agreement between the Agency and the Governments of Norway, Poland and Yugoslavia concerning Co-operative Research in Reactor Science, and of the Minutes of Signature thereof are reproduced herein for the information of all Members. This Agreement entered into force on 10 April 1970.

Experimental investigation of small diameter two-phase closed thermosyphons charged with water, FC-84, FC-77 and FC-3283

International Nuclear Information System (INIS)

Jouhara, Hussam; Robinson, Anthony J.

2010-01-01

An experimental investigation of the performance of thermosyphons charged with water as well as the dielectric heat transfer liquids FC-84, FC-77 and FC-3283 has been carried out. The copper thermosyphon was 200 mm long with an inner diameter of 6 mm, which can be considered quite small compared with the vast majority of thermosyphons reported in the open literature. The evaporator length was 40 mm and the condenser length was 60 mm which corresponds with what might be expected in compact heat exchangers. With water as the working fluid two fluid loadings were investigated, that being 0.6 ml and 1.8 ml, corresponding to approximately half filled and overfilled evaporator section in order to ensure combined pool boiling and thin film evaporation/boiling and pool boiling only conditions, respectively. For the Fluorinert TM liquids, only the higher fill volume was tested as the aim was to investigate pool boiling opposed to thin film evaporation. Generally, the water-charged thermosyphon evaporator and condenser heat transfer characteristics compared well with available predictive correlations and theories. The thermal performance of the water-charged thermosyphon also outperformed the other three working fluids in both the effective thermal resistance as well as maximum heat transport capabilities. Even so, FC-84, the lowest saturation temperature fluid tested, shows marginal improvement in the heat transfer at low operating temperatures. All of the tested Fluorinert TM liquids offer the advantage of being dielectric fluids, which may be better suited for sensitive electronics cooling applications and were all found to provide adequate thermal performance up to approximately 30-50 W after which liquid entrainment compromised their performance.

The effect of FcγRIIA and FcγRIIB on coronary artery lesion formation and intravenous immunoglobulin treatment responses in children with Kawasaki disease

Science.gov (United States)

Chang, Ling-Sai; Lo, Mao-Hung; Li, Sung-Chou; Yang, Ming-Yu; Hsieh, Kai-Sheng; Kuo, Ho-Chang

2017-01-01

Previous research has found patients with the FcγRIIIB NA1 variant having increased risk of intravenous immunoglobulin (IVIG) resistance in Kawasaki disease (KD). Our previous studies revealed that elevated FcγRIIA expression correlated with the susceptibility of KD patients. We conducted this research to determine whether and how Fcγ receptors affect the susceptibility, IVIG treatment response, and coronary artery lesions (CAL) of KD patients. The activating FcγRIIA and inhibitory FcγRIIB methylation levels of seven patients with KD and four control subjects were examined using HumanMethylation27 BeadChip. We enrolled a total of 44 KD patients and 10 control subjects with fevers. We performed real-time RT-PCR to determine the FcγRIIA and FcγRIIB expression levels, as well as a luciferase assay of FcγRIIA. We found a considerable increase in methylation of both FcγRIIA and FcγRIIB in KD patients undergoing IVIG treatment. Promoter methylation of FcγRIIA inhibited reporter activity in K562 cells using luciferase assay. The FcγRIIB mRNA expression levels were not found to increase susceptibility, CAL formation, or IVIG resistance. FcγRIIA mRNA expression levels were significantly higher in IVIG-resistant patients than in those that responded to IVIG during the pre-treatment period. Furthermore, the FcγRIIA/IIB mRNA expression ratio was considerably higher in KD patients with CAL than in those without CAL. FcγRIIA and FcγRIIB both demonstrated increased methylation levels in KD patients that underwent IVIG treatment. FcγRIIA expression influenced the IVIG treatment response of KD patients. The FcγRIIA/IIB mRNA expression ratio was greater in KD patients with CAL formation. PMID:27893416

International Fisheries Agreements

DEFF Research Database (Denmark)

Pintassilgo, Pedro; Kronbak, Lone Grønbæk; Lindroos, Marko

2015-01-01

This paper surveys the application of game theory to the economic analysis of international fisheries agreements. The relevance of this study comes not only from the existence of a vast literature on the topic but especially from the specific features of these agreements. The emphasis of the survey...... is on coalition games, an approach that has become prominent in the fisheries economics literature over the last decade. It is shown that coalition games were first applied to international fisheries agreements in the late 1990s addressing cooperative issues under the framework of characteristic function games...... and stability of international fisheries agreements. A key message that emerges from this literature strand is that self-enforcing cooperative management of internationally shared fish stocks is generally difficult to achieve. Hence, the international legal framework and regulations play a decisive role...

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha

OpenAIRE

Sampaio,Regynaldo A; Ramos,Sílvio J; Guilherme,Denílson O; Costa,Cândido A da; Fernandes,Luiz Arnaldo

2008-01-01

Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC) e pó de rocha de granito (RG) como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC) e pó de rocha de granito (RG): T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% ...

A cooperative agreement for research on radioactive waste management between the United States Department of Energy and Atomic Energy of Canada Limited

International Nuclear Information System (INIS)

Dormuth, K.W.; Levich, R.A.

