WorldWideScience

Sample records for contract de-fc05-97or22606 final

  1. DELTA-DIESEL ENGINE LIGHT TRUCK APPLICATION Contract DE-FC05-97OR22606 Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Hakim, Nabil Balnaves, Mike

    2003-05-27

    DELTA Diesel Engine Light Truck Application End of Contract Report DE-FC05-97-OR22606 EXECUTIVE SUMMARY This report is the final technical report of the Diesel Engine Light Truck Application (DELTA) program under contract DE-FC05-97-OR22606. During the course of this contract, Detroit Diesel Corporation analyzed, designed, tooled, developed and applied the ''Proof of Concept'' (Generation 0) 4.0L V-6 DELTA engine and designed the successor ''Production Technology Demonstration'' (Generation 1) 4.0L V-6 DELTA engine. The objectives of DELTA Program contract DE-FC05-97-OR22606 were to: Demonstrate production-viable diesel engine technologies, specifically intended for the North American LDT and SUV markets; Demonstrate emissions compliance with significant fuel economy advantages. With a clean sheet design, DDC produced the DELTA engine concept promising the following attributes: 30-50% improved fuel economy; Low cost; Good durability and reliability; Acceptable noise, vibration and harshness (NVH); State-of-the-art features; Even firing, 4 valves per cylinder; High pressure common rail fuel system; Electronically controlled; Turbocharged, intercooled, cooled EGR; Extremely low emissions via CLEAN Combustion{copyright} technology. To demonstrate the engine technology in the SUV market, DDC repowered a 1999 Dodge Durango with the DELTA Generation 0 engine. Fuel economy improvements were approximately 50% better than the gasoline engine replaced in the vehicle.

  2. Diesel Engine Light Truck Application

    Energy Technology Data Exchange (ETDEWEB)

    None

    2007-12-31

    The Diesel Engine Light Truck Application (DELTA) program consists of two major contracts with the Department of Energy (DOE). The first one under DE-FC05-97-OR22606, starting from 1997, was completed in 2001, and consequently, a final report was submitted to DOE in 2003. The second part of the contract was under DE-FC05-02OR22909, covering the program progress from 2002 to 2007. This report is the final report of the second part of the program under contract DE-FC05-02OR22909. During the course of this contract, the program work scope and objectives were significantly changed. From 2002 to 2004, the DELTA program continued working on light-duty engine development with the 4.0L V6 DELTA engine, following the accomplishments made from the first part of the program under DE-FC05-97-OR22606. The program work scope in 2005-2007 was changed to the Diesel Particulate Filter (DPF) soot layer characterization and substrate material assessment. This final report will cover two major technical tasks. (1) Continuation of the DELTA engine development to demonstrate production-viable diesel engine technologies and to demonstrate emissions compliance with significant fuel economy advantages, covering progress made from 2002 to 2004. (2) DPF soot layer characterization and substrate material assessment from 2005-2007.

  3. Final Technical Report for contract number DE-FG02-05ER15670

    Energy Technology Data Exchange (ETDEWEB)

    Glazebrook, Jane [Univ. of Minnesota, Minneapolis, MN (United States)

    2016-02-29

    This is the final technical report for contract number DE-FG02-05ER15670. The project is now complete, and results of the project have been published. Two papers were published based on work done in the last three-year funding period. The DOIs of these papers are included below. The abstracts of the papers, providing summaries of the work, are included in the body of the report.

  4. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  5. Final Report - Advanced Cathode Catalysts and Supports for PEM Fuel Cells

    Energy Technology Data Exchange (ETDEWEB)

    Debe, Mark

    2012-09-28

    The principal objectives of the program were development of a durable, low cost, high performance cathode electrode (catalyst and support), that is fully integrated into a fuel cell membrane electrode assembly with gas diffusion media, fabricated by high volume capable processes, and is able to meet or exceed the 2015 DOE targets. Work completed in this contract was an extension of the developments under three preceding cooperative agreements/grants Nos. DE-FC-02-97EE50473, DE-FC-99EE50582 and DE-FC36- 02AL67621 which investigated catalyzed membrane electrode assemblies for PEM fuel cells based on a fundamentally new, nanostructured thin film catalyst and support system, and demonstrated the feasibility for high volume manufacturability.

  6. 46 CFR 97.05-5 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 97.05-5 Section 97.05... OPERATIONS Notice to Mariners and Aids to Navigation § 97.05-5 Charts and nautical publications. As... tables; (g) Current tables; and (h) All other nautical publications necessary. 1 1 For United States...

  7. Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT; FINAL

    International Nuclear Information System (INIS)

    Pienkos, Philip T.

    2002-01-01

    Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19

  8. Can De Sitter spacetime be a final state of the contracting universe

    International Nuclear Information System (INIS)

    Berezin, V.A.

    1984-01-01

    This chapter attempts to phenomenologically describe the final stage of the Universe contraction. A model equation of state is used to demonstrate that during a cosmological contraction a de Sitter spacetime may be produced. It is shown that a equilibrium thermodynamic description of the matter in cosmological models leads to the absence of particle creation. It is proposed that these nonequilibrium processes be taken into account by introducing a new additional thermodynamic variable showing the explicit time dependence of all thermodynamic potentials into the thermodynamic relations. The spacetime is assumed to be homogeneous and isotropic, and the energy momentum tensor includes not only the energy density and pressure for the matter and radiation, but it also includes contributions due to vacuum polarization by correspondent fields. It is demonstrated that it is possible to reach in principle the de Sitter spacetime as the limit of the contraction

  9. Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT

    Energy Technology Data Exchange (ETDEWEB)

    Pienkos, Philip T.

    2002-01-15

    Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19

  10. Substituição parcial e total da proteína do farelo de soja pela proteína dos farelos de canola e algodão em dietas para alevinos de piavuçu, Leporinus macrocephalus (Garavello & Britski, 1988 Partial and total replacement of soybean meal protein by canola or cottonseed meal protein in diets of Leporinus macrocephalus (Garavello & Britski, 1988 fingerlings

    Directory of Open Access Journals (Sweden)

    Anna Christina Esper Amaro de Faria

    2001-05-01

    Full Text Available Com o objetivo de avaliar a substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC e farelo de algodão (FA, em dietas para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, realizou-se um experimento com duração de 60 dias, utilizando-se 300 alevinos, com peso inicial médio de 0,10 g distribuídos em um delineamento em blocos casualizados, com seis tratamentos e cinco repetições. As dietas isoprotéicas foram formuladas de forma a terem o FS, FC, FA, FS+FC, FS+FA e FC+FA como fonte protéica. Os alevinos, alimentados com dietas contendo FS e FS+FA, apresentaram valores de peso final e taxa de eficiência protéica superiores (p 0,05 pelo uso das diferentes dietas. Observou-se redução linear dos valores de peso final, da taxa de eficiência protéica e aumento linear (p The effects of soybean meal (SB protein replacement by canola meal (CN or cottonseed meal (CT protein in diets of Leporinus macrocephalus (Characiformes, Anostomidae fingerlings are provided. Assay was carried out during 60 days. Three hundred fingerlings with mean initial weight of 1.00g were distributed in a block randomized design with six treatments and five replicates. Isoprotein diets contained SB, CN, CT, SB+CN, SB+CT and CN+CT as protein source. Fingerlings fed on diets with SB, SB+CN, SB+CT showed better final mean weight and protein efficiency rate values (p 0.05 by different diets linear reduction (p macrocephalus fingerlings, replacing 50.00% of SB protein.

  11. Final Report for DOE Project DE-FC07-99CH11010

    Energy Technology Data Exchange (ETDEWEB)

    Jed Randall; Robert Kean

    2003-10-22

    Department of Energy award number DE-FC07-99CH11010, Enhanced Utilization of Corn Based Biomaterials, supported a technology development program sponsored by Cargill Dow LLC from September 30, 1999 through June 30, 2003. The work involved fundamental scientific studies on poly lactic acid (PLA), a new environmentally benign plastic material from renewable resources. DOE funds supported academic research at the Colorado School of Mines and the National Renewable Energy Laboratory (NREL), and industry cost share was directed towards applied research into new product development utilizing the fundamental information generated by the academic partners. Under the arrangement of the grant, the fundamental information is published so that other companies can utilize it in evaluating the applicability of PLA in their own products. The overall project objective is to increase the utilization of PLA, a renewable resource based plastic, currently produced from fermented corn sugar.

  12. The Role of Bullfighting and FC Barcelona in the Emancipation of Catalonia from Spain (El papel de la corrida de toros y FC Barcelona en la emancipación de Cataluña de España

    Directory of Open Access Journals (Sweden)

    John A. TKac

    2015-06-01

    Full Text Available Abstract: This paper looks at the role that bullfighting and FC Barcelona have played in the growing independence movement in Catalonia. This article will discuss nations, the importance of bullfighting and soccer to Iberian cultures, Catalan political parties and their role in the nationalist movement, the vote to prohibit bullfighting and FC Barcelona´s increasing political conscious. I conclude that bullfighting and soccer have been used by political parties and those associated with the nationalist movement to foster feelings of difference with Spain. These feelings have been passed from the top down to the Catalan people and risk alienating those who are not in agreement with the nationalist movement.Resumen: Este trabajo examina el papel que la corrida de toros y el equipo de fútbol FC Barcelona han hecho en el movimiento continuo hacia la independencia en Cataluña. Discute el concepto de la nación, la importancia de las corridas y el fútbol en culturas ibéricas, partidos políticos catalanes y su rol en el voto a favor de la prohibición de las corridas en Cataluña y la evolución de la conciencia política cada vez más evidente de FC Barcelona. Concluyo que los partidos políticos y otros asociados con el movimiento hacia la independencia se han aprovechado de las corridas y el fútbol para destacar diferencias culturales con España. Esta actitud de diferencia se ha trasladado de arriba-abajo al pueblo catalán y el movimiento nacionalista corre el riesgo de alienar a los que no comparten sus creencias.

  13. Genetic deletion of muscle RANK or selective inhibition of RANKL is not as effective as full-length OPG-fc in mitigating muscular dystrophy.

    Science.gov (United States)

    Dufresne, Sébastien S; Boulanger-Piette, Antoine; Bossé, Sabrina; Argaw, Anteneh; Hamoudi, Dounia; Marcadet, Laetitia; Gamu, Daniel; Fajardo, Val A; Yagita, Hideo; Penninger, Josef M; Russell Tupling, A; Frenette, Jérôme

    2018-04-24

    Although there is a strong association between osteoporosis and skeletal muscle atrophy/dysfunction, the functional relevance of a particular biological pathway that regulates synchronously bone and skeletal muscle physiopathology is still elusive. Receptor-activator of nuclear factor κB (RANK), its ligand RANKL and the soluble decoy receptor osteoprotegerin (OPG) are the key regulators of osteoclast differentiation and bone remodelling. We thus hypothesized that RANK/RANKL/OPG, which is a key pathway for bone regulation, is involved in Duchenne muscular dystrophy (DMD) physiopathology. Our results show that muscle-specific RANK deletion (mdx-RANK mko ) in dystrophin deficient mdx mice improves significantly specific force [54% gain in force] of EDL muscles with no protective effect against eccentric contraction-induced muscle dysfunction. In contrast, full-length OPG-Fc injections restore the force of dystrophic EDL muscles [162% gain in force], protect against eccentric contraction-induced muscle dysfunction ex vivo and significantly improve functional performance on downhill treadmill and post-exercise physical activity. Since OPG serves a soluble receptor for RANKL and as a decoy receptor for TRAIL, mdx mice were injected with anti-RANKL and anti-TRAIL antibodies to decipher the dual function of OPG. Injections of anti-RANKL and/or anti-TRAIL increase significantly the force of dystrophic EDL muscle [45% and 17% gains in force, respectively]. In agreement, truncated OPG-Fc that contains only RANKL domains produces similar gains, in terms of force production, than anti-RANKL treatments. To corroborate that full-length OPG-Fc also acts independently of RANK/RANKL pathway, dystrophin/RANK double-deficient mice were treated with full-length OPG-Fc for 10 days. Dystrophic EDL muscles exhibited a significant gain in force relative to untreated dystrophin/RANK double-deficient mice, indicating that the effect of full-length OPG-Fc is in part independent of the RANKL

  14. Substratos renováveis na produção de mudas de Ficus enormis proveniente de jardim clonal

    Directory of Open Access Journals (Sweden)

    Rosimeri de Oliveira Fragoso

    2017-01-01

    Full Text Available Objetivou-se avaliar substratos renováveis à base de casca de arroz carbonizada (CAC e fibra de coco (FC sobre o enraizamento e qualidade final de mudas de Ficus enormis Mart. ex Miq. via estaquia caulinar de plantas provenientes de jardim clonal. Foram avaliados seis substratos: comercial (controle, composto por casca de arroz carbonizada (CAC, fibra de coco (FC e vermiculita (S1; 100% FC (S2; 100% CAC (S3; 50% FC e 50% CAC (S4; 30% (FC e 70% CAC (S5; 70% FC e 30% CAC (S6. O substrato comercial (S1 e as composições com maior proporção de FC apresentam qualificação superior para a produção de mudas de F. enormis.

  15. Características físico-químicas e custo do leite de cabras alimentadas com farelo de cacau ou torta de dendê Physical-chemical characteristics and cost of milk of goats fed with cocoa meal or palm kernel cake

    Directory of Open Access Journals (Sweden)

    H.G.O. Silva

    2006-02-01

    Full Text Available Avaliaram-se o efeito de dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao concentrado padrão, à base de milho e farelo de soja, sobre a composição físico-química e o resultado econômico da produção de leite. Foram utilizadas cinco cabras da raça Saanen com 41,66kg de peso e 60 dias de lactação, no delineamento experimental em quadrado latino 5×5. Os períodos experimentais foram de 14 dias, com 10 dias para adaptação e quatro para a coleta dos dados. As rações concentradas isoprotéicas (13,2% foram calculadas para uma produção de 2kg de leite/dia. As dietas constituíram-se de 36% de volumoso e 64% de concentrado. Utilizaram-se silagem de milho e concentrado-padrão (milho e farelo de soja com 0, 15 e 30% de substituição pelo FC ou TD. As dietas não influenciaram (P>0,05 as características físico-químicas do leite. A substituição reduziu o custo das dietas e apenas as com 15% de FC e 15% de TD apresentaram margem bruta superior à da dieta-controle.The effects of cocoa meal (FC or palm kernel cake (TD replacing corn and soybean meal standard concentrate on physical-chemical composition were evaluated and the economical analysis of milk production was performed. Five Saanen goats, with 41.66kg body weight and 60 days of lactation were used in a 5×5 latin square experimental design. The experimental periods of 14 days, had 10 days for adaptation and four days for data collection. The isoprotec diets (13.2%, were formulated to allow a milk production of 2kg/day. The diets were constituted of 36% roughage and 64% concentrate. The standard concentrate was replaced by 0, 15 and 30% of FC or TD. No effects of diets (P>0.05 on milk physical-chemical characteristics were observed. The inclusion of by-products reduced the cost of diets, however, only those with 15% FC and 15% TD showed gross margin higher than the one observed for the control diet.

  16. El rendimiento en el fútbol. Una modelización de las variables determinantes para el F.C. Barcelona

    Directory of Open Access Journals (Sweden)

    Carlos Lago Peñas

    2007-12-01

    Full Text Available El objetivo del presente trabajo es explicar las variables que determinan el rendimiento que alcanza el F.C. Barcelona a lo largo de un partido de fútbol. Para ello se han analizado los 38 partidos disputados por el F.C. Barcelona en la Primera División de la Liga Española de Fútbol de la temporada 2004-2005. La variable que mide el rendimiento es la diferencia entre los lanzamientos a favor y los lanzamientos en contra en cada partido. Las variables explicativas que se manejan son: jugar en casa o fuera, posesión del balón, llegadas al área y equipo rival como determinantes del rendimiento. Los resultados de los análisis de regresión lineal permiten explicar el 68 % de la varianza del rendimiento. El segundo objetivo es valorar la homogeneidad del modelo anterior dependiendo del Episodio de Juego que caracteriza al partido en cada momento, esto es, si el F.C. Barcelona tiene la iniciativa o está a la expectativa en el juego. Los resultados indican que cuando el F.C. Barcelona tiene la iniciativa en el partido tiene un rendimiento mejor que cuando se encuentra a la expectativa y que las variables explicativas analizadas tienen diferente importancia bajo estos escenarios de competición.

  17. 10 CFR 51.97 - Final environmental impact statement-materials license.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Final environmental impact statement-materials license. 51...-Regulations Implementing Section 102(2) Final Environmental Impact Statements-Materials Licenses § 51.97 Final environmental impact statement—materials license. (a) Independent spent fuel storage installation (ISFSI...

  18. DIFERENTES MODELOS DE REGRESIÓN PARA DESCRIBIR LA RELACIÓN V.O2-FC Y PARA ESTIMAR EL V.O2 A DIFERENTES INTENSIDADES DE ESFUERZO

    Directory of Open Access Journals (Sweden)

    Nuria Garatachea Vallejo

    2005-01-01

    Full Text Available Muchos son los estudios que demuestran el potencial de la frecuencia cardiaca (FC para estimar el coste energético de una actividad física, ya que se relaciona directamente con el consumo de oxígeno (V. O2. La mayoría de estudios describen la relación V. O2- FC como lineal para un amplio rango de esfuerzo, exceptuando los valores de reposo aunque se han propuesto diferentes funciones matemáticas continuas no lineales sin existir todavía un acuerdo en la ecuación más apropiada. También existen estudios que apuntan un cambio en la relación V. O2-FC en función de la intensidad del esfuerzo. Nuestro objetivo fue determinar cuál es la mejor función matemática que describe la relación entre la FC y el V. O2 y decidir cuál es la mejor función matemática para estimar el V. O2 a diferentes intensidades de esfuerzo. Participaron 14 sujetos que realizaron una prueba de esfuerzo máxima sobre cicloergómetro y una prueba que consistía en pedalear a 5 intensidades de esfuerzo (40, 50, 60, 70 y 80% del V. O2max durante 3 minutos. Durante ambas pruebas se midió V. O2 y frecuencia cardiaca. El modelo lineal y potencial fueron los modelos matemáticos más exactos para describir la relación V. O2-FC. El mayor error de estimación se produjo a bajas intensidades de esfuerzo. En conclusión, la elección de un tipo u otro de regresión influye en la exactitud del método de monitorización de la frecuencia cardiaca.

  19. A new carbon additive compounded Li3V1.97Zn0.05(PO4)3/C cathode for plug-in hybrid electric vehicles

    International Nuclear Information System (INIS)

    Wang, Wenhui; Zhang, Jiaolong; Lin, Yue; Ding, Fei; Chen, Zhenyu; Dai, Changsong

    2015-01-01

    The application of lithium ion batteries in plug-in hybrid electric vehicles (PHEVs) requires safety, high energy density, high power density, excellent cyclability and good low temperature performance. On the basis of thermally stable Li 3 V 2 (PO 4 ) 3 /C and cost-effective performance carbon additives, we designed a Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (PB stands for performance carbon additives PBX101) cathode that meets the above requirements for PHEVs battery. Firstly, its Ragone plot presents an excellent energy density retention at high power rates; secondly, the excellent capacity retention and high Coulombic efficiency of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB)-Li half-cell clearly indicates a potential good cyclability of full cells based on Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) cathode. Finally, we believe the good low temperature performance of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (i.e. retains 91.6% and 76.3% of its capacity at ∼25 °C, when cycled at 0 and -15 °C) is also beneficial to its application in PHEVs

  20. Dicty_cDB: FC-AA02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285

  1. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    DeTar, Carleton [P.I.

    2012-12-10

    This document constitutes the Final Report for award DE-FC02-06ER41446 as required by the Office of Science. It summarizes accomplishments and provides copies of scientific publications with significant contribution from this award.

  2. Final Report: DE- FC36-05GO15063, Fundamental Studies of Advanced High-Capacity, Reversible Metal Hydrides

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Craig [Univ. of Hawaii, Honolulu, HI (United States); McGrady, Sean [Univ. of New Brunswick, Fredericton NB (Canada); Severa, Godwin [Univ. of Hawaii, Honolulu, HI (United States); Eliseo, Jennifer [Univ. of Hawaii, Honolulu, HI (United States); Chong, Marina [Univ. of Hawaii, Honolulu, HI (United States)

    2013-05-31

    The project was component of the US DOE, Metal Hydride Center of Excellence (MHCoE). The Sandia National Laboratory led center was established to conduct highly collaborative and multi-disciplinary applied R&D to develop new reversible hydrogen storage materials that meet or exceed DOE/FreedomCAR 2010 and 2015 system targets for hydrogen storage materials. Our approach entailed a wide variety of activities ranging from synthesis, characterization, and evaluation of new candidate hydrogen storage materials; screening of catalysts for high capacity materials requiring kinetics enhancement; development of low temperature methods for nano-confinement of hydrides and determining its effects on the kinetics and thermodynamics of hydrides; and development of novel processes for the direct re-hydrogenation of materials. These efforts have resulted in several advancements the development of hydrogen storage materials. We have greatly extended the fundamental knowledge about the highly promising hydrogen storage carrier, alane (AlH3), by carrying out the first crystal structure determinations and the first determination of the heats of dehydrogenation of β–AlH3 and γ-AlD3. A low-temperature homogenous organometallic approach to incorporation of Al and Mg based hydrides into carbon aerogels has been developed that that allows high loadings without degradation of the nano-porous scaffold. Nano-confinement was found to significantly improve the dehydrogenation kinetics but not effect the enthalpy of dehydrogenation. We conceived, characterized, and synthesized a novel class of potential hydrogen storage materials, bimetallic borohydrides. These novel compounds were found to have many favorable properties including release of significant amounts of hydrogen at moderate temperatures (75-190 º C). However, in situ IR studies in tandem with thermal gravimetric analysis have shown that about 0.5 equivalents of diborane are released during the

  3. Multivalent Fcγ-receptor engagement by a hexameric Fc-fusion protein triggers Fcγ-receptor internalisation and modulation of Fcγ-receptor functions.

    Science.gov (United States)

    Qureshi, O S; Rowley, T F; Junker, F; Peters, S J; Crilly, S; Compson, J; Eddleston, A; Björkelund, H; Greenslade, K; Parkinson, M; Davies, N L; Griffin, R; Pither, T L; Cain, K; Christodoulou, L; Staelens, L; Ward, E; Tibbitts, J; Kiessling, A; Smith, B; Brennan, F R; Malmqvist, M; Fallah-Arani, F; Humphreys, D P

    2017-12-06

    Engagement of Fcγ-receptors triggers a range of downstream signalling events resulting in a diverse array of immune functions. As a result, blockade of Fc-mediated function is an important strategy for the control of several autoimmune and inflammatory conditions. We have generated a hexameric-Fc fusion protein (hexameric-Fc) and tested the consequences of multi-valent Fcγ-receptor engagement in in vitro and in vivo systems. In vitro engagement of hexameric-Fc with FcγRs showed complex binding interactions that altered with receptor density and triggered the internalisation and degradation of Fcγ-receptors. This caused a disruption of Fc-binding and phagocytosis. In vivo, in a mouse ITP model we observed a short half-life of hexameric-Fc but were nevertheless able to observe inhibition of platelet phagocytosis several days after hexameric-Fc dosing. In cynomolgus monkeys, we again observed a short half-life, but were able to demonstrate effective FcγR blockade. These findings demonstrate the ability of multi-valent Fc-based therapeutics to interfere with FcγR function and a potential mechanism through which they could have a sustained effect; the internalisation and degradation of FcγRs.

  4. Smart contracts sobre Bitcoin

    OpenAIRE

    Andreu Alemany, Josep Miquel

    2016-01-01

    El present treball final de màster realitza una introducció als smart contracts. El treball introdueix el concepte de contracte intel·ligent, els seus usos i alguns exemples existents. Seguidament proporciona les nocions necessàries de les transaccions del protocol Bitcoin per poder implementar un contracte intel·ligent, usant la blockchain que ofereix el protocol. Per últim, s'explica la implementació d'un contracte intel·ligent usant bitcoin: un canal de micropagaments. El presente traba...

  5. Optimization on Fc for Improvement of Stability and Aggregation Resistance.

    Science.gov (United States)

    Chen, Xiaobo; Zeng, Fang; Huang, Tao; Cheng, Liang; Liu, Huan; Gong, Rui

    2016-01-01

    Fc-based therapeutics including therapeutic full-size monoclonal antibodies (mAbs) and Fcfusion proteins represent fastest-growing market in biopharmaceutical industrial. However, one major challenge during development of Fc-based therapeutics is how to maintain their efficacy in clinic use. Many factors may lead to failure in final marketing. For example, the stability and aggregation resistance might not be high enough for bearing the disadvantages during fermentation, purification, formulation, storage, shipment and other steps in manufacture and sale. Low stability and high aggregation tendency lead to decreased bioactivity and increased risk of immunogenicity resulting in serious side effect. Because Fc is one of the major parts in monoclonal antibodies and Fc-fusion proteins, engineering of Fc to increase its stability and reduce or eliminate aggregation due to incorrect association are of great importance and could further extend the potential of Fc-based therapeutics. Lots of studies focus on Fc optimization for better physical and chemical characteristics and function by structured-based computer-aid rational design, high-throughput screening expression system selection and other methods. The identification of optimized Fc mutants increases the clinic potential of currently existed therapeutics mAbs and Fc-fusion proteins, and accelerates the development of new Fc-based therapeutics. Here we provide an overview of the related field, and discuss recent advances and future directions in optimization of Fc-based therapeutics with modified stability and aggregation resistance. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  6. 40 CFR Appendix C to Part 97 - Final Section 126 Rule: Trading Budget

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Final Section 126 Rule: Trading Budget... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Pt. 97, App. C Appendix C to Part 97Final Section 126 Rule: Trading Budget ST F126-EGU F126-NEGU Total DC 207 26...

  7. FACTORS INFLUENCING THE ACCURACY OF PRE-CONTRACT STAGE ESTIMATION OF FINAL CONTRACT PRICE IN NEW ZEALAND

    Directory of Open Access Journals (Sweden)

    Cong Ji

    2014-12-01

    Full Text Available Establishing and prioritising the factors that may influence the final contract price when responding to a call for tenders is crucial for proper risk analysis and reliable forecasting; it could make or mar the ability to achieve expected profit margin in an era of lump sum fixed price contracts where clients often contest variation claims. In New Zealand, these factors have not been researched; hence estimators rely only on judgement to ‘guess-estimate’ in their price forecasting. This study aimed to fill the knowledge gap by investigating the priority factors. 150 responses from professional members of the New Zealand Institute of Quantity Surveyors were analysed using multi-attribute method. Results showed thirty-seven factors which could influence the final contract price; the three most influential being poor tender documentation, complexity of design & construction, and completeness of project information. Other factors relating to project, client and contractor characteristics, design consultants and tendering conditions, estimating practice and external factors were reported. Concordance analysis indicated high level of agreement amongst survey participants in the rank-ordering of the relative importance of the identified factors. The findings could assist quantity surveyors to prepare more reliable contract price estimates at the pre-contract stage. It would also improve construction-stage cost control.

  8. Temporary labour contracts

    CERN Document Server

    2000-01-01

    The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L 021/PE, L 022/PE, L 023/PE and L 024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) reached the end of their initial three-year contractual period at the end of December 1999. At CERN?s request, in September 1999 the Finance Committee approved an extension of these contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs (CERN/FC/4196). In December 1999, one of the five contractors, FIRCROFT, withdrew from its contract for 2000. Following the satisfactory execution of the four remaining contracts during 2000, CERN requests approval to extend them from January 2001 for the second of the two optional years provided for in the original adjudication. The Finance Committee is invited to approve the extension of the existing contracts until 31 December 2001 for a total amount not exceeding 6 000 000 Swiss francs at 2000 prices.

  9. Thermal decomposition of FC(O)OCH3 and FC(O)OCH2CH3.

    Science.gov (United States)

    Berasategui, M; Argüello, G A; Burgos Paci, M A

    2018-05-09

    The thermal decomposition of methyl and ethyl formates has been extensively studied due to their importance in the oxidation of several fuels, pesticidal properties and their presence in interstellar space. We hitherto present the study of the thermal decomposition of methyl and ethyl fluoroformates, which could help in the elucidation of the reaction mechanisms. The reaction mechanisms were studied using FTIR spectroscopy in the temperature range of 453-733 K in the presence of different pressures of N2 as bath gas. For FC(O)OCH3 two different channels were observed; the unimolecular decomposition which is favored at higher temperatures and has a rate constant kFC(O)OCH3 = (5.3 ± 0.5) × 1015 exp[-(246 ± 10 kJ mol-1/RT)] (in units of s-1) and a bimolecular channel with a rate constant kFC(O)OCH3 = (1.6 ± 0.5) × 1011 exp[-(148 ± 10 kJ mol-1/RT)] (in units of s-1 (mol L)-1). However for ethyl formate, only direct elimination of CO2, HF and ethylene operates. The rate constants of the homogeneous first-order process fit the Arrhenius equation kFC(O)OCH2CH3 = (2.06 ± 0.09) × 1013 exp[-(169 ± 6 kJ mol-1/RT)] (in units of s-1). The difference between the mechanisms of the two fluoroformates relies on the stabilization of a six-centered transition state that only exists for ethyl formate. First principles calculations for the different channels were carried out to understand the dynamics of the decomposition.

  10. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  11. Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

    Directory of Open Access Journals (Sweden)

    Hye-Ji Choi

    Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

  12. Rapid desensitization of mice with anti-FcγRIIb/FcγRIII mAb safely prevents IgG-mediated anaphylaxis.

    Science.gov (United States)

    Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D

    2013-12-01

    Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.

  13. Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART

    Directory of Open Access Journals (Sweden)

    Flávio Areal Lemos

    2013-06-01

    Full Text Available INTRODUÇÃO: A frequência cardíaca (FC no teste anaeróbio máximo de corrida (MART expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON e de recuperação (FC OFF e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉTODOS: Foram voluntários 13 homens assintomáticos e fisicamente ativos, com 25,1 ± 4,9 anos, 76,8 ± 12,5 kg, 178,4 ± 9,0 cm e 50,6 ± 4,1 mL×kg‑1×min‑1. Na primeira visita, após a anamnese e medidas antropométricas, foi realizado um teste cardiopulmonar de exercício (TCPE com monitoração direta dos gases expirados. Na segunda visita, foi feita uma familiarização ao MART e na terceira, o teste de MART conduzido até a exaustão. RESULTADOS: A FC de recuperação (58 ± 20 bpm comparada à FC de pico alcançada no primeiro e no último estágio de MART (39 ± 14 bpm apresentou maior inclinação, resultando em maior amplitude de variação ao longo do teste, caracterizando diferenças significativas (P = 0,0017. A FC ON apresentou entre o momento inicial, meio e final do MART diferenças significativas (inicial versus final, p = 0,007. Para FC OFF foram encontradas diferenças significativas do início com o meio (p = 0,035 e do início com o final (p = 0,005 do teste. As correlações entre as variáveis cronotrópicas e de desempenho não apresentaram significância estatística (P < 0,05, assim como com as variáveis de desempenho. CONCLUSÃO: O MART parece ser um modelo de sobrecargas fisiológicas adequado para investigação da modulação autonômica cardíaca. Observou-se atuação do sistema parassimpático mesmo em cargas supramáximas até o final do teste.

  14. Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.

    Science.gov (United States)

    Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide

    2010-02-15

    The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.

  15. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 3, Appendix M, Contract Copies.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1992-01-01

    This report, is part of the final environmental impact statement of the Bonneville Power Administration, consists of an appendix of contract copies related to the following: Detailed Index to Generic Utility Power Sales Contracts, Text of Generic Utility Contract, Detailed Index to Generic DSI Power Sales Contracts, Text of Generic DSI Contract, Text of Residential Purchase and Sale Agreement (Residential Exchange), and Detailed Index to General Contract Provisions -- GCP Form PSC-2 (Incorporated into all three types of contracts as an Exhibit).

  16. FRACIONAMENTO DE PROTEÍNAS DE SILAGEM DE CAPIM-ELEFANTE EMURCHECIDO OU COM FARELO DE CACAU PROTEIN FRACTIONING OF SILAGE OF ELEPHANTGRASS WILTED OR WITH COCOA MEAL

    Directory of Open Access Journals (Sweden)

    Gleidson Giordano Pinto de Carvalho

    2008-10-01

    Full Text Available

    Desenvolveu-se o experimento para determinar as frações que compõem as proteínas da silagem de capim-elefante (Pennisetum purpureum Schum. cv. Camaroon submetido ao emurchecimento ou à adição de diferentes níveis de farelo de cacau. O capim-elefante utilizado foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos: capim-elefante emurchecido ao sol por oito horas, e capim-elefante sem emurchecimento com níveis de 0 %, 7 %, 14%, 21 % e 28 % de farelo de cacau (FC (% da matéria natural. Acondicionou-se o material em silos de PVC com capacidade para 5,3 litros, que foram abertos após 45 dias. Para todas as frações de proteínas estimadas, o tratamento emurchecido apresentou valores semelhantes (P>0,05 ao do tratamento sem emurchecimento. As frações protéicas foram influenciadas pelas adições de FC, verificando-se redução dos teores das frações A e B1+B2 e aumentos das frações B3 e C, para os níveis crescentes de FC.

    PALAVRAS-CHAVES: Conservação de forragens, forrageira, Pennisetum purpureum Schum. cv. Cameroon, subproduto, Theobroma cacao L.

    The experiment was conducted to determine the fractions that compose the protein of silage on the submitted elephant grass forage to wilting under the sun light for eight hours. Other treatments involved the same elephant grass without exposing to sun light but with addition of 0, 7, 14, 21, and 28% of cocoa meal (CM at the ensilage processing. The PVC silos used in the experiment were 5.3 liters in capacity, and were opened in 45 days. To all protein-estimated fractions, the wilted treatment showed similar values (P>.05 to the treatment without wilting. The protein fractions were influenced by CM addictions, verifying reduction in contents of A and B1+B2 fractions and increase in B3 and C fractions, with CM increasing levels

  17. Immunization with avian metapneumovirus harboring chicken Fc induces higher immune responses.

    Science.gov (United States)

    Paudel, Sarita; Easwaran, Maheswaran; Jang, Hyun; Jung, Ho-Kyoung; Kim, Joo-Hun; Shin, Hyun-Jin

    2016-07-15

    In this study, we evaluated the immune responses of avian metapneumovirus harboring chicken Fc molecule. Stable Vero cells expressing chicken Fc chimera on its surface (Vero-cFc) were established, and we confirmed that aMPV grown in Vero-cFc incorporated host derived chimera Fc into the aMPV virions. Immunization of chicken with aMPV-cFc induced higher level of antibodies and inflammatory cytokines; (Interferon (IFN)-γ and Interleukin (IL)-1β) compared to those of aMPV. The increased levels of antibodies and inflammatory cytokines in chicken immunized with aMPV-cFc were statistically significantly (p<0.05) to that of aMPV and control. The aMPV-cFc group also generated the highest neutralizing antibody response. After challenges, chickens immunized with aMPV-cFc showed much less pathological signs in nasal turbinates and trachea so that we could confirm aMPV-cFc induced higher protection than that of aMPV. The greater ability of aMPV harboring chicken Fc to that of aMPV presented it as a possible vaccine candidate. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Effects of microparticle size and Fc density on macrophage phagocytosis.