1994-01-01

The United States Department of Energy (USDOE) and Atomic Energy of Canada Limited (AECL) have a history of more than ten years of bilateral cooperation in the management of high level radioactive waste. In 1982, the USDOE and AECL executed a five year information-exchange agreement, for open-quotes Cooperation in Radioactive Waste Managementclose quotes. Since that time, this bilateral umbrella agreement has been renewed twice and the third renewal is currently being processed. International cooperation in high level radioactive waste management is highly beneficial to all concerned. Each nation involved in high level waste disposal has a single coordinated program for developing, testing, and evaluating approaches, hardware, and techniques for high level waste disposal. Thus there is limited opportunity for researchers in each country to exchange views regarding disposal technology with experienced researchers external to their own program, and to share research and development activities. The international arena, however, provides a host of organizations who have similar responsibilities and therefore similar interests and needs

The Text of the Agreement of 22 July 1977 between Argentina and the Agency for the Application of Safeguards in Connection with a Contract Concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union Gmbh Hanau (Federal Republic of Germany) for Co-Operation in the Field of Fabrication of Fuel Elements for Peaceful Nuclear Activities

International Nuclear Information System (INIS)

1977-01-01

The text of the Agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with the Contract of 13 August 1976 concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union GmbH (Federal Republic of Germany) for co-operation in the field of fabrication of fuel elements for peaceful nuclear activities is reproduced in this document for the information of all Members. The Agreement entered into force, pursuant to Section 26, on 22 July 1977.

The Text of the Agreement of 22 July 1977 between Argentina and the Agency for the Application of Safeguards in Connection with a Contract Concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union Gmbh Hanau (Federal Republic of Germany) for Co-Operation in the Field of Fabrication of Fuel Elements for Peaceful Nuclear Activities

Energy Technology Data Exchange (ETDEWEB)

NONE

1977-11-30

The text of the Agreement of 22 July 1977 between Argentina and the Agency for the application of safeguards in connection with the Contract of 13 August 1976 concluded between the Comision Nacional de Energia Atomica (Argentina) and the Reaktor Brennelement Union GmbH (Federal Republic of Germany) for co-operation in the field of fabrication of fuel elements for peaceful nuclear activities is reproduced in this document for the information of all Members. The Agreement entered into force, pursuant to Section 26, on 22 July 1977.

Discussion on the tropospheric concentrations of FC21

Energy Technology Data Exchange (ETDEWEB)

Crescentini, G.; Mangani, F.; Mastrogiamcomo, A.R.; Cappiello, A.; Bruner, F.

1986-01-01

FC21 tropospheric mixing ratios measured in air samples collected at different locations in the world are presented. Results of a campaign carried out at two locations in the Sahara desert where FC21 and FC11 mixing ratios were simultaneously determined in 180 samples are also shown. Though scattered high values have been found, the average background concentration of FC21 ranged between 0 and 1 pptv. 9 references, 1 figure, 2 tables.

The text of an African regional co-operative agreement for research, development and training related to nuclear science and technology

International Nuclear Information System (INIS)

1990-04-01

The document reproduces the text of an African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology among African Member States that was endorsed by the Board of Governors on 21 February 1990

Decontamination Systems Information and Research Program: Quarterly report, July--September 1994

International Nuclear Information System (INIS)

1994-11-01

West Virginia University (WVU) and the US DOE Morgantown Energy Technology Center (METC) entered into a Cooperative Agreement on August 29, 1992 entitled ''Decontamination Systems Information and Research Programs'' (DOE Instrument No.: DE-FC21-92MC29467). Stipulated within the Agreement is the requirement that WVU submit to METC a series of Technical Progress Reports on a quarterly basis. This report comprises the eighth Quarterly Technical Progress Report for the Agreement. This report reflects the progress and/or efforts performed on the 16 technical projects encompassed by the Agreement for the period of July 1 through September 30, 1994. These projects focus on the following: Bio-remediation of organic compounds, heavy metals, and radionuclides; miscellaneous remediation technologies; instrumentation; and technology assessments

43 CFR 24.6 - Cooperative agreements.

Science.gov (United States)

2010-10-01

... Congressional policy (e.g., Fish and Wildlife Coordination Act of 1956) of State-Federal cooperation and coordination in the area of fish and wildlife conservation, State and Federal agencies have implemented...: (1) Protection, maintenance, and development of fish and wildlife habitat; (2) Fish and wildlife...

C/EBPβ (CCAAT/enhancer-binding protein β) mediates progesterone production through transcriptional regulation in co-operation with SF-1 (steroidogenic factor-1).

Science.gov (United States)

Mizutani, Tetsuya; Ju, Yunfeng; Imamichi, Yoshitaka; Osaki, Tsukasa; Yazawa, Takashi; Kawabe, Shinya; Ishikane, Shin; Matsumura, Takehiro; Kanno, Masafumi; Kamiki, Yasue; Kimura, Kohei; Minamino, Naoto; Miyamoto, Kaoru