    Directory of Open Access Journals (Sweden)

    Patricia Pacheco

    Full Text Available Controlled induction of phagocytosis in macrophages offers the ability to therapeutically regulate the immune system as well as improve delivery of chemicals or biologicals for immune processing. Maximizing particle uptake by macrophages through Fc receptor-mediated phagocytosis could lead to new delivery mechanisms in drug or vaccine development. Fc ligand density and particle size were examined independently and in combination in order to optimize and tune the phagocytosis of opsonized microparticles. We show the internalization efficiency of small polystyrene particles (0.5 µm to 2 µm is significantly affected by changes in Fc ligand density, while particles greater than 2 µm show little correlation between internalization and Fc density. We found that while macrophages can efficiently phagocytose a large number of smaller particles, the total volume of phagocytosed particles is maximized through the non-specific uptake of larger microparticles. Therefore, larger microparticles may be more efficient at delivering a greater therapeutic payload to macrophages, but smaller opsonized microparticles can deliver bio-active substances to a greater percentage of the macrophage population. This study is the first to treat as independent variables the physical and biological properties of Fc density and microparticle size that initiate macrophage phagocytosis. Defining the physical and biological parameters that affect phagocytosis efficiency will lead to improved methods of microparticle delivery to macrophages.

  19. Corrosion rate of steel embedded in blended Portland and fluid catalytic cracking catalyst residue (FC3R cement mortars

    Directory of Open Access Journals (Sweden)

    Payá, J.

    2008-12-01

    Full Text Available This paper reports on a study of the corrosion levels in steel bars embedded in mortars made with a blend of Portland cement and (0-20% spent fluid catalytic cracking catalyst residue (FC3R, with a variable (0.3-0.7 water/binder (w/b ratio. The specimens were stored in the following conditions: relative humidity of 40, 80 or 100% and CO2 concentrations of 5 and 100%. The steel corrosion rate was measured with polarization resistance techniques. In the absence of aggressive agents, the steel was found to remain duly passivated in mortars with an FC3R content of up to 15% under all the conditions of relative humidity tested. The reinforcement corrosion level in mortars with a w/b ratio of 0.3 and 15% FC3R subjected to accelerated carbonation was similar to the level observed in the unblended Portland cement control mortar.En este trabajo se ha estudiado el nivel de corrosión de barras de acero embebidas en morteros de cemento Portland con relación agua/material cementante (a/mc variable (0,3-0,7, en los que parte del cemento (0-20% se sustituyó por catalizador de craqueo usado (FC3R. Las condiciones de conservación de las probetas elaboradas fueron las siguientes: distintas humedades relativas (40, 80 y 100% y dos concentraciones de CO2 (5 y 100%. La velocidad de corrosión de los aceros se midió mediante la técnica de resistencia de polarización. Se ha podido determinar que, bajo las distintas condiciones de humedad relativa y ausencia de agresivo, los aceros se mantuvieron correctamente pasivados en los morteros con contenidos de FC3R de hasta el 15%. El nivel de corrosión que presenta el refuerzo embebidos en morteros con sustitución de un 15% de cemento por FC3R y relación a/mc 0,3, al ser sometidos a un proceso de carbonatación acelerada, era muy similar al mostrado por el mortero patrón, sin FC3R.

  20. The neonatal Fc receptor, FcRn, as a target for drug delivery and therapy.

    Science.gov (United States)

    Sockolosky, Jonathan T; Szoka, Francis C

    2015-08-30

    Immunoglobulin G (IgG)-based drugs are arguably the most successful class of protein therapeutics due in part to their remarkably long blood circulation. This arises from IgG interaction with the neonatal Fc receptor, FcRn. FcRn is the central regulator of IgG and albumin homeostasis throughout life and is increasingly being recognized as an important player in autoimmune disease, mucosal immunity, and tumor immune surveillance. Various engineering approaches that hijack or disrupt the FcRn-mediated transport pathway have been devised to develop long-lasting and non-invasive protein therapeutics, protein subunit vaccines, and therapeutics for treatment of autoimmune and infectious disease. In this review, we highlight the diverse biological functions of FcRn, emerging therapeutic opportunities, as well as the associated challenges of targeting FcRn for drug delivery and disease therapy. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Final Report for Contract No. MDA903-85-C-0472

    National Research Council Canada - National Science Library

    Lewman, T

    2002-01-01

    .... Work was performed on site at ARI Presidio of Monterey (ARI-POM). This document, the final report for the contract, describes the results achieved during the contract, and provides a list of the products delivered...

  2. Acidentes de trabalho não fatais: diferenças de gênero e tipo de contrato de trabalho Non-fatal occupational injuries: gender and job contract differences

    Directory of Open Access Journals (Sweden)

    Vilma Santana

    2003-04-01

    Full Text Available No Brasil, trabalhadores sem vínculo formal de trabalho representam mais da metade da força de trabalho, cuja maioria é composta por mulheres. Neste estudo, estima-se a incidência anual de acidentes ocupacionais não fatais, e a sua distribuição por gênero e tipo de contrato de trabalho, em uma área urbana do Brasil. Dados provêm de um inquérito de base comunitária conduzido com uma amostra aleatória dos habitantes de Salvador, capital do Estado da Bahia. A população deste estudo compreende o total de pessoas entre 18 e 65 anos que referiram trabalho remunerado (n = 2.947. A coleta de dados baseada em entrevistas domiciliares individuais. A incidência anual de acidentes foi estimada em 5,80%, discretamente maior entre os homens (6,05% do que entre as mulheres (5,53%, ou entre trabalhadores sem contrato formal de trabalho (5,92% do que no grupo de comparação (5,67%, diferenças não estatisticamente significantes. A semelhança entre as freqüências de acidentes de trabalho entre mulheres e homens independentemente do tipo de contrato de trabalho apontam para a necessidade de maior atenção a estes eventos no sexo feminino, e entre os trabalhadores informais, amplamente ignorados nas estatísticas oficiais do país.In Brazil, workers without a formal job contract comprise more than half of the labor force, a contingent formed mainly by women. This study presents estimates of the annual incidence of non-fatal work-related injuries and their distribution by gender and type of job contract in an urban area of Brazil. This was a community-based study with a random cluster area sample of the inhabitants from the city of Salvador, capital of the State of Bahia. The study population included all individuals from 18 to 65 years of age who reported having a paid job (n = 2,947. Data were obtained through individual household interviews. The overall estimated annual incidence rate was 5.80%, with a non-statistically significant

  3. Influência do nível de performance na estratégia de ritmo de corrida em prova de 10 km de corredores recreacionais

    Directory of Open Access Journals (Sweden)

    Francisco de Assis MANOEL

    2015-09-01

    Full Text Available ResumoO objetivo do estudo foi verificar a influência do nível de performance na estratégia de ritmo de corrida de corredores recreacionais. Adicionalmente, objetivou-se descrever o comportamento da frequência cardíaca (FC obtida em prova de 10 km em pista de atletismo. Participaram 39 corredores recreacionais (31,5 ± 6,7 anos, experientes em provas de 10 km que realizaram uma performance nesta distância em pista de atletismo (400 m. A FC foi constantemente monitorada (Polar RS800 e o tempo a cada 400 m foi registrado para determinação da velocidade média (VM, posteriormente analisada a cada 2 km. Os participantes foram divididos em dois grupos de acordo com a VM alcançada nos testes: G1 = VM 10 km ≤ 11,81 (n = 20 e G2 = VM 10 km > 11,81 (n = 19. A comparação entre os valores de VM e FC obtidos nos diferentes momentos da performance para os dois grupos foi realizada pela Anova mista, adotando-se nível de significância de p < 0,05. Os valores de VM foram diferentes entre os grupos em todos os momentos analisados, com aumento significante da VM do momento 6-8 km para 8-10 km para o mesmo grupo. Os valores de FC foram diferentes apenas intra-grupos. No G1, houve aumento significante da FC a cada 2 km de prova. Para o G2, a FC aumentou do 2º ao 4º km e permaneceu estável até o 8º km, aumentando novamente nos últimos 2 km da performance. Concluímos que o nível de performance não influencia a estratégia de corrida de corredores recreacionais.

  4. Advanced power conversion based on the Aerocapacitor{trademark}. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Roark, D.

    1997-03-05

    This report summarizes work performed under contract No. DE-FC07-94ID13283, {open_quotes}Advanced Power Conversion Based on the Aerocapacitors{trademark}.{close_quotes} Under this contract high power density, high energy density, organic electrolyte Aerocapacitors{trademark} were developed and characterized for power conversion applications. Pilot facilities for manufacturing prototype AA-size Aerocapacitors{trademark} were put in place. The low ESR and good frequency response of these devices show that they are ideal components for high discharge rate and low to moderate frequency (< 10 kHz) applications such as power conversion.

  5. Sustaining the Productivity and Function of Intensively Managed Forests - Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Burger, James A.; Xu, Yi-Jun

    2001-03-23

    The main goal of this study is to ensure sustainable management of wetland forests in the southeastern United States. The study is projected to measure soil, hydrology, and forest responses to several management scenarios across a complete forest cycle. From August 1997 to August 2000 the study has received funding as one of the Agenda 2020 projects, from the U.S. Department of Energy (Cooperative Agreement Number DE-FC07-97ID13551), the National Council of the Paper Industry for Air and Stream Improvement, and Westvac Corporation. Quarterly progress reports were submitted regularly to the Department and all project participants. This final report summarizes the project results and progress achieved during this 3-year period. Over the past three years all research objectives planned for this project were completed.

  6. Comparison of the Fc fragment from a human IgG1 and its CH2, pFc', and tFc' subfragments. A study using reductive methylation and 13C NMR

    International Nuclear Information System (INIS)

    Jentoft, J.E.; Rayford, R.

    1989-01-01

    The Fc fragment of a human monoclonal IgG1 was compared with subfragments containing (a) the intact CH2 domain (CH2 fragment) or (b) the intact CH3 domain (pFc' and tFc' fragments). All fragments were reductively 13 C-methylated and their resulting dimethyllysyl resonances characterized in 0.1 M KCl as a function of pH by 13 C NMR spectroscopy. Seven resonances were characterized for the 18 lysine residues of the Fc fragment, eight for the 12 lysines of the CH2 fragment, and five each for the 9 lysines of the pFc' and the 6 lysines of the tFc' fragments, respectively. The multiplicity of resonances indicates that the lysine residues in each fragment exist in a variety of microenvironments and that the fragments are all highly structured. The correspondence between 6 of the 12 or 13 perturbed lysine residues in the Fc fragment and the smaller subfragments indicates that the conformation of the CH2 and CH3 domains is largely unchanged in the smaller fragments. However, in addition to three lysines at the CH2-CH3 domain interface, whose environments were known to be disrupted in the smaller fragments, three or four lysine residues have somewhat different properties in the Fc fragment and in the subfragments, indicating that some local perturbations are included in the domain structure in the subfragments

  7. Contracts Take or Pay, for supply and transport of gas

    International Nuclear Information System (INIS)

    Velasquez Bermudez, Jesus Maria

    2000-01-01

    The present article has as objective to study the effect that has the contract of supply and of transport of gas that subscribe generators agents of the electric sector with the agents of the market of the gas. The article concentrates on the study of the denominated contracts take or pay. Initially the modeling is analyzed to include the effect of the contracts of gas in the mathematical models that are used to support the works of planning. Later on is studied of optimal form to determining the prices in spot markets of the industries associated to the contracts. Finally is presented the methodology and controlled experiments that allow to identify and to quantify the macro economic effect of the contracts

  8. 48 CFR 53.301-1437 - Settlement Proposal for Cost-Reimbursement Type Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Settlement Proposal for Cost-Reimbursement Type Contracts. 53.301-1437 Section 53.301-1437 Federal Acquisition Regulations...-1437 Settlement Proposal for Cost-Reimbursement Type Contracts. ER09DE97.012 [62 FR 64951, Dec. 9, 1997] ...

  9. Positron emission tomography/computed tomographic and magnetic resonance imaging in a murine model of progressive atherosclerosis using (64)Cu-labeled glycoprotein VI-Fc.

    Science.gov (United States)

    Bigalke, Boris; Phinikaridou, Alkystis; Andia, Marcelo E; Cooper, Margaret S; Schuster, Andreas; Schönberger, Tanja; Griessinger, Christoph M; Wurster, Thomas; Onthank, David; Ungerer, Martin; Gawaz, Meinrad; Nagel, Eike; Botnar, Rene M

    2013-11-01

    Plaque erosion leads to exposure of subendothelial collagen, which may be targeted by glycoprotein VI (GPVI). We aimed to detect plaque erosion using (64)Cu-labeled GPVI-Fc (fragment crystallized). Four-week-old male apolipoprotein E-deficient (ApoE(-/-)) mice (n=6) were fed a high-fat diet for 12 weeks. C57BL/6J wild-type (WT) mice served as controls (n=6). Another group of WT mice received a ligation injury of the left carotid artery (n=6) or sham procedure (n=4). All mice received a total activity of ≈12 MBq (64)Cu-GPVI-Fc by tail vein injection followed by delayed (24 hours) positron emission tomography using a NanoPET/computed tomographic scanner (Mediso, Hungary; Bioscan, USA) with an acquisition time of 1800 seconds. Seventy-two hours after positron emission tomography/computed tomography, all mice were scanned 2 hours after intravenous administration of 0.2 mmol/kg body weight of a gadolinium-based elastin-specific MR contrast agent. MRI was performed on a 3-T clinical scanner (Philips Healthcare, Best, The Netherlands). In ApoE(-/-) mice, the (64)Cu-GPVI-Fc uptake in the aortic arch was significantly higher compared with WT mice (ApoE(-/-): 13.2±1.5 Bq/cm(3) versus WT mice: 5.1±0.5 Bq/cm(3); P=0.028). (64)Cu-GPVI-Fc uptake was also higher in the injured left carotid artery wall compared with the intact right carotid artery of WT mice and as a trend compared with sham procedure (injured: 20.7±1.3 Bq/cm(3) versus intact: 2.3±0.5 Bq/cm(3); P=0.028 versus sham: 12.7±1.7 Bq/cm(3); P=0.068). Results were confirmed by ex vivo histology and in vivo MRI with elastin-specific MR contrast agent that measures plaque burden and vessel wall remodeling. Higher R1 relaxation rates were found in the injured carotid wall with a T1 mapping sequence (injured: 1.44±0.08 s(-1) versus intact: 0.91±0.02 s(-1); P=0.028 versus sham: 0.97±0.05 s(-1); P=0.068) and in the aortic arch of ApoE(-/-) mice compared with WT mice (ApoE(-/-): 1.49±0.05 s(-1) versus WT: 0.92±0.04 s

  10. Final Report on the Audit of the Administration of the Contract Closeout Process at the Defense Contract Management Region, Dallas

    Science.gov (United States)

    1990-09-18

    This is our final report on the Audit of the Administration of the Contract Closeout Process at the Defense Contract Management Region, Dallas (DCMR... audit was made from January to October 1989. The objectives of the audit were to determine the timeliness of the contract closeout process, the validity...As part of the audit , we also evaluated internal controls over the contract closeout process. As of December 31, 1988, the Contract Administration

  11. A Scientific Calculator for Exact Real Number Computation Based on LRT, GMP and FC++

    Directory of Open Access Journals (Sweden)

    J. A. Hernández

    2012-03-01

    Full Text Available Language for Redundant Test (LRT is a programming language for exact real number computation. Its lazy evaluation mechanism (also called call-by-need and its infinite list requirement, make the language appropriate to be implemented in a functional programming language such as Haskell. However, a direction translation of the operational semantics of LRT into Haskell as well as the algorithms to implement basic operations (addition subtraction, multiplication, division and trigonometric functions (sin, cosine, tangent, etc. makes the resulting scientific calculator time consuming and so inefficient. In this paper, we present an alternative implementation of the scientific calculator using FC++ and GMP. FC++ is a functional C++ library while GMP is a GNU multiple presicion library. We show that a direct translation of LRT in FC++ results in a faster scientific calculator than the one presented in Haskell.El lenguaje de verificación redundante (LRT, por sus siglas en inglés es un lenguaje de programación para el cómputo con números reales exactos. Su método de evaluación lazy (o mejor conocido como llamada por necesidad y el manejo de listas infinitas requerido, hace que el lenguaje sea apropiado para su implementación en un lenguaje funcional como Haskell. Sin embargo, la implementación directa de la semántica operacional de LRT en Haskell así como los algoritmos para funciones básicas (suma, resta, multiplicación y división y funciones trigonométricas (seno, coseno, tangente, etc hace que la calculadora científica resultante sea ineficiente. En este artículo, presentamos una implementación alternativa de la calculadora científica usando FC++ y GMP. FC++ es una librería que utiliza el paradigma Funcional en C++ mientras que GMP es una librería GNU de múltiple precisión. En el artículo mostramos que la implementación directa de LRT en FC++ resulta en una librería más eficiente que la implementada en Haskell.

  12. The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?

    Directory of Open Access Journals (Sweden)

    David Finnie

    2015-11-01

    Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kepts in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.

  13. The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?

    Directory of Open Access Journals (Sweden)

    David Finnie

    2015-11-01

    Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kept in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.

  14. Brain Functional Connectivity is Different during VoluntaryConcentric and Eccentric Muscle Contraction

    Directory of Open Access Journals (Sweden)

    Wan X Yao

    2016-11-01

    Full Text Available Previous studies report greater activation in the cortical motor network in controlling eccentric contraction (EC than concentric contraction (CC of human skeletal muscles despite lower activation level of the muscle associated with EC. It is unknown, however, whether the strength of functional coupling between the primary motor cortex (M1 and other involved areas in the brain differs as voluntary movements are controlled by a network of regions in the primary, secondary and association cortices. Examining fMRI-based functional connectivity (FC offers an opportunity to measure strength of such coupling. To address the question, we examined functional MRI (fMRI data acquired during EC and CC (20 contractions each with similar movement distance and speed of the right first dorsal interosseous (FDI muscle in 11 young (20-32 years and healthy individuals and estimated FC between the M1 and a number of cortical regions in the motor control network. The major findings from the behavioral and fMRI-based FC analysis were that (1 no significant differences were seen in movement distance, speed and stability between the EC and CC; (2 significantly stronger mean FC was found for CC than EC. Our finding provides novel insights for a better understanding of the control mechanisms underlying voluntary movements produced by EC and CC. The finding is potentially helpful for guiding the development of targeted sport training and/or therapeutic programs for performance enhancement and injury prevention.

  15. SILAGE OF HIGH MOISTURE GRAIN AND DRY GRAIN OF SORGHUM AS ENERGETIC SOURCE FOR FEMALE CALVES FROM TWO GENETIC GROUPS SILAGEM DE GRÃO ÚMIDO OU GRÃO SECO DE SORGO COMO FONTE ENERGÉTICA PARA BEZERRAS DE DOIS GRUPOS GENÉTICOS

    Directory of Open Access Journals (Sweden)

    João Restle

    2009-12-01

    Full Text Available The performance and development of Charolais (CH and 5/8Nellore 3/8Charolais (5/8NC female calves, feedlot fed with silage of high moisture grain or dry grain of sorghum, were evaluated. The roughage (corn silage:concentrate ratio was 60:40, dry matter (DM basis. Calves average initial weight and age was 96.9±8.5kg and five months. The experimental design was complete randomized, with a 2 x 2 factorial arrangement (types of sorghum grains conservation x genetic groups. No significant interaction was observed between type of sorghum grain conservation and genetic group, for the variables studied. No difference (P>.05 was observed between high moisture and dry grain for daily intake of DM (DMI 3.83 and 3.84 kg DM/day, and digestible energy (DEI 14.59 and 14.92 Mcal/day, respectively. Average daily weight gain (ADW .80 and .83 kg, final weight (FW 165.0 and 166.5 kg, and feed conversion (FC 4.78 and 4.63, were similar for high moisture and dry grain sorghum, respectively. Calves growth parameters according to sorghum grains conservation did not differ (P>.05. The gain of body condition (GBC was higher (P<.05 for the treatment of high moisture grain (.33 points in comparison to dry grain (.22 points. No difference (P>.05 was observed between genetic groups for DMI, DEI, ADW, FC and FW. The 5/8NC compared to the CH calves showed higher (P<.05 final body condition score (3.1 vs 3.0 points, initial (91.12 vs 83.62 cm and final withers height (102.62 vs 94.84 cm and initial (99.37 vs 89.69 cm and final rump height (108.87 vs 101.37 cm. The CH calves had higher (P<.05 thoracic perimeter (24.94 vs 20.56 cm.


    KEY WORDS: Average daily weight gain, crossbreeding, rump height, withers height, thoracic perimeter.

    Avaliaram-se o desempenho e o desenvolvimento corporal de bezerras Charolês (CH e 5/8Nelore 3/8Charolês (5/8NC, alimentadas em confinamento com silagem de grão úmido ou seco de sorgo. A rela

  16. FcγRll: Characterisation of novel Fc receptor interactions and a new receptor form.

    OpenAIRE

    JESSICA CLAIRE ANANIA

    2018-01-01

    Leukocyte Fc receptors (FcR) bind to immunogloulins (Ig) to link the innate and humoral immune system to help balance the immune system and clear infections. We have characterised a novel FcR for IgG (FcγR) form, designated FcγRIIa3, which contains a 19 amino acid insert. This insert interacts with cytoskeletal structures allowing the receptor to be retained for longer periods of time at the cells surface upon activation, higher cell signalling which causes greater cellular activation. Theref...

  17. Human FcγRIIA induces anaphylactic and allergic reactions.

    Science.gov (United States)

    Jönsson, Friederike; Mancardi, David A; Zhao, Wei; Kita, Yoshihiro; Iannascoli, Bruno; Khun, Huot; van Rooijen, Nico; Shimizu, Takao; Schwartz, Lawrence B; Daëron, Marc; Bruhns, Pierre

    2012-03-15

    IgE and IgE receptors (FcεRI) are well-known inducers of allergy. We recently found in mice that active systemic anaphylaxis depends on IgG and IgG receptors (FcγRIIIA and FcγRIV) expressed by neutrophils, rather than on IgE and FcεRI expressed by mast cells and basophils. In humans, neutrophils, mast cells, basophils, and eosinophils do not express FcγRIIIA or FcγRIV, but FcγRIIA. We therefore investigated the possible role of FcγRIIA in allergy by generating novel FcγRIIA-transgenic mice, in which various models of allergic reactions induced by IgG could be studied. In mice, FcγRIIA was sufficient to trigger active and passive anaphylaxis, and airway inflammation in vivo. Blocking FcγRIIA in vivo abolished these reactions. We identified mast cells to be responsible for FcγRIIA-dependent passive cutaneous anaphylaxis, and monocytes/macrophages and neutrophils to be responsible for FcγRIIA-dependent passive systemic anaphylaxis. Supporting these findings, human mast cells, monocytes and neutrophils produced anaphylactogenic mediators after FcγRIIA engagement. IgG and FcγRIIA may therefore contribute to allergic and anaphylactic reactions in humans.

  18. 48 CFR 1819.7302 - NASA contract clauses.

    Science.gov (United States)

    2010-10-01

    ... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...

  19. Types of contracts and contracting procedures

    International Nuclear Information System (INIS)

    Zijl, N.A. van

    1977-01-01

    Contracting for a nuclear power plant can be carried out in many different ways, from a bilateral agreement between two countries to an international open bidding competition. Also the kind of contracts (turnkey, split-package or multi-contract type) are discussed with their pros and cons as well as the contracting procedures which can be followed to come to the conclusion of a contract. (orig.) [de

  20. Farinha de resíduos da filetagem de tilápia em rações para alevinos de piauçu (Leporinus macrocephalus Effects of feeding tilapia by-products flour for piauçu (Leporinus macrocephalus fingerlings

    Directory of Open Access Journals (Sweden)

    Wilson Rogério Boscolo

    2005-12-01

    Full Text Available Este experimento foi realizado com o objetivo de avaliar o efeito da inclusão de farinha de resíduos da industrialização de tilápia (FT na alimentação de alevinos de piauçu (Leporinus macrocephalus. Cento e vinte e cinco alevinos com peso e comprimento iniciais de 0,19 ± 0,004 g e 2,37 ± 0,2 cm foram distribuídos em delineamento inteiramente casualizado, com cinco tratamentos e cinco repetições. As rações testadas continham 0; 5; 10 e 15% de FT e 0% de FT suplementada com metionina. O arraçoamento foi de 10% da biomassa quatro vezes ao dia (8, 11, 14 e 17 h. As médias dos parâmetros físico-químicos da água foram 7,89 ± 0,05, 89,93 ± 0,42, 7,15 ± 0,10 e 27,10 ± 0,95 para pH, condutividade elétrica (µS.cm-1, oxigênio dissolvido (mg.L-1 e temperatura (ºC, respectivamente. Ao final do período experimental, foram avaliadas as médias de sobrevivência (SO, peso final (PF, comprimento final (CF, ganho de peso (GP, fator de condição (FC e conversão alimentar aparente (CA. Foram observadas diferenças quanto ao CF, CA e FC entre tratamentos, obtendo-se melhores resultados naqueles com inclusão de FT e suplementação de metionina. O CF apresentou aumento linear com platô em 8,56% de FT e a CA apresentou redução linear com platô de 8,19% de inclusão de FT. Os maiores teores de proteína bruta (PB na carcaça foram obtidos nos tratamentos com mais de 5% de FT e 0% de FT suplementado com metionina. Pode-se incluir até 15% de FT em rações para alevinos de piauçu, melhorando seu desempenho e deposição de PB na carcaça, o que torna a FT uma fonte protéica alternativa.This trial was carried out to evaluate the effects of feeding Tilapia fillet by-products meal (TF for piauçu (Leporinus macrocephalus fingerlings. One hundred and twenty-five fingerlings averaging weight of 0.19 ± 0.004 g and length of 2.37 ± 0.28 cm were assigned to a completely randomized design with five treatments of five replicates. The diets

  1. Final Report- "An Algorithmic and Software Framework for Applied Partial Differential Equations (APDEC): A DOE SciDAC Integrated Software Infrastructure Center (ISIC)

    Energy Technology Data Exchange (ETDEWEB)

    Elbridge Gerry Puckett

    2008-05-13

    this he had been a Deputy Section Head at the National Center for Atmospheric Research in Colorado. My understanding is that Chris Algieri is the first person that Bill hired after coming to LBNL. The plan is that Chris Algieri will finish his PhD thesis while employed as a staff scientist in Bill's group. Both Sarah and Chris were supported in part with funds from DE-FC02-01ER25473. In Sarah's case she received support both while at U.C. Davis (UCD) taking classes and writing an MS thesis and during some of the time she was living in Berkeley, working at LBNL and finishing her PhD thesis. In Chris' case he was at U.C. Davis during the entire time he received support from DE-FC02-01ER25473. More specific details of their work are included in the report below. Finally my own research conducted under the auspices of DE-FC02-01ER25473 either involved direct collaboration with researchers at LBNL - Phil Colella and Peter Schwartz who is a member of Phil's Applied Numerical Algorithms Group - or was on problems that are closely related to research that has been and continues to be conducted by researchers at LBNL. Specific details of this work can be found below. Finally, I would like to note that the work conducted by my students and me under the auspices of this contract is closely related to work that I have performed with funding from my DOE MICS contract DE-FC02-03ER25579 'Development of High-Order Accurate Interface Tracking Algorithms and Improved Constitutive Models for Problems in Continuum Mechanics with Applications to Jetting' and with my CoPI on that grant Professor Greg Miller of the Department of Applied Science at UCD. In theory I tried to use funds from the SciDAC grant DE-FC02-01ER25473 to support work that directly involved implementing algorithms developed by my research group at U.C. Davis in software that was developed and is maintained by my SciDAC CoPI's at LBNL.

  2. Advances in therapeutic Fc engineering - modulation of IgG associated effector functions and serum half-life

    Directory of Open Access Journals (Sweden)

    Abhishek Saxena

    2016-12-01

    Full Text Available Today monoclonal immunoglobulin gamma (IgG antibodies have become a major option in cancer therapy especially for the patients with advanced or metastatic cancers. Efficacy of monoclonal antibodies (mAbs are achieved through both its antigen binding fragment (Fab and crystallizable fragment (Fc. Fab can specifically recognize tumor associated antigen (TAA and thus modulate TAA-linked downstream signaling pathways that may lead to inhibition of tumor growth, induction of tumor apoptosis and differentiation. The Fc region can further improve mAbs’ efficacy by mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC, complement-dependent cytotoxicity (CDC and antibody dependent cell-mediated phagocytosis (ADCP. Moreover, Fc is the region interacting with the neonatal Fc receptor (FcRn in a pH-dependent manner that can slow down IgG’s degradation and extend its serum half-life. Loss of the antibody Fc region dramatically shortens its serum half-life and weakens its anti-cancer effects. Given the essential roles that the Fc region plays in the modulation of the efficacy of mAb in cancer treatment, Fc engineering has been extensively studied in the past years. This review focuses on the recent advances in therapeutic Fc engineering that modulates its related effector functions and serum half-life. We also discuss the progress made in aglycosylated mAb development that may substantially reduce cost of manufacture but maintain similar efficacies as conventional glycosylated mAb. Finally, we highlight several Fc engineering based mAbs under clinical trials.

  3. Endurance race equines performance fed diets with oil levels Desempenho de equinos submetidos a enduro alimentados com níveis de óleo de soja na dieta

    Directory of Open Access Journals (Sweden)

    José Correa de Lacerda Neto

    2009-06-01

    Full Text Available In order to study the endurance equine performance, experimental diets composed by five increasing soybean oil levels (control, 6, 12, 18, 24% of the concentrate were given. The following variables were analyzed: lactate concentration (LA, Glucose (GL, Cardiac frequency (FC and rectal temperature (TR. Twenty Arabian horses were used, 9.5 ±5.5 years old, weight 400 ± 30 kg, undergone to an 80 Km endurance race simulation in a treadmill. The endurance was divided in four rings (phases with 20 km each. There was no effect (p>0.05 of the oil addition but there was an effect (P<0.05 of distance on the LA, TR, GL variables. For the FC variable, we observed the effect (p<0.05 of the soybean addition and the distance. The soybean oil addition upper than 6% in the concentrate maintained lower the cardiac frequency, favoring the endurance horse performance. This lower cardiac frequency could suggest that animal lasted longer time in aerobic metabolism, situation that was confirmed by the non exponential increase in the lactate concentration and the increase in the glucose concentration. The oil favored the endurance horse performance.Com o objetivo de estudar o desempenho de cavalos de enduro, foram fornecidas dietas compostas por cinco níveis crescentes de óleo de soja (controle – sem adição de óleo, 6, 12, 18 e 24% do concentrado. As seguintes variáveis foram analisadas: concentração de lactato sangüíneo (LA, glicemia (GL, freqüência cardíaca (FC e temperatura retal (TR. Foram utilizados 20 eqüinos da raça Árabe, idades 9,5 ±5,5 anos, pesos de 400 ± 30 kg, submetidos à simulação de prova de enduro de 80 km em esteira rolante. O enduro foi dividido em quatro anéis (fases de 20 km cada. Não foi observado efeito (p>0,05 da adição de óleo de soja, porém observou-se efeito (p<0,05 da distância percorrida sobre as variáveis LA, TR e GL. Para a variável FC foi observado efeito (p<0,05 da distância percorrida bem como da adi

  4. Efeitos de um programa de hidroterapia na pressão arterial e freqüência cardíaca de mulheres idosas sedentárias Effects of a hidrotherapy program on blood pressure and heart rate in elderly, sedentary women

    Directory of Open Access Journals (Sweden)

    Juliana Monteiro Candeloro

    2008-01-01

    Full Text Available Este estudo visou analisar as conseqüências cardiocirculatórias (na pressão arterial, PA, e freqüência cardíaca, FC de um programa de hidroterapia cujo objetivo clínico era ganho de força muscular e flexibilidade para mulheres idosas saudáveis e sedentárias. Participaram 16 idosas, de 65 a 70 anos. O programa constou de 32 sessões, com uma hora de duração cada, de exercícios em imersão para ganho de força muscular e flexibilidade, com grau de dificuldade crescente, em sete fases. As quatro primeiras sessões foram usadas para adaptação ao meio aquático e desconsideradas para coleta de dados. As medidas de PA e FC foram coletadas ao final de cada fase, em quatro momentos: repouso fora da água, em repouso 3 minutos após imersão, em imersão ao final dos exercícios, e três minutos após a saída da piscina. Os dados foram analisados estatisticamente com nível de significância a pThis study aimed at analysing cardiocirculatory effects (on blood pressure, BP, and heart rate, HR of a hydrotherapy program of which the purpose was to increase muscle force and flexibility of 16 sedentary, healthy, 65-to-70 year-old women. The program consisted of 32 1-hour sessions of strength and flexibility training exercises, with increasing degree of difficulty in seven phases. The first four sessions were used for adaptation to the aquatic environment and the respective data were not considered. BP and HR were monitored at the end of each phase in four different moments: at rest before diving, at rest 3 minutes after immersion, still immerged at the end of exercises, and at rest, 3 minutes after exiting the pool. Collected measures were statistically analysed, and significance level set at p<0.05. Results show significant mean at-rest systolic BP decrease of 5.6 mmHg, and mean at-rest diastolic BP decrease of 9.7 mmHg, from the 5th (base session to the 32nd (last session; participants' BP classification turned from threshold-normal to

  5. Fc-mediated immune precipitation. III. Visualization by electron microscopy

    DEFF Research Database (Denmark)

    Møller, NPH; Christiansen, Gunna

    1983-01-01

    with either rabbit anti-KLH IgG or anti-KLH F(ab')2 fragments. The Fc-Fc interactions were investigated by reacting these surface-adsorbed antibody-rich KLH immune complexes with soluble, antigen-rich ferritin-anti-ferritin complexes using either rabbit anti-ferritin IgG or the corresponding isomolar F(ab')2...... fragments as antibody. Fc-Fc interactions were indicated by the formation of clusters or ring structures of ferritin molecules, which were only seen when using KLH anti-KLH IgG and ferritin-anti-ferritin IgG complexes. When F(ab')2 fragments were used as antibody, no reaction between KLH anti-KLH complexes...

  6. INTENSIDAD DE LA MUSICA: EFECTO SOBRE LA FRECUENCIA CARDIACA Y EL ESFUERZO PERCIBIDO DURANTE LA ACTIVIDAD FISICA

    Directory of Open Access Journals (Sweden)

    Jorge Marín Hernández

    2001-12-01

    Full Text Available La música ha sido ampliamente utilizada en la práctica de ejercicios aeróbicos en la industria deportiva. El propósito de este estudio fue comparar el efecto de diferentes intensidades de la música sobre la frecuencia cardiaca (FC y el esfuerzo percibido (EP durante ejercicio estandarizado en un cicloergómetro. 13 hombres y 5 mujeres voluntarios, físicamente activos (edad 20.6 ± 2.2 años realizaron una prueba bajo tres condiciones en diferentes días, asignadas en un diseño contrabalanceado de medidas repetidas: no música (NM, música a 70 dB, (M70 y música a 85 dB (M85. Ellos se ejercitaron por 20 min. con una carga de trabajo constante predeterminada y equivalente al 80% de su FCMax (kp = 1.47 ± 0.4, 90 rev/min. La música utilizada fue del tipo 'Merengue House' en español con un tempo de 131 ± 4.30 bpm, las diferentes intensidades fueron calibradas con un sonómetro. La FC y el EP fueron registrados a los 10 y 20 min. con un monitor de FC Polar y la escala EP-15 de Borg. Prueba FC 10 min. FC 20 min. EP 10 min. EP 20 min. NM 164.78 ± 8.37 172.11 ± 8.54 12.06 ±1.92 13.78 ±2.58 M70 165.11 ±11.16 173.00 ±12.05 12.00 ±2.11 13.56 ±2.89 M85 163.00 ± 7.58 170.17 ± 7.87 11.50 ±1.55 12.94 ±2.07 Tanto para FC como para EP un ANOVA 3 x 2 con medidas repetidas indicó que los promedios a los 20 min. fueron significativamente mayores que a los 10 min. (p<0.05. Las diferencias en FC y EP entre las tres condiciones no fueron significativas (p >0.05. Los resultados indican que los rangos de intensidades de música estudiados M70 y M85 no produjeron un efecto sobre el EP y la FC cuando se realizó ejercicio estandarizado en un cicloergómetro comparado con una condición sin música NM.