2014-06-15

The transcription factor SF-1 (steroidogenic factor-1) is a master regulator of steroidogenesis. Previously, we have found that SF-1 induces the differentiation of mesenchymal stem cells into steroidogenic cells. To elucidate the molecular mechanisms of SF-1-mediated functions, we attempted to identify protein components of the SF-1 nuclear protein complex in differentiated cells. SF-1 immunoaffinity chromatography followed by MS/MS analysis was performed, and 24 proteins were identified. Among these proteins, we focused on C/EBPβ (CCAAT/enhancer-binding protein β), which is an essential transcription factor for ovulation and luteinization, as the transcriptional mechanisms of C/EBPβ working together with SF-1 are poorly understood. C/EBPβ knockdown attenuated cAMP-induced progesterone production in granulosa tumour-derived KGN cells by altering STAR (steroidogenic acute regulatory protein), CYP11A1 (cytochrome P450, family 11, subfamily A, polypeptide 1) and HSD3B2 (hydroxy-δ-5-steroid dehydrogenase, 3β- and steroid δ-isomerase 2) expression. EMSA and ChIP assays revealed novel C/EBPβ-binding sites in the upstream regions of the HSD3B2 and CYP11A1 genes. These interactions were enhanced by cAMP stimulation. Luciferase assays showed that C/EBPβ-responsive regions were found in each promoter and C/EBPβ is involved in the cAMP-induced transcriptional activity of these genes together with SF-1. These results indicate that C/EBPβ is an important mediator of progesterone production by working together with SF-1, especially under tropic hormone-stimulated conditions.

Text of an African regional co-operative agreement for research, development and training related to nuclear science and technology

International Nuclear Information System (INIS)

1994-01-01

As of 1 September 1994, notifications of acceptance of the African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (see INFCIRC/377), in accordance with Article XIII thereof, had been received by the Director General from the Governments of: Tunisia, Egypt, Algeria, Nigeria, Madagascar, Libya, Morocco, Kenya, Sudan, Ghana, Tanzania, Mauritius, Cameroon, South Africa, Zaire, Ethiopia, Zambia, Niger. The Agreement entered into force on 4 April 1990, the date of receipt of the third notification of acceptance

Determination of 99Mo in 99mTc eluates used in nuclear medicine centers in Rio de Janeiro

International Nuclear Information System (INIS)

Ribeiro, Bianca da S.; Souza, Raphael S.S.; Lucena, Eder A.; Dantas, Ana Leticia A.; Dantas, Bernardo M.

2009-01-01

99m Tc is used in nuclear medicine for image diagnoses with SPECT. It is obtained from the elution of molybdenum-99/technetium-99m ( 99 Mo/ 99m Tc) generators. During the elution, 99 Mo can detach from the column, passing through the filter and mixing in the solution of pertechnetate eluate and becoming a radionuclidic impurity. The presence of molybdenum in the radiopharmaceutical solution imparts an unnecessary radiation dose to the patient, since its half-life is relatively long (66 hours) and it emits beta particles and high-energy photons of (740 keV). A parameter that indicates the quality of the eluates is the radionuclidic purity, the MBT (molybdenum break through), defined as the ratio between 99 Mo and 99m Tc activities in the eluate. The American and the European Pharmacopoeias restrict 99 Mo content to respectively 0.015% and 0.1% activity ratio 99 Mo/ 99m Tc at the time of the administration to the patient. In Brazil, this parameter is not controlled by official regulations. The objective of this work is to determine the presence of 99 Mo in the eluates used in nuclear medicine centers (NMC). The activity measurements of 99 Mo were performed with a NaI(Tl)8''x4'' scintillation detector installed in the IRD whole body counter. The activity of 99m Tc was measured in the NMC where the eluates were collected and, using the established calculations, it was determined the activity ratio 99 Mo/ 99m Tc. The eluate samples were kindly supplied by the participating NMC of Rio de Janeiro. All measurements indicated the presence of 99 Mo. It is concluded that the technique is sensitive to detect 99 Mo in 99m Tc eluates and permits to verify the quality of the generators used in NMC evaluated in this study. (author)

The Principle of Justice Administered Only by the Court When Making a Pre-Trial Cooperation Agreement and Special Trial Order

Directory of Open Access Journals (Sweden)

Suvorova A. A.

2015-01-01

Full Text Available The article investigates the problems of realization of the principle of justice administered only by the court in special conditions of judicial proceedings, suggests the ways of optimizing the procedure of making a pre-trial cooperation agreement.

Evolutionary Fuzzy Control and Navigation for Two Wheeled Robots Cooperatively Carrying an Object in Unknown Environments.

Science.gov (United States)

Juang, Chia-Feng; Lai, Min-Ge; Zeng, Wan-Ting

2015-09-01

This paper presents a method that allows two wheeled, mobile robots to navigate unknown environments while cooperatively carrying an object. In the navigation method, a leader robot and a follower robot cooperatively perform either obstacle boundary following (OBF) or target seeking (TS) to reach a destination. The two robots are controlled by fuzzy controllers (FC) whose rules are learned through an adaptive fusion of continuous ant colony optimization and particle swarm optimization (AF-CACPSO), which avoids the time-consuming task of manually designing the controllers. The AF-CACPSO-based evolutionary fuzzy control approach is first applied to the control of a single robot to perform OBF. The learning approach is then applied to achieve cooperative OBF with two robots, where an auxiliary FC designed with the AF-CACPSO is used to control the follower robot. For cooperative TS, a rule for coordination of the two robots is developed. To navigate cooperatively, a cooperative behavior supervisor is introduced to select between cooperative OBF and cooperative TS. The performance of the AF-CACPSO is verified through comparisons with various population-based optimization algorithms for the OBF learning problem. Simulations and experiments verify the effectiveness of the approach for cooperative navigation of two robots.

SF3B1-initiating mutations in MDS-RSs target lymphomyeloid hematopoietic stem cells.

Science.gov (United States)

Mortera-Blanco, Teresa; Dimitriou, Marios; Woll, Petter S; Karimi, Mohsen; Elvarsdottir, Edda; Conte, Simona; Tobiasson, Magnus; Jansson, Monika; Douagi, Iyadh; Moarii, Matahi; Saft, Leonie; Papaemmanuil, Elli; Jacobsen, Sten Eirik W; Hellström-Lindberg, Eva

2017-08-17

Mutations in the RNA splicing gene SF3B1 are found in >80% of patients with myelodysplastic syndrome with ring sideroblasts (MDS-RS). We investigated the origin of SF3B1 mutations within the bone marrow hematopoietic stem and progenitor cell compartments in patients with MDS-RS. Screening for recurrently mutated genes in the mononuclear cell fraction revealed mutations in SF3B1 in 39 of 40 cases (97.5%), combined with TET2 and DNMT3A in 11 (28%) and 6 (15%) patients, respectively. All recurrent mutations identified in mononuclear cells could be tracked back to the phenotypically defined hematopoietic stem cell (HSC) compartment in all investigated patients and were also present in downstream myeloid and erythroid progenitor cells. While in agreement with previous studies, little or no evidence for clonal ( SF3B1 mutation) involvement could be found in mature B cells, consistent involvement at the pro-B-cell progenitor stage was established, providing definitive evidence for SF3B1 mutations targeting lymphomyeloid HSCs and compatible with mutated SF3B1 negatively affecting lymphoid development. Assessment of stem cell function in vitro as well as in vivo established that only HSCs and not investigated progenitor populations could propagate the SF3B1 mutated clone. Upon transplantation into immune-deficient mice, SF3B1 mutated MDS-RS HSCs differentiated into characteristic ring sideroblasts, the hallmark of MDS-RS. Our findings provide evidence of a multipotent lymphomyeloid HSC origin of SF3B1 mutations in MDS-RS patients and provide a novel in vivo platform for mechanistically and therapeutically exploring SF3B1 mutated MDS-RS. © 2017 by The American Society of Hematology.

El éxito de los procesos de fusión en el mercado de auditoría: el caso de PriceWaterhouseCoopers

Directory of Open Access Journals (Sweden)

Cristina de Fuentes

2015-01-01

Los resultados revelan que PriceWaterhouse y Coopers & Lybrand hubiesen alcanzado una cuota de mercado y una facturación inferior a la de sus competidores más directos en caso de no haberse fusionado, aunque las diferencias no son significativas. Por otra parte, la firma fusionada alcanzó una facturación y cuota de mercado significativamente superior a la de sus competidoras más relevantes, siendo en este caso las diferencias estadísticamente significativas. Así pues, este trabajo nos permite concluir que la firma resultante de la fusión, PriceWaterhouseCoopers, ha alcanzado un grado de penetración en el mercado de auditoría mayor que el de sus competidores más directos.

Upgraded PMI diagnostic capabilities using Accelerator-based In-situ Materials Surveillance (AIMS) on Alcator C-Mod

Science.gov (United States)

Kesler, Leigh; Barnard, Harold; Hartwig, Zachary; Sorbom, Brandon; Lanza, Richard; Terry, David; Vieira, Rui; Whyte, Dennis

2014-10-01

The AIMS diagnostic was developed to rapidly and non-invasively characterize in-situ plasma material interactions (PMI) in a tokamak. Recent improvements are described which significantly expand this measurement capability on Alcator C-Mod. The detection time at each wall location is reduced from about 10 min to 30 s, via improved hardware and detection geometry. Detectors are in an augmented re-entrant tube to maximize the solid angle between detectors and diagnostic locations. Spatial range is expanded by using beam dynamics simulation to design upgraded B-field power supplies to provide maximal poloidal access, including a ~20° toroidal range in the divertor. Measurement accuracy is improved with angular and energy resolved cross section measurements obtained using a separate 0.9 MeV deuteron ion accelerator. Future improvements include the installation of recessed scintillator tiles as beam targets for calibration of the diagnostic. Additionally, implanted depth marker tiles will enable AIMS to observe the in-situ erosion and deposition of high-Z plasma-facing materials. This work is supported by U.S. DOE Grant No. DE-FG02-94ER54235 and Cooperative Agreement No. DE-FC02-99ER54512.

Traces of pFc' in IVIG interact with human IgG Fc domains and counteract aggregation

NARCIS (Netherlands)

Rispens, Theo; Himly, Martin; Ooievaar-de Heer, Pleuni; den Bleker, Tamara H.; Aalberse, Rob C.

2010-01-01

To prevent multimer formation, intravenous immunoglobulin (IVIG) is often treated with traces of pepsin. So far, the mechanism behind this treatment has been unclear. Recently, we reported that human IgG4 binds other IgG molecules via Fc-Fc interactions. Here we show that IVIG treated with traces of

United States and Spain sign energy R and D agreement

International Nuclear Information System (INIS)

Anon.