  7. 24 CFR 983.206 - HAP contract amendments (to add or substitute contract units).

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract amendments (to add or... Contract § 983.206 HAP contract amendments (to add or substitute contract units). (a) Amendment to substitute contract units. At the discretion of the PHA and subject to all PBV requirements, the HAP contract...

  8. Influência do uso do forno de microondas ou convencional na síntese de ZrO2 Influence of the use of microwave oven or conventional furnace on the synthesis of ZrO2

    Directory of Open Access Journals (Sweden)

    V. dos Santos

    2008-12-01

    Full Text Available O presente trabalho tem como objetivo descrever a síntese de óxido de zircônio, variando as condições de síntese com o uso de forno convencional (FC ou forno de microondas (FM, através do método Pechini. As características estruturais dos óxidos sintetizados foram determinadas por difração de raios X, infravermelho e análises térmicas. As propriedades morfológicas foram determinadas por microscopia eletrônica de varredura com emissão de campo e por isotermas de adsorção/desorção. O uso de FM ou FC, ou o uso de ambos para um mesmo óxido (FM + FC ou FC + FM apresentaram uma grande influência sobre o grau de cristalinidade dos materiais sintetizados.The present work deals with the synthesis of zirconium oxide under varying conditions of synthesis using conventional furnace (CF or microwave oven (MO, by the Pechini method. This study was carried out with the primary aim of studying the possible influence of the above parameters as synthesis variables on the structural and morphologic properties of ZrO2. The structural characteristics of the synthesized oxides were determined by X-ray diffractio, infrared and thermal analysis. The morphologic properties were determined by FEG-SEM and isothermal gas adsorption/desorption. The use of MO or CF, or both for the same oxide (MO+CF or CF+MO has great influence on the degree of crystallinity of the synthesized materials.

  9. 46 CFR 9.7 - Rate for Sunday or holiday services.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Rate for Sunday or holiday services. 9.7 Section 9.7... COMPENSATION FOR OVERTIME SERVICES § 9.7 Rate for Sunday or holiday services. The rate of extra compensation for Sunday or holiday services is hereby fixed at twice the gross daily rate of regular pay of the...

  10. Field flow fractionation for assessing neonatal Fc receptor and Fcγ receptor binding to monoclonal antibodies in solution.

    Science.gov (United States)

    Pollastrini, Joey; Dillon, Thomas M; Bondarenko, Pavel; Chou, Robert Y-T

    2011-07-01

    Analysis of the strength and stoichiometry of immunoglobulin G (IgG) binding to neonatal Fc receptor (FcRn) and Fcγ receptor (FcγR) is important for evaluating the pharmacokinetics and effector functions of therapeutic monoclonal antibody (mAb) products, respectively. The current standard for assessing FcγR and FcRn binding is composed of cell-based and surface plasmon resonance (SPR) assays. In this work, asymmetrical flow field flow fractionation (AF4) was evaluated to establish the true stoichiometry of IgG binding in solution. AF4 and liquid chromatography-mass spectrometry (LC-MS) were applied to directly observe IgG/FcγR and IgG/FcRn complexes, which were not observed using nonequilibrium size exclusion chromatography (SEC) analysis. Human serum albumin (HSA), an abundant component of human blood and capable of binding FcRn, was studied in combination with FcRn and IgG. AF4 demonstrated that the majority of large complexes of IgG/FcRn/HSA were at an approximate 1:2:1 molar ratio. In addition, affinity measurements of the complex were performed in the sub-micromolar affinity range. A significant decrease in binding was detected for IgG molecules with increased oxidation in the Fc region. AF4 was useful in detecting weak binding between full-length IgG/Fc fragments and Fc receptors and the effect of chemical modifications on binding. AF4 is a useful technique in the assessment of mAb product quality attributes. Copyright © 2011 Elsevier Inc. All rights reserved.

  11. Dicty_cDB: FC-BS11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS...11Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS

  12. The contract - introduction

    International Nuclear Information System (INIS)

    Loeffler, G.

    1975-01-01

    The contract is the last and final step of project planning and the first step of project implementation. The contract has to specify in detail and to the point, as concisely as possible, the complete scope of supplies and work, define all technical particulars and requirements, put forward the conditions of legal, regulatory, administrative and financial procedure, prepare for operating and maintenance instructions to be issued after commissioning. In short, the contract is expected to be a reliable instrument during the manufacturing and construction period as well as a guide-book to assist the owner afterwards in the operation and maintenance of the plant. (orig./FW) [de

  13. Dicty_cDB: FC-BS10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/

  14. Dicty_cDB: FC-BS21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS21 (Link to dictyBase) - - - Contig-U15764-1 FC-BS21Z (Li...nk to Original site) - - FC-BS21Z 723 - - - - Show FC-BS21 Library FC (Link to library) Clone ID FC-BS21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS21Q.Seq.d/ Representative seq. ID FC-BS...21Z (Link to Original site) Representative DNA sequence >FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.Seq.... Score E Sequences producing significant alignments: (bits) Value FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.

  15. Dicty_cDB: FC-BS19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

  16. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  17. Structural characterization of the Man5 glycoform of human IgG3 Fc

    Energy Technology Data Exchange (ETDEWEB)

    Shah, Ishan S.; Lovell, Scott; Mehzabeen, Nurjahan; Battaile, Kevin P.; Tolbert, Thomas J. (Kansas); (HWMRI)

    2017-12-01

    Immunoglobulin G (IgG) consists of four subclasses in humans: IgG1, IgG2, IgG3 and IgG4, which are highly conserved but have unique differences that result in subclass-specific effector functions. Though IgG1 is the most extensively studied IgG subclass, study of other subclasses is important to understand overall immune function and for development of new therapeutics. When compared to IgG1, IgG3 exhibits a similar binding profile to Fcγ receptors and stronger activation of complement. All IgG subclasses are glycosylated at N297, which is required for Fcγ receptor and C1q complement binding as well as maintaining optimal Fc conformation. We have determined the crystal structure of homogenously glycosylated human IgG3 Fc with a GlcNAc2Man5 (Man5) high mannose glycoform at 1.8 Å resolution and compared its structural features with published structures from the other IgG subclasses. Although the overall structure of IgG3 Fc is similar to that of other subclasses, some structural perturbations based on sequence differences were revealed. For instance, the presence of R435 in IgG3 (and H435 in the other IgG subclasses) has been implicated to result in IgG3-specific properties related to binding to protein A, protein G and the neonatal Fc receptor (FcRn). The IgG3 Fc structure helps to explain some of these differences. Additionally, protein-glycan contacts observed in the crystal structure appear to correlate with IgG3 affinity for Fcγ receptors as shown by binding studies with IgG3 Fc glycoforms. Finally, this IgG3 Fc structure provides a template for further studies aimed at engineering the Fc for specific gain of function.

  18. Tank 241-TX-302C grab samples 302C-TX-97-1A through 302C-TX-97-3B analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1998-03-12

    This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ``A`` and ``B`` portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information.

  19. Tank 241-TX-302C grab samples, 302C-TX-97-1A through 302C-TX-97-3B analytical results for the final report

    International Nuclear Information System (INIS)

    Esch, R.A.

    1998-01-01

    This document is the final report for tank 241-TX-302C grab samples. Six grabs samples (302C-TX-97-1A, 302C-TX-97-1B, 302C-TX-97-2A, 302C-TX-97-2B, 302C-TX-97-3A, and 302C-TX-97-3B) were collected from the catch tank level gauge riser on December 19, 1997. The ''A'' and ''B'' portions from each sample location were composited and analyses were performed on the composites in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. Appearance and Sample Handling Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information

  20. Dicty_cDB: FC-BS09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS

  1. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  2. Dicty_cDB: FC-BR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

  3. Dicty_cDB: FC-BS14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS...14E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS

  4. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  5. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  6. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  7. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  8. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  9. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  10. Revisiting Field Capacity (FC: variation of definition of FC and its estimation from pedotransfer functions

    Directory of Open Access Journals (Sweden)

    Theophilo Benedicto Ottoni Filho

    2014-12-01

    Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.

  11. A Theory of Diagnostic Inference: Contract Final Report,

    Science.gov (United States)

    1983-11-01

    and I-bLications ftlated to this Contract ........ 19 1caml.igmnts and Scientific I&VOuMM1.......................... 21 M&i 2 This report esunarizes our... Comunications Sciences Division Naval Training Equipment Center Code 7500 Orlando, FL 32813 Naval Research Laboratory Washington, D. C. 20375 Dr. Gary...Dr. A. L. Slafkosky Scientific Advisor Commander Commandant of the Marine Corps Naval Electronics Systems Co-and C6de RD-1 Human Factors Engineering

  12. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  13. The effect of FcγRIIA and FcγRIIB on coronary artery lesion formation and intravenous immunoglobulin treatment responses in children with Kawasaki disease

    Science.gov (United States)

    Chang, Ling-Sai; Lo, Mao-Hung; Li, Sung-Chou; Yang, Ming-Yu; Hsieh, Kai-Sheng; Kuo, Ho-Chang

    2017-01-01

    Previous research has found patients with the FcγRIIIB NA1 variant having increased risk of intravenous immunoglobulin (IVIG) resistance in Kawasaki disease (KD). Our previous studies revealed that elevated FcγRIIA expression correlated with the susceptibility of KD patients. We conducted this research to determine whether and how Fcγ receptors affect the susceptibility, IVIG treatment response, and coronary artery lesions (CAL) of KD patients. The activating FcγRIIA and inhibitory FcγRIIB methylation levels of seven patients with KD and four control subjects were examined using HumanMethylation27 BeadChip. We enrolled a total of 44 KD patients and 10 control subjects with fevers. We performed real-time RT-PCR to determine the FcγRIIA and FcγRIIB expression levels, as well as a luciferase assay of FcγRIIA. We found a considerable increase in methylation of both FcγRIIA and FcγRIIB in KD patients undergoing IVIG treatment. Promoter methylation of FcγRIIA inhibited reporter activity in K562 cells using luciferase assay. The FcγRIIB mRNA expression levels were not found to increase susceptibility, CAL formation, or IVIG resistance. FcγRIIA mRNA expression levels were significantly higher in IVIG-resistant patients than in those that responded to IVIG during the pre-treatment period. Furthermore, the FcγRIIA/IIB mRNA expression ratio was considerably higher in KD patients with CAL than in those without CAL. FcγRIIA and FcγRIIB both demonstrated increased methylation levels in KD patients that underwent IVIG treatment. FcγRIIA expression influenced the IVIG treatment response of KD patients. The FcγRIIA/IIB mRNA expression ratio was greater in KD patients with CAL formation. PMID:27893416

  14. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  15. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  16. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  17. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  18. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  19. Tank 241-AX-101, grab samples, 1AX-97-1 through 1AX-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    Esch, R.A.

    1997-01-01

    This document is the final report for tank 241-AX-101 grab samples. Four grab samples were collected from riser 5B on July 29, 1997. Analyses were performed on samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. All four samples contained settled solids that appeared to be large salt crystals that precipitated upon cooling to ambient temperature. Less than 25 % settled solids were present in the first three samples, therefore only the supernate was sampled and analyzed. Sample 1AX-97-4 contained approximately 25.3 % settled solids. Compatibility analyses were not performed on this sample. Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information. All four samples contained settled solids that appeared to be large salt crystal that precipitated upon cooling to ambient temperature. The settled solids in samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 were less than 25% by volume. Therefore, for these three samples, two 15-mL subsamples were pipetted to the surface of the liquid and submitted to the laboratory for analysis. In addition, a portion of the liquid was taken from each of the these three samples to perform an acidified ammonia analysis. No analysis was performed on the settled solid portion of the samples. Sample 1AX-97-4 was reserved for the Process Chemistry group to perform boil down and dissolution testing in accordance with Letter of Instruction for Non-Routine Analysis of Single-Shell Tank 241-AX-101 Grab Samples (Field, 1997) (Correspondence 1). However, prior to the analysis, the sample was inadvertently

  20. Tank 241-AX-101 grab samples 1AX-97-1 through 1AX-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1997-11-13

    This document is the final report for tank 241-AX-101 grab samples. Four grab samples were collected from riser 5B on July 29, 1997. Analyses were performed on samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Miller, 1997). The analytical results are presented in Table 1. No notification limits were exceeded. All four samples contained settled solids that appeared to be large salt crystals that precipitated upon cooling to ambient temperature. Less than 25 % settled solids were present in the first three samples, therefore only the supernate was sampled and analyzed. Sample 1AX-97-4 contained approximately 25.3 % settled solids. Compatibility analyses were not performed on this sample. Attachment 1 is provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed. Table 2 provides the appearance information. All four samples contained settled solids that appeared to be large salt crystal that precipitated upon cooling to ambient temperature. The settled solids in samples 1AX-97-1, 1AX-97-2 and 1AX-97-3 were less than 25% by volume. Therefore, for these three samples, two 15-mL subsamples were pipetted to the surface of the liquid and submitted to the laboratory for analysis. In addition, a portion of the liquid was taken from each of the these three samples to perform an acidified ammonia analysis. No analysis was performed on the settled solid portion of the samples. Sample 1AX-97-4 was reserved for the Process Chemistry group to perform boil down and dissolution testing in accordance with Letter of Instruction for Non-Routine Analysis of Single-Shell Tank 241-AX-101 Grab Samples (Field, 1997) (Correspondence 1). However, prior to the analysis, the sample was inadvertently

  1. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  2. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  3. Role of activatory Fc gamma RI and Fc gamma RIII and inhibitory Fc gamma RII in inflammation and cartilage destruction during experimental antigen-induced arthritis.

    NARCIS (Netherlands)

    Lent, P.L.E.M. van; Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Sloetjes, A.W.; Putte, L.B.A. van de; Verbeek, S.; Berg, W.B. van den

    2001-01-01

    IgG-containing immune complexes, which are found in most RA joints, communicate with hematopoietic cells using three classes of Fc receptors(Fc gamma RI, -II, -III). In a previous study we found that if a chronic T-cell-mediated antigen-induced arthritis (AIA) was elicited in knee joints of FcR

  4. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    Steen, F.H.

    1997-01-01

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed

  5. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  6. Fc-fusion Proteins in Therapy: An Updated View.

    Science.gov (United States)

    Jafari, Reza; Zolbanin, Naime M; Rafatpanah, Houshang; Majidi, Jafar; Kazemi, Tohid

    2017-01-01

    Fc-fusion proteins are composed of Fc region of IgG antibody (Hinge-CH2-CH3) and a desired linked protein. Fc region of Fc-fusion proteins can bind to neonatal Fc receptor (FcRn) thereby rescuing it from degradation. The first therapeutic Fc-fusion protein was introduced for the treatment of AIDS. The molecular designing is the first stage in production of Fc-fusion proteins. The amino acid residues in the Fc region and linked protein are very important in the bioactivity and affinity of the fusion proteins. Although, therapeutic monoclonal antibodies are the top selling biologics but the application of therapeutic Fc-fusion proteins in clinic is in progress and among these medications Etanercept is the most effective in therapy. At present, eleven Fc-fusion proteins have been approved by FDA. There are novel Fc-fusion proteins which are in pre-clinical and clinical development. In this article, we review the molecular and biological characteristics of Fc-fusion proteins and then further discuss the features of novel therapeutic Fc-fusion proteins. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  7. Dicty_cDB: FC-BR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

  8. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  9. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  10. Copyright or Contract?

    Science.gov (United States)

    Okerson, Ann

    1997-01-01

    Most authors and publishers of electronic information believe that current copyright law does not address technical capabilities or reader uses and have turned to contracts or licenses to define the rights of owners and users. Discusses copyrights, fair use, and licenses and highlights licensing's unresolved issues: use and users; archiving;…

  11. Temporary labour contracts

    CERN Document Server

    1999-01-01

    The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L021/PE, L022/PE, L023/PE and L024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) will reach the end of their initial three-year contractual period at the end of December 1999. Following the satisfactory execution of these contracts during this period, CERN requests approval to extend them from January 2000 for the first of the two years foreseen in the original adjudication. The Finance Committee is invited: - to take note that the three-year expenditure for Temporary Labour contracts from 1997 to 1999 will not exceed 19 100 000 Swiss francs, compared to the 18 900 000 Swiss francs estimated at the time of the adjudication in March 1996; - to approve an extension of the present Temporary Labour contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs.

  12. Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

    Directory of Open Access Journals (Sweden)

    Se Jin Im

    Full Text Available Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc consisting of IgD and IgG4, and tested its function using erythropoietin (EPO conjugate, EPO-hyFc. Despite low amino acid homology (20.5% between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H, a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last. Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

  13. Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

    Science.gov (United States)

    Im, Se Jin; Yang, Sang In; Yang, Se Hwan; Choi, Dong Hoon; Choi, So Young; Kim, Hea Sook; Jang, Do Soo; Jin, Kyeong Sik; Chung, Yo-Kyung; Kim, Seung-Hee; Paik, Sang Hoon; Park, Yoo Chang; Chung, Moon Koo; Kim, Yong Bum; Han, Kang-Hyun; Choi, Kwan Yong; Sung, Young Chul

    2011-01-01

    Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc) consisting of IgD and IgG4, and tested its function using erythropoietin (EPO) conjugate, EPO-hyFc. Despite low amino acid homology (20.5%) between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H), a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H) not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last)). Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

  14. Cross-Linking GPVI-Fc by Anti-Fc Antibodies Potentiates Its Inhibition of Atherosclerotic Plaque- and Collagen-Induced Platelet Activation

    Directory of Open Access Journals (Sweden)

    Janina Jamasbi, RPh

    2016-04-01

    Full Text Available To enhance the antithrombotic properties of recombinant glycoprotein VI fragment crystallizable (GPVI-Fc, the authors incubated GPVI-Fc with anti-human Fc antibodies to cross-link the Fc tails of GPVI-Fc. Cross-linking potentiated the inhibition of human plaque- and collagen-induced platelet aggregation by GPVI-Fc under static and flow conditions without increasing bleeding time in vitro. Cross-linking with anti-human-Fc Fab2 was even superior to anti-human-Fc immunoglobulin G (IgG. Advanced optical imaging revealed a continuous sheath-like coverage of collagen fibers by cross-linked GPVI-Fc complexes. Cross-linking of GPVI into oligomeric complexes provides a new, highly effective, and probably safe antithrombotic treatment as it suppresses platelet GPVI-plaque interaction selectively at the site of acute atherothrombosis.