1986-01-01

In two memoranda signed June 6, 1986, the United States Department of Energy and two Spanish governmental agencies have agreed to conduct cooperative energy research and development projects. These five-year bilateral agreements mark the first formal cooperative energy efforts between the two countries. Areas of cooperation in one memorandum between the DOE and the Spanish Junta de Energia Nuclear are as follows: nuclear energy (including nuclear safety technology), radioactive waste management, renewable energy (including biomass), and coal and gas technologies. The second memorandum, signed by the DOE and the Spanish Instituto Geologico y Minero, deals solely with coal gasification and geothermal energy technologies. No specific projects or development efforts are discussed in the memoranda. Rather, the terms for exchanges of personnel, technology conferences, establishment of projects, etc. are more to outline areas to possible future cooperation

Fatores de correção volumétrica na medição de atividade de 99mTc e 123I em calibradores de radionuclídeos

Directory of Open Access Journals (Sweden)

Amanda Ribeiro Correia

2012-04-01

Full Text Available OBJETIVO: Determinar os fatores de correção para a variação volumétrica dos radiofármacos contidos em recipientes de diferentes geometrias. Comparar a influência desses fatores na determinação da atividade de 99mTc e 123I utilizando dois tipos de calibradores: um com câmara de ionização e outro com detector Geiger-Müller (G-M. Avaliar o desempenho de calibradores de alguns serviços de medicina nuclear em medição de atividade de 99mTc e 123I. MATERIAIS E MÉTODOS: Foram utilizados oito calibradores, frascos de vidro 10R, seringas de plástico de 3 e 5 mL e soluções de 99mTc e 123I. Os fatores de correção foram determinados a partir das medições práticas da variação da leitura do calibrador com a variação do volume da solução no recipiente. O desempenho foi avaliado em relação ao critério de aceitação de ±10% de exatidão exigida pela norma brasileira. RESULTADOS: A variação da resposta do calibrador com a variação do volume do frasco foi bem maior no calibrador que utiliza G-M. Ela também foi maior para 123I do que para 99mTc. CONCLUSÃO: Os resultados confirmam que a resposta dos calibradores depende do volume contido nos recipientes. Essa dependência é mais crítica para os calibradores equipados com detector G-M e para 123I quando comparado com 99mTc.

Coordinating choice in partial cooperative equilibrium

NARCIS (Netherlands)

Mallozzi, L.; Tijs, S.H.

2009-01-01

In this paper we consider symmetric aggregative games and investigate partial cooperation between a portion of the players that sign a cooperative agreement and the rest of the players. Existence results of partial cooperative equilibria are obtained when the players who do not sign the agreement

Influência do nível de performance na estratégia de ritmo de corrida em prova de 10 km de corredores recreacionais

Directory of Open Access Journals (Sweden)

Francisco de Assis MANOEL

2015-09-01

Full Text Available ResumoO objetivo do estudo foi verificar a influência do nível de performance na estratégia de ritmo de corrida de corredores recreacionais. Adicionalmente, objetivou-se descrever o comportamento da frequência cardíaca (FC obtida em prova de 10 km em pista de atletismo. Participaram 39 corredores recreacionais (31,5 ± 6,7 anos, experientes em provas de 10 km que realizaram uma performance nesta distância em pista de atletismo (400 m. A FC foi constantemente monitorada (Polar RS800 e o tempo a cada 400 m foi registrado para determinação da velocidade média (VM, posteriormente analisada a cada 2 km. Os participantes foram divididos em dois grupos de acordo com a VM alcançada nos testes: G1 = VM 10 km ≤ 11,81 (n = 20 e G2 = VM 10 km > 11,81 (n = 19. A comparação entre os valores de VM e FC obtidos nos diferentes momentos da performance para os dois grupos foi realizada pela Anova mista, adotando-se nível de significância de p < 0,05. Os valores de VM foram diferentes entre os grupos em todos os momentos analisados, com aumento significante da VM do momento 6-8 km para 8-10 km para o mesmo grupo. Os valores de FC foram diferentes apenas intra-grupos. No G1, houve aumento significante da FC a cada 2 km de prova. Para o G2, a FC aumentou do 2º ao 4º km e permaneceu estável até o 8º km, aumentando novamente nos últimos 2 km da performance. Concluímos que o nível de performance não influencia a estratégia de corrida de corredores recreacionais.

Agreement for cooperation on the peaceful uses of nuclear energy between the Swiss Federal Council and the Government of the French Republic

International Nuclear Information System (INIS)

1988-01-01

This Agreement between France and Switzerland entered into force on 1 December 1990. The purpose of the Agreement, in the framework of both countries' respective programmes, is to develop their co-operation in the field of the peaceful uses of nuclear energy. Co-operation may be extended to the entire area of nuclear power production, including fuel cycle operations, radioisotope production, scientific and technical research, and nuclear safety. Both Parties agree to contribute to enhancing the safety of nuclear installations and preventing harmful effects to the environment, in particular, by exchanging information in particular on reactor safety design and reactor safety; technical rules and criteria in the field of reactor safety; and safety of other installations in the fuel cycle [fr

IAEA Director General reacts to U.S.- India cooperation agreement

International Nuclear Information System (INIS)

2005-01-01

Full text: IAEA Director General, Mohamed ElBaradei has welcomed the US-India agreement to embark on full civil nuclear energy cooperation and to work to enhance nuclear non-proliferation and security. 'Out of the box thinking and active participation by all members of the international community are important if we are to advance nuclear arms control, non-proliferation, safety and security, and tackle new threats such as illicit trafficking in sensitive nuclear technology and the risks of nuclear terrorism,' Dr. ElBaradei said. Dr. ElBaradei has also been urging all countries using nuclear energy to apply the highest safety standards possible. 'Making advanced civil nuclear technology available to all countries will contribute to the enhancement of nuclear safety and security,' he said. Dr. ElBaradei said that India's intention to identify and place all its civilian nuclear facilities under IAEA safeguards and sign and adhere to an Additional Protocol with respect to civilian nuclear facilities is a welcome development. I have always advocated concrete and practical steps towards the universal application of IAEA safeguards,' Dr. ElBaradei said. (IAEA)

CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

Energy Technology Data Exchange (ETDEWEB)

Hugh W. Rimmer

2004-05-12

This Technical Progress Report describes progress made on the seventeen subprojects awarded in the first year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices. Due to the time taken up by the solicitation/selection process, these cover the initial 6-month period of project activity only. The U.S. is the largest producer of mining products in the world. In 1999, U.S. mining operations produced $66.7 billion worth of raw materials that contributed a total of $533 billion to the nation's wealth. Despite these contributions, the mining industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations. Originally set up by Virginia Tech and West Virginia University, this endeavor has been expanded into a seven-university consortium--Virginia Tech, West Virginia University, University of Kentucky, University of Utah, Montana Tech, New Mexico Tech and University of Nevada, Reno--that is supported through U.S. DOE Cooperative Agreement No. DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: (1) Solid-solid separation (2) Solid-liquid separation (3) Chemical/Biological Extraction (4) Modeling and Control, and (5) Environmental Control.

Relevancia de los diferentes momentos del juego y de las acciones a balón parado (ABP en los rendimientos del FC Barcelona y Real Madrid durante la liga nacional de fútbol profesional 2011/12

Directory of Open Access Journals (Sweden)

Xavier Planes i Fontestad

2015-08-01

Full Text Available El estudio se centra en la relevancia de las fases dinámicas y estáticas en los rendimientos del FC Barcelona y Real Madrid. Utilizamos la metodología observacional con el fin de tratar de asociar los diferentes Momentos o Fases del juego (MJ y las Acciones a Balón Parado (ABP con la obtención de cada uno de los goles. Para conseguirlo, hemos creado un instrumento de observación ad hoc (IOX y hemos utilizado dos instrumentos de registro (LINCE y MOTS. Para el análisis de los datos del registro y la obtención de resultados, hemos utilizado las técnicas de comparación de proporciones con el software Statgraphics, habiendo encontrado, inicialmente, diferencias significativas entre los dos equipos únicamente en la fase defensiva.

Excited cooper pairs

Energy Technology Data Exchange (ETDEWEB)

Lopez-Arrietea, M. G.; Solis, M. A.; De Llano, M. [Universidad Nacional Autonoma de Mexico, Mexico, D.F (Mexico)

2001-02-01

Excited cooper pairs formed in a many-fermion system are those with nonzero total center-of mass momentum (CMM). They are normally neglected in the standard Bardeen-Cooper-Schrieffer (BCS) theory of superconductivity for being too few compared with zero CMM pairs. However, a Bose-Einstein condensation picture requires both zero and nonzero CMM pairs. Assuming a BCS model interaction between fermions we determine the populations for all CMM values of Cooper pairs by actually calculating the number of nonzero-CMM pairs relative to that of zero-CMM ones in both 2D and 3D. Although this ratio decreases rapidly with CMM, the number of Cooper pairs for any specific CMM less than the maximum (or breakup of the pair) momentum turns out to be typically larger than about 95% of those with zero-CMM at zero temperature T. Even at T {approx}100 K this fraction en 2D is still as large as about 70% for typical quasi-2D cuprate superconductor parameters. [Spanish] Los pares de cooper excitados formados en un sistema de muchos electrones, son aquellos con momentos de centro de masa (CMM) diferente de cero. Normalmente estos no son tomados en cuenta en la teoria estandar de la superconductividad de Bardeen-Cooper-Schrieffer (BCS) al suponer que su numero es muy pequeno comparados con los pares de centro de masa igual a cero. Sin embargo, un esquema de condensacion Bose-Einstein requiere de ambos pares, con CMM cero y diferente de cero. Asumiendo una interaccion modelo BCS entre los fermiones, determinamos la poblacion de pares cooper con cada uno de todos los posibles valores del CMM calculando el numero de pares con momentos de centro de masa diferente de cero relativo a los pares de CMM igual a cero, en 2D y 3D. Aunque esta razon decrece rapidamente con el CMM, el numero de pares de cooper para cualquier CMM especifico menor que el momento maximo (o rompimiento de par) es tipicamente mas grande que el 95% de aquellos con CMM cero. Aun a T {approx}100 K esta fraccion en 2D es

Efeito do método de abate e do sexo sobre a qualidade da carne de capivara (Hydrochaeris hydrochaeris Effect of slaughter method and gender on the meat quality of capybara (Hydrochaeris hydrochaeris L. 1766

Directory of Open Access Journals (Sweden)