  15. The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.

    Science.gov (United States)

    Abdiche, Yasmina Noubia; Yeung, Yik Andy; Chaparro-Riggers, Javier; Barman, Ishita; Strop, Pavel; Chin, Sherman Michael; Pham, Amber; Bolton, Gary; McDonough, Dan; Lindquist, Kevin; Pons, Jaume; Rajpal, Arvind

    2015-01-01

    The neonatal Fc receptor (FcRn) is expressed by cells of epithelial, endothelial and myeloid lineages and performs multiple roles in adaptive immunity. Characterizing the FcRn/IgG interaction is fundamental to designing therapeutic antibodies because IgGs with moderately increased binding affinities for FcRn exhibit superior serum half-lives and efficacy. It has been hypothesized that 2 FcRn molecules bind an IgG homodimer with disparate affinities, yet their affinity constants are inconsistent across the literature. Using surface plasmon resonance biosensor assays that eliminated confounding experimental artifacts, we present data supporting an alternate hypothesis: 2 FcRn molecules saturate an IgG homodimer with identical affinities at independent sites, consistent with the symmetrical arrangement of the FcRn/Fc complex observed in the crystal structure published by Burmeister et al. in 1994. We find that human FcRn binds human IgG1 with an equilibrium dissociation constant (KD) of 760 ± 60 nM (N = 14) at 25°C and pH 5.8, and shows less than 25% variation across the other human subtypes. Human IgG1 binds cynomolgus monkey FcRn with a 2-fold higher affinity than human FcRn, and binds both mouse and rat FcRn with a 10-fold higher affinity than human FcRn. FcRn/IgG interactions from multiple species show less than a 2-fold weaker affinity at 37°C than at 25°C and appear independent of an IgG's variable region. Our in vivo data in mouse and rat models demonstrate that both affinity and avidity influence an IgG's serum half-life, which should be considered when choosing animals, especially transgenic systems, as surrogates.

  16. Valor nutritivo de silagens de capim-elefante emurchecido ou com adição de farelo de cacau Nutritive value of elephantgrass silage wilted or with addition of cocoa meal

    Directory of Open Access Journals (Sweden)

    Gleidson Giordano Pinto de Carvalho

    2007-10-01

    Full Text Available O experimento foi conduzido para avaliar o valor nutritivo da silagem de capim-elefante produzida com o capim emurchecido ou adicionada de diferentes níveis de farelo de cacau. O capim-elefante foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos na ensilagem: capim-elefante emurchecido ao sol por 8 horas, e capim-elefante sem emurchecimento com 0, 7, 14, 21 e 28% de farelo de cacau (FC (% da matéria natural. Foram utilizadas quatro repetições por tratamento; o material foi acondicionado em silos de PVC com 0,15 m de diâmetro e 0,3 m de altura, adotando-se compactação de 500 kg/m³. A inclusão do farelo de cacau na ensilagem do capim-elefante mostrou-se eficiente em aumentar o teor de MS da silagem. A inclusão de FC no nível de 7% permitiu produção de silagem com teor de MS semelhante ao da silagem de capim emurchecido. As silagens com FC apresentaram maiores teores de NT, EE, lignina, NIDN e NIDA, no entanto, os teores de FDN, FDA CEL, HEM, cinzas e NDT e a DIVMS diminuíram com a adição de farelo de cacau. O NDT estimado para a silagem de capim emurchecido foi superior ao obtido nas demais silagens, com e sem farelo de cacau. Embora o FC tenha promovido redução da DIVMS, sua inclusão nos níveis de 7 e 14% proporcionou boa digestibilidade das silagens (acima de 60%. O emurchecimento do capim-elefante e a adição de FC podem ser alternativas para aumentar o teor de MS da silagem e garantir a produção de silagens de bom valor nutritivo.The experiment was carried out to evaluate the nutritive value of elephant grass silage wilted under the sun light for eight hours. Other treatments involved the same elephant grass without exposing to sun light but with addition of 0, 7, 14, 21, and 28% of cocoa meal (CM at the ensilage process. The PVC silos used in the experiment measured 0.15 m of diameter and 0.30 m of height. During the ensiling process the forage was compressed until

  17. Immunoglobulin Fc receptors in clinical strains of Staphylococcus aureus do not confer resistance to Phagocytosis in an in vitro assay Los receptores Fc para inmunoglobulinas en cepas clínicas de Staphylococcus aureus no confieren resistencia a la fagocitosis in vitro

    Directory of Open Access Journals (Sweden)

    Benito VEGA

    1999-05-01

    Full Text Available Staphylococcus aureus binds Immunoglobulin G (IgG on its external surface due to the presence of specific receptors for the Fc domain of this immunoglobulin. This mechanism represents a kind of camouflage against phagocytic cells. In order to confirm that possibility an in vitro evaluation of the phagocytic activity of leukocytes polymorpho-nuclear (PMN against strains of Staphylococcus aureus was done, comparing 18 strains isolated from clinical samples and 16 from healthy individuals. The presence of Fc receptors was evaluated by haemagglutination (HA with erythrocytes group A after incubation of the strains with IgG anti blood group A. Phagocytosis of S. aureus was carried out by mixing live bacteria with a suspension of human PMN and incubating at 37 °C for 1 h; survivors were counted as colony forming units by plating. The strains from clinical specimens showed higher HA than those from healthy individuals (p = 0.01; but the former were killed more efficiently than the latter (80-90% and 40%, respectively. It is may be possible that S. aureus showed different behavior in vivo, where could express other virulence factors to prevent the action of phagocytes.Staphylococcus aureus liga inmunoglobulinas G (IgG a su superficie externa debido a la presencia de receptores para el dominio Fc de esas inmunoglobulinas. Este mecanismo representa una clase de camuflage contra células fagocíticas. Para confirmar tal posibilidad se realizó una evaluación in vitro de la actividad fagocítica de leucocitos polimorfonucleares (PMN contra cepas de Staphylococcus aureus, comparando 18 cepas aisladas de casos clínicos y 16 de individuos sanos. La presencia de receptores fue evaluada por hemaglutinación (HA con eritrocitos grupo A luego que las cepas fueron incubadas con IgG anti grupo sanguíneo A. La fagocitosis de S. aureus fue realizada mezclando células vivas con una suspensión de PMN e incubada a 37 °C por una hora; las bacterias sobrevivientes

  18. Condutividade e teste quantitativo coulométrico na triagem neonatal para fibrose cística

    Directory of Open Access Journals (Sweden)

    Mouseline Torquato Domingos

    2015-12-01

    Full Text Available Resumo Objetivo Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém0nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos O teste do suor foi feito simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60 mmol/L. Resultados Fizeram o teste do suor por condutividade e dosagem coulométrica simultaneamente 444 RN sem FC (185 do sexo masculino, 234 do feminino e 24 não informado e obtiveram resultado mediano de 32 mmol/L e 12 mmol/L respectivamente. Para os noventa RN com FC os valores medianos de condutividade e dosagem coulométrica foram 108 mmol/L e 97 mmol/L respectivamente. O índice de falso positivo para condutividade foi de 16,7% e em todos os pacientes FC foi superior a 50 mmol/L, o que confere ao método 100% de sensibilidade (IC 95% = 93,8 a 97,8, especificidade de 96,2% (IC 95% = 93,8 a 97,8, valor preditivo positivo 83,3 (IC 95% = 74,4 a 91,1, valor preditivo negativo 100% (IC 95% = 90,5 a 109,4 e acurácia 9,8%. A correlação entre os métodos foi de r = 0,97 (p > 0,001.O melhor valor de corte sugerido foi de 69,0 mmol/L, coeficiente de kappa = 0,89. Conclusão O teste da condutividade apresentou excelente correlação com o quantitativo coulométrico, alta sensibilidade e especificidade e pode ser usado no diagnóstico da FC em crianças detectadas pela triagem neonatal.

  19. Final Report on the Audit of Architect-Engineer Contracting at the Officer in Charge of Construction, Naval Facilities Engineering Command Contracts, Mediterranean, Madrid, Spain

    Science.gov (United States)

    1990-11-30

    This is our final report on the audit of Architect-Engineer Contracting for the Officer in Charge of Construction, Naval Facilities Engineering...Command Contracts, Mediterranean, for your information and use. This is the fourth in a series of reports issued as part of the audit of architect-engineer...A-E) contracting. The Contract Management Directorate made the audit from August 1989 through July 1990. When we expanded the audit scope to include

  20. O efeito do destreinamento de força muscular em meninos pré-púberes El efecto del desentrenamiento muscular en niños pre-puberes Effect of the muscular strength detraining in prepubertal boys

    Directory of Open Access Journals (Sweden)

    Andrea Silveira da Fontoura

    2004-08-01

    Full Text Available A treinabilidade da força em crianças tem sido bem explorada, mas ainda existe um questionamento a respeito de como a força diminui quando elas param de treinar. O objetivo deste estudo foi avaliar o efeito de 12 semanas de destreino na força muscular de meninos treinados por 12 semanas. Sete meninos pré-púberes (EX, 9,4 ± 1,6 anos treinaram três séries de 15 repetições, três vezes por semana, por 12 semanas. O treinamento foi supervisionado e desenvolvido em equipamentos; consistiu de oito exercícios, incluindo extensão de joelhos (EJ e flexão de cotovelos (FC. O teste de 1-RM de EJ e FC foi feito antes e após o treinamento e após 12 semanas de destreinamento. Um grupo similar de meninos (n = 7, 9,7 ± 1,7 anos, que não treinou, serviu como grupo controle (CO. Após o treinamento o grupo EX aumentou (p 0,05. Quando corrigida pelo peso corporal e pela massa corporal magra (MCM, 1-RM de EJ diminuiu significativamente (p El entrenamiento de la fuerza en niños ha sido bien explorada, mas existe en la actualidad un cuestionamiento al respecto de como la fuerza disminuye cuando los mismos paran de entrenar. El objetivo de este estudio fue evaluar el efecto del desentrenamiento de 12 semanas sobre la fuerza muscular en niños entrenados por 12 semanas. Siete niños pre-púberes (EX, 9,4 ± 1,6 años entrenaron tres series de 15 repeticiones, tres veces por semana, por 12 semanas. El entrenamiento fué supervisado y desarrollado en equipamientos, consistió de ocho ejercicios, incluyendo extensión de los codos (EJ y la flexión de las rodillas (FC. El test de 1-RM de EJ y FC fué hecho antes y después del entrenamiento y después de 12 semanas de desentrenamiento. Un grupo similar de niños (n = 7, 9,7 ± 1,7 años, que no entrenó sirvió como grupo control (CO. Después del entrenamiento el grupo EX aumentó (p 0,05. Cuando fue corregido por el peso corporal y por la masa corporal magra (MCM, 1-RM de EJ disminuy

  1. Comportamiento productivo de diferentes genotipos bovinos en una finca comercial. Ceba final

    Directory of Open Access Journals (Sweden)

    J. M Iglesias

    Full Text Available El objetivo de esta investigación fue dar continuidad a los estudios relacionados con el comportamiento productivo de los genotipos bovinos Cebú (C, F1 Holstein x Cebú (HC y Mambí de Cuba (M, realizados durante la ceba inicial en pastoreo y semiestabulación. La ceba final se desarrolló durante 388 días y abarcó la época lluviosa (ELl y la poco lluviosa (EPLl. Se utilizaron los mismos 45 animales del estudio anterior, que se convirtieron en toretes de 18 meses de edad y 241-263 kg de peso, los cuales se mantuvieron divididos en tres grupos de 15 animales cada uno, según un diseño totalmente aleatorizado. Estos pastorearon en un área de gramíneas durante el horario diurno y recibieron en establo sales minerales a voluntad y suplementos (Northgold y afrecho de trigo, a razón de un kilogramo diario en la EPLl y 1,5 kg en la ELl. La disponibilidad de pastos fue de 11,8 y 26,4 kg de MS animal-1 día-1 para la EPLl y la ELl, respectivamente. Hubo diferencias significativas (p < 0,05 en la ganancia diaria de peso vivo a favor de C y HC, con valores de 0,432; 0,364 y 0,256 kg para C, HC y M, respectivamente, en la EPLl; pero los genotipos no difirieron en la ELl. El peso vivo final al sacrificio (p < 0,05 fue de 442,7; 436,3 y 391,6 kg para C, HC y M, respectivamente. Se concluye que los bovinos del genotipo M tuvieron un comportamiento satisfactorio en pastoreo, ya que las ganancias alcanzadas durante la ceba final propiciaron la obtención de animales de segunda categoría, con un peso superior a 390 kg.

  2. Desempenho de perus de corte alimentados com níveis crescentes de aflatoxinas, com ou sem adição de adsorvente Turkey performance fed with increasing aflatoxins levels, with or without adsorvent inclusion

    Directory of Open Access Journals (Sweden)

    Janio Morais Santurio

    1998-03-01

    Full Text Available Este trabalho foi realizado durante o verão de 1995/96 com o objetivo de determinar o nível de aflatoxinas (AFL capaz de causar prejuízos no desempenho de perus de corte criados sob condições ambientais de baixo desafio, bem como avaliar a eficácia da adição de bentonita sódica natural (BSN como um adsorvente. Foram utilizados 1008 perus de corte, alojados em 84 boxes seguindo um delineamento experimental de blocos casualizados com 14 tratamentos distribuídos em um arranjo fatorial 7x2, sendo 7 níveis de adição de AFL, (0, 10, 50, 100, 500, 1000 e 2000ppb e 2 níveis de adição de BSN (0 e 0,5%. Aos 21 dias de idade, as aves alimentadas com as dietas sem adição de BSN mostraram uma redução significativa (PThis experiment was carried out in the 1995/96 summer to determine the aflatoxin (AFL levels ability to decrease turkey performance raised under excellent environmental conditions and also to avaluate a natural sodium bentonite (NSB efficiency as an adsorbent. One thousand and eight poults were housed in 84 floor pens following a randomized complete block design with 14 treatments arranged in a 7x2 factorial, with 7 AFL levels (0, 10, 50, 100, 500, 1000 and 2000ppb and 2 NSB levels (0 and 0.5%. At 21 days of age the birds fed without NSB showed body weight gain (BWG and feed intake (FI reduction (P<0.05 from 500ppb or more of AFL, whereas the birds fed with NSB showed BWG and FI reduction (P<0.05 only from 1000ppb or more of AFL. These same results were observed at 40 days of age, but at 70 days, the BWG and FI reduction was statistically significant (P<0.05 from 500ppb or more of AFL, with or without NSB inclusion. In general, birds fed with NSB had about 15 to 20% less BWG and FI reduction than birds fed without NSB. The feed conversion (FC was less affected by AFL levels, although it worsened with increasing AFL levels. AFL have greatly affected the mortality rate. At 21 days of age the birds fed with 1000 and 2000pbb of

  3. Fatigue crack growth in EUROFER 97 at different temperatures. Final report, tasks: TW1-TTMS-002, D22 and TW2-TTMS-002a, D22

    International Nuclear Information System (INIS)

    Aktaa, J.; Lerch, M.

    2005-05-01

    For the assessment of cracks in First Wall structures built from EUROFER 97 of future fusion reactors the fatigue crack behaviour in EUROFER 97 was investigated at room temperature (RT), 300, 500 and 550 C. For this purpose fatigue crack growth tests were performed using CT specimens with two R-ratios, R=0.1 and R=0.5, respectively. Hence, fatigue crack threshold, fatigue crack growth behaviour in the near-threshold range and their dependences on temperature and R-ratio were determined and described using an analytical formula. The fatigue crack threshold showed a monotonic dependence on temperature which is for insignificantly small. The fatigue crack growth behaviour exhibited for a nonmonotonic dependence on temperature which is explained by the decrease of yield stress and the increase of creep damage when increasing the temperature [de

  4. Cholecystokinin (CCK) functional cholescintigraphy (FC) in patients suspected of acalculous biliary disease (ABD)

    International Nuclear Information System (INIS)

    Fink-Bennett, D.; De Ridder, P.; Kolozsi, W.; Gordon, R.; Rapp, J.

    1984-01-01

    To determine if CCK FC can aid in the diagnosis (Dx.) of ABD, the authors retrospectively analyzed the max. gallbladder (GB) ejection fraction response (EFR) to CCK in 240 patients (pts.) with persistent symptoms of biliary colic, a normal GB Ultrasound exam and/or OCG. Each pt. (NPO after 12 A.M.) received 5 mCi of technetium (Tc)-99 Hepatolite. After max GB filling, .02 μg/kg CCK was administered (1-3 minutes) I.V. Background corrected GB EFs were determined q.5 min x4 by ratioing the pre-CCK GB cts. minus post-CCK GB cts. to pre-CCK GB cts. In 131/240 pts. the max. GBEFR was 35%. Eleven underwent surgery, 98 medical Rx. 4/11 Cx. apts had CAC, 7 were normal. Of the 98 medical Rx. pts. 21 lack followup, 71 are clinically felt not to have ABD; 6 are felt to have ABD. CCK FC appears to be a useful test for the detection of ABD. Its predictive value (GBEF <35%) in Cx. pts. is 97%; in all pts. (assuming medical Rx. correct), 94% (sensitivity - 91%, specificity - 93%)

  5. Generation and Characterization of an IgG4 Monomeric Fc Platform.

    Directory of Open Access Journals (Sweden)

    Lu Shan

    Full Text Available The immunoglobulin Fc region is a homodimer consisted of two sets of CH2 and CH3 domains and has been exploited to generate two-arm protein fusions with high expression yields, simplified purification processes and extended serum half-life. However, attempts to generate one-arm fusion proteins with monomeric Fc, with one set of CH2 and CH3 domains, are often plagued with challenges such as weakened binding to FcRn or partial monomer formation. Here, we demonstrate the generation of a stable IgG4 Fc monomer with a unique combination of mutations at the CH3-CH3 interface using rational design combined with in vitro evolution methodologies. In addition to size-exclusion chromatography and analytical ultracentrifugation, we used multi-angle light scattering (MALS to show that the engineered Fc monomer exhibits excellent monodispersity. Furthermore, crystal structure analysis (PDB ID: 5HVW reveals monomeric properties supported by disrupted interactions at the CH3-CH3 interface. Monomeric Fc fusions with Fab or scFv achieved FcRn binding and serum half-life comparable to wildtype IgG. These results demonstrate that this monomeric IgG4 Fc is a promising therapeutic platform to extend the serum half-life of proteins in a monovalent format.