Sandra H. I. Oda

2004-09-01

Full Text Available O presente trabalho teve como objetivo avaliar o efeito de dois métodos de abate (MA e do sexo sobre a qualidade de carne de capivaras. Os métodos de abate avaliados foram o humanitário (MH e por tiro (MT, sendo utilizados 2 lotes de 10 animais, um deles contendo 5 machos e 5 fêmeas e outro com 8 machos e 2 fêmeas, nos quais foram avaliados os valores de pH na 1ª, 3ª, 5ª, 7ª, 9ª, 11ª e 24ª horas após o abate e a perda de peso por cozimento (PPC, a cor e a força de cisalhamento (FC, em porções do músculo longissimus dorsi, retiradas entre a 10ª e 12ª vértebras. Os resultados obtidos indicaram que as médias de pH não foram influenciadas pelo MA e pelo sexo. Os valores médios foram: 6,24; 6,05; 6,01; 6,01; 6,03; 6,04 e 5,96 às 1, 3, 5, 7, 9, 11 e 24 horas, respectivamente. Em relação à cor, o MT apresentou valor de L* (32,40 superior (PThe aim of this study was to assess the effect of two slaughter methods (SM and the gender on the quality of capybara meat. The slaughter methods assessed were the humanitarian (HM and by head-shot (HS. Two lots of 10 animals were used, one of them containing 5 males and 5 females and the other containing 8 males and 2 females. Values of pH of the longissimus dorsi muscle (between the vertebras 10th and 12th after 1, 3, 5, 7, 9, 11 and 24h post mortem (p. m., color (L, a e b, weight losses by cooking (WLC and shear force (SF were assessed on samples obtained at these points. The results indicated that pH means were not influenced by both SM and sex. The medium values were: 6.24; 6.05; 6.01; 6.01; 6.03; 6.04 and 5.96 at 1, 3, 5, 7, 9, 11 and 24 hours respectively. That demonstrated that in those encourage the installation of the rigor mortis superficial with reduced extension glicolitic. Regarding the color, HS presented higher L* (32.40 values (P<0,05 than HM (29.59, and the effect of gender on this parameter was not observed. On the other color parameters and on WLC no differences among

Medições instrumentais e sensoriais de dureza e suculência na carne caprina Instrumental and sensorial assessment of tenderness and juiciness in goat meat

Directory of Open Access Journals (Sweden)

Ângela da Silva Borges

2006-12-01

Full Text Available Foi avaliado o efeito do tipo de músculo e da maturação sobre algumas propriedades funcionais e sensoriais da carne caprina. Utilizaram-se os músculos longissimus dorsi, semimembranosus e biceps femoris de cabras com aproximadamente 20 meses de idade. A carne, sem maturar e maturada por sete dias, foi avaliada para perdas por cocção (PPC e força de cisalhamento (FC, por métodos instrumentais, e para dureza sensorial (DS e suculência sensorial (SS, por provadores treinados. As PPC não sofreram efeito significativo (p > 0,05 do tipo de músculo e da maturação da carne. A carne sem maturar do músculo semimembranosus apresentou maior FC que aquelas dos músculos longissimus dorsi e biceps femoris. Em relação ao tipo de músculo, após a maturação, as carnes dos músculos semimembranosus e biceps femoris se apresentaram mais macias que a do longissimus dorsi. Quanto ao efeito da maturação, a FC da carne do músculo semimembranosus diminuiu significativamente. A FC apresentou correlação positiva com DS e correlação negativa com SS. Dureza e suculência avaliadas de forma sensorial apresentaram correlação negativa. A maturação por 7 dias diminuiu a dureza, mas não afetou as PPC da carne dos músculos semimembranosus e bíceps femoris.The effect of muscle type and aging for seven days on certain functional and sensory properties of goat meat was evaluated. The experiment used meat from longissimus dorsi, semimembranosus and biceps femoris muscles from female goats that were approximately 20 months. After 24 h of being slaughtered and seven days, the aging meat was instrumentally analyzed for cooking losses (CL and shear force (SF, as well as for sensory firmness (F and juiciness (J by a trained panel. CL was not affected (p > 0.05 by the type of muscle and aging of the meat. Before aging, meat from semimembranosus muscles showed higher SF than those from longissimus dorsi or bicep femoris muscles. After aging, meat from

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function.

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela

2016-02-05

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function*

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela

2016-01-01

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823

The Text of the Safeguards Agreement relating to the Bilateral Agreement between India and the United States of America

International Nuclear Information System (INIS)

1971-01-01

The text of the Safeguards Agreement between the Agency, the Government of India and the Government of the United States of America providing for the Agency to apply safeguards in relation to the agreement between those Governments concerning co-operation in the civil uses of atomic energy, is reproduced in part I of this document for the information of all Members. The text of the co-operation agreement is reproduced in part II. The Safeguards Agreement entered into force on 27 January 1971

The Text of the Safeguards Agreement relating to the Bilateral Agreement between India and the United States of America

Energy Technology Data Exchange (ETDEWEB)

NONE

1971-09-03

The text of the Safeguards Agreement between the Agency, the Government of India and the Government of the United States of America providing for the Agency to apply safeguards in relation to the agreement between those Governments concerning co-operation in the civil uses of atomic energy, is reproduced in part I of this document for the information of all Members. The text of the co-operation agreement is reproduced in part II. The Safeguards Agreement entered into force on 27 January 1971.

Scattering factor evaluation for internal dose assessment due to 60Co

International Nuclear Information System (INIS)

Gautam, Y.P.; Kumar, A.; Sharma, S.; Sharma, A.K.; Dube, B.; Hegde, A.G.

2008-01-01

Guidelines for the assessment of internal doses from monitoring suggest default measurement of uncertainties (i.e. lognormal scattering factor, SF) to be used for different types of monitoring data. In this paper, SF values have been evaluated for internal contamination due to 60 Co in two cases using whole body counting data. SF values of 1.04 and 1.03 were obtained for case I and II respectively while SF value of 1.03 was obtained using bioassay data for case I. SF evaluated is in good agreement with the default values given by IDEAS guidelines. (author)

Proposal for the Extension of a Project Agreement with ISTC - Crystal Clear Collaboration

CERN Document Server

2002-01-01

This document concerns the extension of the scope of work covered by a project agreement with the ISTC, entitled "Development of the Detector Production Technology for a New Generation of Positron Emission Tomographs to be used in Medicine and Pharmacology" which was approved by Finance Committee on 19 September 2001 (CERN/FC/4478). For the reasons set out in this document, the Finance Committee is invited to approve the extension of the scope of work covered by the above project agreement for the optimisation of the technology for a total amount of 160 000 US dollars. This extension will be partially funded by two external sponsors (RAYTEST - DE and the UNIVERSITY OF LAUSANNE - CH) at the level of 90 000 US dollars. CERN's contribution, which will be funded by revenue generated by its technology transfer activities, will not exceed 70 000 US dollars. This extension will bring the total amount of the Project Agreement to 935 000 US dollars, of which CERN's total contribution will not exceed 320 000 US dollars...

Experience in infection images with new radio antibiotic the {sup 99m}Tc-ceftizoxime (TCF); Experiencia en imagenes de infecciones con un nuevo radio-antibiotico la ceftizoxima-{sup 99m}Tc (CFT)

Energy Technology Data Exchange (ETDEWEB)

Soroa, Victoria E; Rabiller, Graciela; Velasquez Espeche, Maria del H. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Centro de Medicina Nuclear; Fioriolli, Marcelo H; Rodriguez, Hernan [Hospital de Clinicas Jose de San Martin, Buenos Aires (Argentina); Roca, Manuel; Martin-Comin, Joseph [Hospital Universitario Bellvitge, Barcelona (Spain). Servicio de Medicina Nuclear

2004-07-01

Previous results obtained in the detection of infections with {sup 99m}Tc-ceftizoxime encourage to the group of work to investigate the behavior of an antibiotic of third generation: the ceftizoxime radiolabelled with {sup 99m}Tc and to compare it with other radio-labels in different infectious / inflammatory pathologies. [Spanish] Anteriores resultados obtenidos en la deteccion de infecciones con el {sup 99m}TC-ceftizoxima incentivo al grupo de trabajo a investigar el comportamiento de un antibiotico de tercera generacion: la ceftizoxima radiomarcada con {sup 99m}Tc y compararlo con otros radiomarcadores en diferentes patologias infecciosas/inflamatorias.

Optimization on Fc for Improvement of Stability and Aggregation Resistance.

Science.gov (United States)

Chen, Xiaobo; Zeng, Fang; Huang, Tao; Cheng, Liang; Liu, Huan; Gong, Rui

2016-01-01

Fc-based therapeutics including therapeutic full-size monoclonal antibodies (mAbs) and Fcfusion proteins represent fastest-growing market in biopharmaceutical industrial. However, one major challenge during development of Fc-based therapeutics is how to maintain their efficacy in clinic use. Many factors may lead to failure in final marketing. For example, the stability and aggregation resistance might not be high enough for bearing the disadvantages during fermentation, purification, formulation, storage, shipment and other steps in manufacture and sale. Low stability and high aggregation tendency lead to decreased bioactivity and increased risk of immunogenicity resulting in serious side effect. Because Fc is one of the major parts in monoclonal antibodies and Fc-fusion proteins, engineering of Fc to increase its stability and reduce or eliminate aggregation due to incorrect association are of great importance and could further extend the potential of Fc-based therapeutics. Lots of studies focus on Fc optimization for better physical and chemical characteristics and function by structured-based computer-aid rational design, high-throughput screening expression system selection and other methods. The identification of optimized Fc mutants increases the clinic potential of currently existed therapeutics mAbs and Fc-fusion proteins, and accelerates the development of new Fc-based therapeutics. Here we provide an overview of the related field, and discuss recent advances and future directions in optimization of Fc-based therapeutics with modified stability and aggregation resistance. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Dicty_cDB: FC-AJ15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

International Nuclear Information System (INIS)

1998-01-01

As of 31 January 1998, notifications of acceptance of the extension of the African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology(INFCIRC/377), has been received by the Director General of the IAEA from the Governments of 21 African States. Uganda is added at the at the list of 20 African States reported in the previous addition to the document (INFCIRC/377/Add.8). Pursuant to Article XIV.2 of the original Agreement the extension entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)

International Nuclear Information System (INIS)

1997-01-01

As of 31 December 1996, notifications of acceptance of the extension of the African Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology (AFRA) (see INFCIRC/377), had been received by the Director General from the Governments of 20 African countries. Niger, Libya and Mali are added at the list of 17 countries reported in the previous addition of the document (INFCIRC/377/Add.7). Pursuant to Article XIV.2 of the original Agreement, the extension entered into force on 4 April 1995, upon expiration of the original Agreement, and will remain in force for an additional period of 5 years, i.e. through 3 April 2000

Extension of the African regional co-operative agreement for research, development and training related to nuclear science and technology (AFRA)