  6. Qualidade da carne de marreco pequim branco (Anas Platyrhynchos platyrhynchos L. 1758 comparado a frango de corte Meat quality in white peking mallard (Anas Platyrhynchos platyrhynchos L. 1758 compared to broiler chicken

    Directory of Open Access Journals (Sweden)

    Peter Bitencourt Faria

    2008-02-01

    Full Text Available O total de 20 carcaças resfriadas (10 Marrecos Pequim Branco e 10 de frangos de corte foi submetido às análises de composição centesimal, colesterol, cor (sistema CIE L*a*b*, perda de peso por cozimento (PPC e força de cisalhamento (FC. A carne de marreco apresenta (PTwenty refrigerated carcasses (10 Peking mallard and 10 broiler chicken were submitted to analyses of chemical composition, cholesterol, colour (CIE L*a*b* system, weight loss by cooking (PPC and shear force (FC. Mallard meat had lower (P<0.05 humidity in both leg and breast (71.77 and 74.53%, respectively when compared with chicken meat (74.73 and 76.07%, respectively. When different cuts were compared, the breast had a higher (P<0.05 humidity and protein content than the leg in both species. Mallard leg and breast had lower (P<0.05 lightness (37.59 and 35.75, respectively and higher red content (18.48 and 20.67, respectively, than the lightness (40.98 and 45.18, respectively and red content (10.02 and 5.52, respectively observed in chicken. The FC was higher (P<0.05 in mallard breast (4.90 kgf than in chicken breast (2.63 kgf. Meat from White Peking mallard is darker and with a stronger red pigment than meat from broiler chicken. Even though it is less tender than meat from broiler chicken, mallard meat still has an acceptable tenderness.

  7. Temperatura base, plastocrono e número final de nós no malmequer-do-campo Base temperature, plastochron and final node number in yellow calendula

    Directory of Open Access Journals (Sweden)

    Joelma Dutra Fagundes

    2008-12-01

    Full Text Available O malmequer-do-campo (Aspilia montevidensis é uma planta herbácea perene, nativa do Sul e Sudeste do Brasil, cuja biologia tem sido pouco estudada. O objetivo deste trabalho foi determinar a temperatura base, o plastocrono e o número final de nós de A. montevidensis. Para tanto, foi conduzido um experimento em Santa Maria, RS, com seis épocas de cultivo (20/12/2005, 14/02/2006, 06/03/2006, 04/04/2006, 05/05/2006 e 08/06/2006 no delineamento inteiramente casualizado. A unidade experimental foi uma planta cultivada em vasos preenchidos com substrato comercial. O número de nós visíveis foi registrado na haste principal e nas hastes laterais de primeira e segunda ordem. A temperatura base de emissão de nós foi estimada pela metodologia do menor Quadrado Médio do Erro. A soma térmica diária foi calculada a partir do transplante e o plastocrono foi estimado para cada haste. A temperatura base estimada para emissão de nós de A. montevidensis foi de 0°C. O plastocrono e o número final de nós variam entre hastes e épocas de cultivo, com os menores valores de plastocrono e maiores valores de número final de nós observados na haste principal.Yellow calendula (Aspilia montevidensis is a perenium herbaceous plant native of South and Southeast Brazil that has been little studied about its biology. The objective of this study was to determine the base temperature, the plastochron and the final node number in A. montevidensis. An experiment was conducted in Santa Maria, RS, with six planting dates (12/20/2005, 02/14/2006, 03/06/2006, 04/04/2006, 05/05/2006 and 06/08/2006. The experimental design was completely randomized and the experimental unit was one plant grown in pots filled with commercial substratum. The number of visible nodes were measured on the maim stem and on first and second order lateral branches. The base temperature for node appearance was estimated with the mean square error approach. The daily thermal unit was calculated

  8. Final Close-Out Report for DE-FG02-93ER40764

    Energy Technology Data Exchange (ETDEWEB)

    Gyulassy, Miklos [Columbia Univ., New York, NY (United States)

    2016-02-12

    This is a final close-out report for DOE contract DE-FG02-93ER40764 at Columbia University in New York that funded nuclear theory research at Columbia from 12/15/1992 to 12/14/2015. Highlight of research results from the last FY 2015 period, a list of all 12 PhD students trained through the whole grant, and a list of 201 original papers published from 1993-2015 with impact factor metrics are presented.

  9. High energy physics program at Texas A&M University. Final report, April 1, 1990--March 31, 1991

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-01

    The Texas A&M experimental high energy physics program has been supported since its inception by DOE Contract DE-AS05-81ER40039. During that period we established a viable experimental program at a university which before this time had no program in high energy physics. In 1990, the experimental program was augmented with a program in particle theory. In the accompanying final report, we outline the research work accomplished during the final year of this contract and the program being proposed for consideration by the Department of Energy for future grant support. Some of the particular areas covered are: Collider detector at Fermilab program; the TAMU MACRO program; SSC R&D program; SSC experimental program; and theoretical physics program.

  10. Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies

    Science.gov (United States)

    Schlothauer, Tilman; Rueger, Petra; Stracke, Jan Olaf; Hertenberger, Hubert; Fingas, Felix; Kling, Lothar; Emrich, Thomas; Drabner, Georg; Seeber, Stefan; Auer, Johannes; Koch, Stefan; Papadimitriou, Apollon

    2013-01-01

    The neonatal Fc receptor (FcRn) is important for the metabolic fate of IgG antibodies in vivo. Analysis of the interaction between FcRn and IgG in vitro might provide insight into the structural and functional integrity of therapeutic IgG that may affect pharmacokinetics (PK) in vivo. We developed a standardized pH gradient FcRn affinity liquid chromatography method with conditions closely resembling the physiological mechanism of interaction between IgG and FcRn. This method allows the separation of molecular IgG isoforms, degradation products and engineered molecules based on their affinity to FcRn. Human FcRn was immobilized on the column and a linear pH gradient from pH 5.5 to 8.8 was applied. FcRn chromatography was used in comparison to surface plasmon resonance to characterize different monoclonal IgG preparations, e.g., oxidized or aggregated species. Wild-type and engineered IgGs were compared in vitro by FcRn chromatography and in vivo by PK studies in huFcRn transgenic mice. Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile. The method can distinguish: 1) IgGs with different Fabs, 2) oxidized from native IgG, 3) aggregates from monomer and 4) antibodies with mutations in the Fc part from wild-type IgGs. Changes in the FcRn chromatographic behavior of mutant IgGs relative to the wild-type IgG correlate to changes in the PK profile in the FcRn transgenic mice. These results demonstrate that FcRn affinity chromatography is a useful new method for the assessment of IgG integrity. PMID:23765230

  11. Ingestão de alimentos e adequação de nutrientes no final da infância Food intake and nutritional adequacy in final phase of childhood

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Machado de ALBUQUERQUE

    2002-09-01

    Full Text Available Este trabalho reúne informações sobre a ingestão de alimentos e a adequação dos nutrientes no período final da infância. O grupo estudado foi composto por 247 escolares, sendo 150 do sexo feminino e 97 do masculino, com idade de nove e dez anos, pertencentes a escolas públicas municipais de Maceió. Os dados sobre ingestão de alimentos foram coletados através do recordatório de 24 horas e comparados com as recomendações preconizadas pelo National Research Council de 1989. De acordo com os resultados, a ingestão alimentar dos escolares apresentou-se deficiente em relação à energia e aos micronutrientes, especialmente as vitaminas e alguns minerais pesquisados, com exceção do ferro. Essa deficiência foi encontrada independente do sexo. Tais achados sugerem que o aporte insuficiente dos nutrientes estudados, se persistente, poderá contribuir negativamente para o desempenho do crescimento linear durante a fase da adolescência.This study analyzes the results of a dietary intake survey. The main goal was to estimate the nutrient and energy intake of children in final phase of childhood and the nutritional adequacy of their diet. The studied group was composed of 247 schoolchildren (150 females and 97 males, aged nine to ten years old from public schools of the city of Maceió, state of Alagoas. Food intake data were collected through a 24-hour dietary recall and compared with the standards of National Research Council-Recommended Dietary Allowances (RDA, 1989. According to the results, the children food intake, independently of the sex, was deficient in energy and micronutrients, specially vitamins and some minerals, with the exception of iron. These findings suggest that in this group specific nutrients deficits can be a limiting factor which may contribute to an inadequate growth performance during adolescence.

  12. Study of electron and neutrino interactions. Final report

    International Nuclear Information System (INIS)

    Abashian, A.

    1997-01-01

    This is the final report for the DOE-sponsored experimental particle physics program at Virginia Tech to study the properties of the Standard Model of strong and electroweak interactions. This contract (DE-AS05-80ER10713) covers the period from August 1, 1980 to January 31, 1993. Task B of this contract, headed by Professor Alexander Abashian, is described in this final report. This program has been pursued on many fronts by the researchers in a search for axions at SLAC, in electron-positron collisions in the AMY experiment at the TRISTAN collider in Japan, in measurements of muon decay properties in the MEGA and RHO experiments at the LAMPF accelerator, in a detailed analysis of scattering effects in the purported observation of a 17 keV neutrino at Oxford, in a search for a disoriented chiral condensate with the MiniMax experiment at Fermilab, and in an R ampersand D program on resistive plate counters that could find use in low-cost high-quality charged particle detection at low rates

  13. Uso de óleo essencial de orégano, salinomicina e bacitracina de zinco na dieta de frangos de corte

    Directory of Open Access Journals (Sweden)

    Patricia Maria Meneghetti Pulici

    2014-09-01

    Full Text Available O presente trabalho teve como objetivo avaliar dietas com óleo essencial de orégano, associado ou não com salinomicina, como alternativa à bacitracina de zinco sobre o desempenho zootécnico de frangos de corte. Foram utilizados 600 pintos de um dia de idade, machos, da linhagem Cobb® 500, criados até 42 dias de idade em boxes com cama de casca de arroz providos de comedouros tubulares e bebedouros nipple. O delineamento foi inteiramente casualizado, com seis dietas e 10 repetições de 10 aves cada. As dietas experimentais à base de milho e farelo de soja foram: controle positivo – antibiótico (bacitracina de zinco + 0,05% de anticoccidiano (salinomicina, controle negativo – dieta basal (DB sem aditivos, DB + 0,05% de salinomicina e 0,03% de óleo essencial de orégano (Orego-Stim®, DB + 0,03% de óleo essencial de orégano, DB + 0,05% de salinomicina e 0,05% de óleo essencial de orégano, DB + 0,05% de óleo essencial de orégano. Não foi encontrado efeito da utilização do óleo de orégano até 21 dias no desempenho das aves. Nos demais períodos, aos 35 e 42 dias, o desempenho das aves tratadas com 0,03% de óleo essencial de orégano + salinomicina apresentou resultados semelhantes ao controle positivo, levando à conclusão de que a dose de 0,03% de óleo essencial de orégano + salinomicina pode substituir a bacitracina de zinco + salinomicina em dietas para frangos de corte.

  14. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  15. Modulating Cytotoxic Effector Functions by Fc Engineering to Improve Cancer Therapy.

    Science.gov (United States)

    Kellner, Christian; Otte, Anna; Cappuzzello, Elisa; Klausz, Katja; Peipp, Matthias

    2017-09-01

    In the last two decades, monoclonal antibodies have revolutionized the therapy of cancer patients. Although antibody therapy has continuously been improved, still a significant number of patients do not benefit from antibody therapy. Therefore, rational optimization of the antibody molecule by Fc engineering represents a major area of translational research to further improve this potent therapeutic option. Monoclonal antibodies are able to trigger a variety of effector mechanisms. Especially Fc-mediated effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement- dependent cytotoxicity (CDC) are considered important in antibody therapy of cancer. Novel mechanistic insights into the action of monoclonal antibodies allowed the development of various Fc engineering approaches to modulate antibodies' effector functions. Strategies in modifying the Fc glycosylation profile (Fc glyco-engineering) or approaches in engineering the protein backbone (Fc protein engineering) have been intensively evaluated. In the current review, Fc engineering strategies resulting in improved ADCC, ADCP and CDC activity are summarized and discussed.

  16. Comparative studies on Fc receptors for IgG on resting and activated T lymphocytes

    International Nuclear Information System (INIS)

    Hueckel, C.; Jensen, H.L.; Rychly, J.; Sandor, M.; Erdei, A.; Gergely, J.

    1986-01-01

    Fc-receptors for IgG (FcγR) on resting (i.e. freshly prepared) and mitogen (Con A) or alloantigen-activated mouse spleen T cells were compared using binding of different markers such as 125 I-labelled immune complexes, 125 I-labelled anti FcγR monoclonal antibody, FITC-labelled aggr. IgG and sheep erythrocytes covered with specific antibody (EA rosetting). C3b receptors were detected by rosetting with sheep erythrocytes covered with antibody and complement (EAC rosetting). The electrophoretic mobility of the cells without or after binding of aggr. IgG was also tested. Differences between resting and activated T cells were found: (1) After activation of T cells by mitogen or alloantigen, a proportion of FcγR-positive cells increased two to four times. (2) FcγR number per FcγR-positive cell seemed to be higher on activated then on resting cells. (3) FcγR-positive resting cells did not shed their FcγR upon incubation at 4 0 C followed by incubation at 37 0 C, but FcγR-positive activated cells shed a remarkable proportion of their FcγR on the same conditions. (4) Binding of aggr. IgG caused a decrease of electrophoretic mobility of activated but not resting cells. (5) FcγR-positive resting cells were also C3b receptor-positive, whereas FcγR-positive activated cells had no detectable C3b receptors. (author)

  17. Dicty_cDB: FC-AY04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e

  18. Dicty_cDB: FC-AK01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s

  19. Dicty_cDB: FC-BF01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BF01 (Link to dictyBase) - - - Contig-U15105-1 FC-BF01Z (Li...nk to Original site) - - FC-BF01Z 674 - - - - Show FC-BF01 Library FC (Link to library) Clone ID FC-BF01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 260 3e-68 AJ783868_1( AJ783868 |pid:none...lasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-BF01 is cyt 5' end seq. ID - 5' end seq. - L

  20. Dicty_cDB: FC-BC16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BC16 (Link to dictyBase) - - - Contig-U15105-1 FC-BC16Z (Li...nk to Original site) - - FC-BC16Z 620 - - - - Show FC-BC16 Library FC (Link to library) Clone ID FC-BC16 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...4 2e-66 AY961522_1( AY961522 |pid:none) Lysiphlebus testaceipes ribosomal ... 254 2e-66 AF402813_1( AF402813 |pid:none) Ict...hondrial 4.0 %: nuclear >> prediction for FC-BC16 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq

  1. Fibrose Cística: Análise da Coorte de 10 Anos de um Programa para Adultos

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Roth Dalcin

    2011-07-01

    Full Text Available Introdução: A fibrose cística (FC que já foi considerada doença da criança é agora doença do adulto e requer programa para adultos. Objetivo: definir características clínicas de uma coorte de 10 anos de um programa para adultos com FC e determinar as características associadas com desfechos clínicos. Métodos: coorte retrospectiva de pacientes com FC (idade ≥ 10 anos atendida pelo Programa para Adultos do Hospital de Clínicas de Porto Alegre, de outubro de 1998 a outubro de 2008. Foram coletados dados demográficos, dados clínicos, status nutricional, função pulmonar, testes laboratoriais e microbiologia do escarro. Foram definidos como desfechos clínicos: sobrevivência, sobrevivência com transplante pulmonar e óbito. Resultados: foram atendidos 94 pacientes pelo programa para adultos. A média de idade foi 24,0±7,4 anos e a média do volume expiratório forçado no primeiro segundo (VEF1 foi 56,4±28,8%. Setenta e sete pacientes foram sobreviventes, 6 sobreviventes com transplante pulmonar e 11 morreram. Na análise univariada, etnia caucasiana (p=0,016, mutação F508del (p=0,04, escore clínico (p<0,001, índice de massa corporal (p<0,001,  oxigenoterapia (p<0,001, capacidade vital forçada (p=0,023 e VEF1 (p<0,001 se associaram com os desfechos clínicos. A análise de regressão logística identificou fatores associados com desfecho precário: VEF1 (RC=0,.72, ICI=0,54-0,94, p=0,017 e escore clínico  (RC = 0,70, IC=0,50-0,97, p = 0,034. Insuficiência respiratória crônica exacerbada por infecção respiratória aguda foi causa imediata de morte na maioria dos casos. Conclusão: Este estudo descreveu uma coorte de 94 pacientes com FC atendidos por um programa de adultos. VEF1 e escore clinico se associaram com os desfechos clínicos.

  2. EFECTO DEL ESPESOR EN LAS PROPIEDADES SUPERCONDUCTORAS Y ESTRUCTURALES DE PELÍCULAS DELGADAS DE FeSe0,5Te0,5

    Directory of Open Access Journals (Sweden)

    Oscar Rodríguez

    2012-07-01

    Full Text Available En este trabajo se investiga la influencia del espesor de la capa de FeSe0,5Te0,5 en las propiedades cristalinas y superconductoras de las películas depositadas sobre una capa buffer de hierro (Fe en sustratos de MgAl2O4, por el método de deposición por láser pulsado (PLD. El espesor de las capas superconductoras producidas son ~55nm y ~134nm. La película con menor espesor presenta mejores propiedades de textura (crecimiento orientado y una menor rugosidad superficial (RMS; verificadas por difracción de rayos X y AFM respectivamente. Esta misma película presenta una transición marcada al estado superconductor y una mayor temperatura crítica a diferencia de la película de mayor espesor. Se discute el efecto del espesor en las tensiones de la red superconductora.

  3. Contabilización de Contratos de Futuros, Opciones, Forwards y Swaps (Accounting treatment for future, options, forwards and swap contracts

    Directory of Open Access Journals (Sweden)

    Vernor Mesén Figueroa

    2012-12-01

    Full Text Available Un entorno cada vez más dinámico y evolutivo ha dado paso al surgimiento y, por ende, al uso cada vez más frecuente de instrumentos financieros cuya flexibilidad y capacidad de ajuste a las condiciones de mercado permitan a las personas y empresas lograr sus objetivos de operación, inversión y financiamiento. En el contexto antes descrito, los contratos de futuros, opciones, forwards y swaps representan mecanismos cuyas características operativas permiten a sus tenedores el logro de objetivos alternativos tales como la cobertura eficaz de diferentes tipos de riesgos o la obtención de ganancias o pérdidas derivadas de la especulación. El presente artículo pretende reseñar, en forma breve, los mecanismos de operación de los contratos de futuros, opciones, forwards y swaps, para luego enfatizar en los criterios de contabilización que toda entidad o intermediario financiero debe seguir para reconocer los efectos que dichos tipos de contratos tienen sobre su posición financiera, resultados de operación y flujos de efectivo.   ABSTRACT A rapidly changing and evolving environment has given rise and increased the use of financial tools whose flexibility and adjusting capabilities to variable market conditions allow individuals and companies to achieve their operating, investment and financial goals. Within this framework, contracts for futures, options, forwards and swaps provide mechanisms with operating characteristics that allow their tenants to achieve alternative objectives such as the effective coverage of different risks or the attaining of profits or losses as a result of speculation. This article attempts to resume the operating mechanisms of futures, options, forwards and swap contracts and then concentrates into the accounting criteria that must be followed by financial intermediaries or entities to recognize the effects such contracts have on their financial position, operational results and cash flow.

  4. HAL/S-FC compiler system specifications

    Science.gov (United States)

    1976-01-01

    This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.

  5. Administrative contracts

    OpenAIRE

    Vukićević-Petković Milica

    2015-01-01

    Administrative contracts are a special type of contract where usually one of the contracting parties is a public law body and which is concluded for the performance of public service and the realization of a public interest. They go a long way since its inception to its eventual final acceptance of all the legal systems. One of the enduring characteristics of this type of contract is their disquised or unnoticed existence. This is why only monitoring their development may lead to a complete u...

  6. Farelo de canola na alimentação de alevinos de carpa-capim (Ctenopharyngodon idella V. Use of canola meal in the diet of grasscarp fry (Ctenopharyngodon idella V.

    Directory of Open Access Journals (Sweden)

    Valéria Rossetto Barriviera Furuya

    1998-10-01

    Full Text Available Foram avaliados os efeitos da substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC, em dietas para alevinos de carpa-capim (Ctenopharyngodon idella. Foram utilizados 100 alevinos com peso vivo médio de 1,33 gramas e comprimento médio de 5,06cm, distribuídos em um delineamento inteiramente casualizado, com cinco tratamentos e quatro repetições, em 20 aquários com capacidade para 50 litros, com 5 peixes por unidade. Foram utilizados cinco níveis de substituição de proteína do FS pela do FC (0,00%; 20,00%; 40,00%; 60,00% e 80,00%, o que correspondeu a 0,00%; 8,03%; 16,10%; 24;10% e 32,15% de inclusão de FC nas dietas. As dietas, formuladas de modo a serem isoprotéicas, isocálcicas e isofosfóricas, foram fornecidas durante 28 dias; ao mesmo tempo, os parâmetros físico-químicos foram monitorados. Ao final do período experimental, foram avaliadas as características de desempenho. O ganho de peso, taxa de crescimento relativo, taxa de eficiência protéica, conversão alimentar, sobrevivência e custo de ração/peso ganho não foram afetados pelos níveis de substituição da proteína do FS pela do FC. Entretanto, foram observados efeitos quadráticos para o peso final (Y = 2,39190 + 0,01327X - 0,00019X2, r2 = 0,78, comprimento total (Y = 6,15270 + 0,01195X - 0,00016X2, r2 = 0,86 e incremento em comprimento total (Y = 1,10340 + 0,01198X - 0,00016X2, r2 = 0,86. Os parâmetros físico-químicos permaneceram dentro dos níveis adequados. O nível de substituição de 35,79% de proteína do FS pela do FC ou a inclusão de 14,40% de FC na dieta levou ao melhor desempenho em alevinos de carpa-capim.One hundred fry with 1.33 mean weight and 5.06cm mean length distributed in twenty 50-liter aquarium, with 5 fish each, were used in a completely randomized plotted experiment, with 4 replications, to evaluate the effects of soybean meal (SM protein replacement by canola meal (CM protein in diets for

  7. Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha Tomato seedlings production using substrates with coconut fiber and rock waste

    Directory of Open Access Journals (Sweden)

    Regynaldo A Sampaio

    2008-12-01

    Full Text Available Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC e pó de rocha de granito (RG como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC e pó de rocha de granito (RG: T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. O cultivo foi feito em bandeja de poliestireno expandido com células de 3,5 x 3,5 x 5,0 cm. Foram avaliados o diâmetro do coleto, a altura da planta, o índice de velocidade de emergência, a percentagem de emergência e a massa fresca e seca da parte aérea e da raiz. Em praticamente todas as características avaliadas o substrato comercial foi superior aos substratos contendo fibra de coco e pó de rocha. Considerando-se apenas os substratos contendo fibra de coco e pó de rocha, as mudas com melhores características foram obtidas com a mistura de aproximadamente 70% em volume de fibra de coco.A greenhouse experiment was carried out to evaluate the ratio of coconut fiber and rock waste, in the tomato seedling production (cultivar Kada Gigante, in Montes Claros, Brazil. The experimental design was of randomized complete blocks with four replicates. The treatments were composed of a control and six ratios of coconut fiber (FC and rock waste (RG: T1 - Commercial Substrate Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. The cultivation was done in polystyrene trays with cells of 3.5 x 3.5 x 5,0 cm. Stem diameter, seedling height, emergency speed index, emergency percentage, root and aerial part of fresh and dry matter were evaluated. In

  8. Alimentação de juvenis de carpa capim com dietas à base de farelos vegetais e forragem = Feeding grass carp juveniles with plant-protein diets and forage

    Directory of Open Access Journals (Sweden)

    Cátia Aline Veiverberg

    2010-07-01

    Full Text Available Para avaliar o potencial dos ingredientes de origem vegetal como substitutos da farinha de carne suína em dietas para Ctenopharyngodon idella Valenciennes, (1844 (carpa capim, 180 juvenis (15 por tanque foram criados durante 60 dias em sistema de recirculação de água. Foi avaliada a substituição da farinha de carne suína (FCS por farelo de canola (FC, farelo de girassol (FG e a mistura dos farelos de canola e girassol (FCG. As dietas também continham farelo de soja como fonte proteica. O consumo diário de forragem (1,24 a 2,11% do peso vivo não diferiu entre os tratamentos. Peso final, ganho em peso, taxa de crescimento específico e conversão alimentar aparente não diferiram estatisticamente entre as dietas. O rendimento de filé foi maior nos tratamentos FC e FCG, enquanto o índice digestivossomático foi maior nos tratamentos FG e FCG. Maior teor degordura e menores teores de proteína no peixe inteiro e de cinzas no filé foram obtidos no tratamento FCG. Os filés dos tratamentos FCS e FCG apresentaram maior valor de luminosidade. Os peixes da dieta FCS apresentaram maiores valores de proteínas, triglicerídeos e colesterol total no soro. Conclui-se que os farelos de canola e girassol podem ser utilizados em dietas para recria da carpa capim.To evaluate the potential of plant-protein sources to replace porcine meat meal in diets for grass carp juveniles, 180 fish (15 per tank were reared for 60 days in a re-use water system. We evaluated the replacement of porcine meat meal (FCS for canola meal (FC, sunflowermeal (FG or a mixture of canola and sunflower meal (FCG. The diets were also composed of soybean meal as a protein source. Daily forage intake ranged from 1.24 to 2.11% body weight and did not differ among treatments. Final weight, weight gain, specific growth rate and feed conversion rate did not differ statistically among diets. The fillet yield was higher in FC and FCG diets, while the digestive-somatic index was higher

  9. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 4, Comments and Responses.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1992-01-01

    This volume of the Initial Northwest Power Act Power Sales Contracts Final Environmental Impact Statement (Final EIS) contains public comments addressing the Initial Northwest Power Act Power Sales Contracts Draft EIS, August 1990 and Bonneville Power Administration`s (BPA) responses. The Introduction provides information about the process BPA follows in addressing these comments. Part I contains a listing of the Alternative Actions evaluated in the Final EIS; Part II is organized by Alternatives and includes summaries of the comments and BPA responses; Part III provides copies of the original comments letters, and, for ease of identification, are coded in the margins according to the alternative(s) addressed.

  10. Dicty_cDB: FC-IC0102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g

  11. Assessing the Heterogeneity of the Fc-Glycan of a Therapeutic Antibody Using an engineered FcγReceptor IIIa-Immobilized Column.

    Science.gov (United States)

    Kiyoshi, Masato; Caaveiro, Jose M M; Tada, Minoru; Tamura, Hiroko; Tanaka, Toru; Terao, Yosuke; Morante, Koldo; Harazono, Akira; Hashii, Noritaka; Shibata, Hiroko; Kuroda, Daisuke; Nagatoishi, Satoru; Oe, Seigo; Ide, Teruhiko; Tsumoto, Kouhei; Ishii-Watabe, Akiko

    2018-03-02

    The N-glycan moiety of IgG-Fc has a significant impact on multifaceted properties of antibodies such as in their effector function, structure, and stability. Numerous studies have been devoted to understanding its biological effect since the exact composition of the Fc N-glycan modulates the magnitude of effector functions such as the antibody-dependent cell mediated cytotoxicity (ADCC), and the complement-dependent cytotoxicity (CDC). To date, systematic analyses of the properties and influence of glycan variants have been of great interest. Understanding the principles on how N-glycosylation modulates those properties is important for the molecular design, manufacturing, process optimization, and quality control of therapeutic antibodies. In this study, we have separated a model therapeutic antibody into three fractions according to the composition of the N-glycan by using a novel FcγRIIIa chromatography column. Notably, Fc galactosylation was a major factor influencing the affinity of IgG-Fc to the FcγRIIIa immobilized on the column. Each antibody fraction was employed for structural, biological, and physicochemical analysis, illustrating the mechanism by which galactose modulates the affinity to FcγRIIIa. In addition, we discuss the benefits of the FcγRIIIa chromatography column to assess the heterogeneity of the N-glycan.

  12. Cultura Organizacional e Gestão de Equipes de Alto Rendimento: Os Casos FC Barcelona, Sporting Club de Portugal e AFC Ajax

    Directory of Open Access Journals (Sweden)

    Ary José Rocco Júnior

    2015-01-01

    Full Text Available 800x600 Em todo o mundo, a chamada Indústria do Esporte vêm experimentando vertiginoso crescimento financeiro. Com isso, o papel das agremiações esportivas adquiriu especial importância dentro da sociedade contemporânea global. A relevância do planejamento estratégico dessas organizações fez crescer a necessidade dos clubes esportivos investirem em estratégias que permitam o seu correto posicionamento no mercado e as suas conquistas no campo esportivo. A implantação e o desenvolvimento de uma cultura organizacional que permita o desenvolvimento de uma identidade do clube que agregue todos os seus stakeholders – atletas, torcedores, patrocinadores, marcas, investidores e outros -, é uma dessas estratégias. A criação estratégica e planejada de valores e princípios organizacionais que equilibrem resultados econômicos, mercadológicos e financeiros, com a performance esportiva, colabora para o desenvolvimento e implantação de uma cultura, que gera receita e traz conquistas no campo esportivo. O objetivo deste artigo é analisar três casos de sucesso – FC Barcelona, da Espanha; Sporting Club de Portugal; e, AFC Ajax, da Holanda -, de organizações esportivas que implantaram estratégias dessa natureza na Europa. Pretendemos, com isso, estimular agremiações esportivas do Brasil a adotarem estratégias semelhantes. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4

  13. Final Report for DOE Grant DE-FG02-03ER25579; Development of High-Order Accurate Interface Tracking Algorithms and Improved Constitutive Models for Problems in Continuum Mechanics with Applications to Jetting

    Energy Technology Data Exchange (ETDEWEB)

    Puckett, Elbridge Gerry [U.C. Davis, Department of Mathematics; Miller, Gregory Hale [.C. Davis, Department of Chemical Engineering

    2012-10-14

    published by Dr. Phillip Colella, the head of ANAG, and some of his colleagues. Chris Algieri is now employed as a staff member in Dr. Bill Collins' Climate Science Department in the Earth Sciences Division at LBNL working with computational models of climate change. Finally, it should be noted that the work conducted by Professor Puckett and his students Sarah Williams and Chris Algieri and described in this final report for DOE grant # DE-FC02-03ER25579 is closely related to work performed by Professor Puckett and his students under the auspices of Professor Puckett's DOE SciDAC grant DE-FC02-01ER25473 An Algorithmic and Software Framework for Applied Partial Differential Equations: A DOE SciDAC Integrated Software Infrastructure Center (ISIC). Dr. Colella was the lead PI for this SciDAC grant, which was comprised of several research groups from DOE national laboratories and five university PI's from five different universities. In theory Professor Puckett tried to use funds from the SciDAC grant to support work directly involved in implementing algorithms developed by members of his research group at UCD as software that might be of use to Puckett's SciDAC CoPIs. (For example, see the work reported in Section 2.2.2 of this final report.) However, since there is considerable lead time spent developing such algorithms before they are ready to become `software' and research plans and goals change as the research progresses, Professor Puckett supported each member of his research group partially with funds from the SciDAC APDEC ISIC DE-FC02-01ER25473 and partially with funds from this DOE MICS grant DE-FC02-03ER25579. This has necessarily resulted in a significant overlap of project areas that were funded by both grants. In particular, both Sarah Williams and Chris Algieri were supported partially with funds from grant # DE-FG02-03ER25579, for which this is the final report, and in part with funds from Professor Puckett's DOE SciDAC grant # DE-FC

  14. Dicty_cDB: FC-BS24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN

  15. Postneonatal Mortality and Liver Changes in Cloned Pigs Associated with Human Tumor Necrosis Factor Receptor I-Fc and Human Heme Oxygenase-1 Overexpression

    Directory of Open Access Journals (Sweden)

    Geon A. Kim

    2017-01-01

    Full Text Available Soluble human tumor necrosis factor (shTNFRI-Fc and human heme oxygenase 1 (hHO-1 are key regulators for protection against oxidative and inflammatory injury for xenotransplantation. Somatic cells with more than 10 copy numbers of shTNFRI-Fc and hHO-1 were employed in somatic cell nuclear transfer to generate cloned pigs, thereby resulting in seven cloned piglets. However, produced piglets were all dead within 24 hours after birth. Obviously, postnatal death with liver apoptosis was reported in the higher copy number of shTNFRI-Fc and hHO-1 piglets. In liver, the transcript levels of ferritin heavy chain, light chain, transferrin, and inducible nitric oxide synthase were significantly highly expressed compared to those of lower copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. Also, H2O2 contents were increased, and superoxide dismutase was significantly lower in the higher copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism.

  16. Experimental investigation of small diameter two-phase closed thermosyphons charged with water, FC-84, FC-77 and FC-3283

    International Nuclear Information System (INIS)

    Jouhara, Hussam; Robinson, Anthony J.

    2010-01-01

    An experimental investigation of the performance of thermosyphons charged with water as well as the dielectric heat transfer liquids FC-84, FC-77 and FC-3283 has been carried out. The copper thermosyphon was 200 mm long with an inner diameter of 6 mm, which can be considered quite small compared with the vast majority of thermosyphons reported in the open literature. The evaporator length was 40 mm and the condenser length was 60 mm which corresponds with what might be expected in compact heat exchangers. With water as the working fluid two fluid loadings were investigated, that being 0.6 ml and 1.8 ml, corresponding to approximately half filled and overfilled evaporator section in order to ensure combined pool boiling and thin film evaporation/boiling and pool boiling only conditions, respectively. For the Fluorinert TM liquids, only the higher fill volume was tested as the aim was to investigate pool boiling opposed to thin film evaporation. Generally, the water-charged thermosyphon evaporator and condenser heat transfer characteristics compared well with available predictive correlations and theories. The thermal performance of the water-charged thermosyphon also outperformed the other three working fluids in both the effective thermal resistance as well as maximum heat transport capabilities. Even so, FC-84, the lowest saturation temperature fluid tested, shows marginal improvement in the heat transfer at low operating temperatures. All of the tested Fluorinert TM liquids offer the advantage of being dielectric fluids, which may be better suited for sensitive electronics cooling applications and were all found to provide adequate thermal performance up to approximately 30-50 W after which liquid entrainment compromised their performance.

  17. Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Mariangela Toledo Barbino

    2011-08-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

  18. Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha

    OpenAIRE

    Sampaio,Regynaldo A; Ramos,Sílvio J; Guilherme,Denílson O; Costa,Cândido A da; Fernandes,Luiz Arnaldo

    2008-01-01

    Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC) e pó de rocha de granito (RG) como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC) e pó de rocha de granito (RG): T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% ...

  19. Grau de moagem dos alimentos em rações para a tilápia do Nilo (Oreochromis niloticus durante o período de reversão sexual - DOI: 10.4025/actascianimsci.v27i1.1245 Milling degree of feed in ration for Nile tilapia (Oreochromis niloticus larvae during sexual reversion phase - DOI: 10.4025/actascianimsci.v27i1.1245

    Directory of Open Access Journals (Sweden)

    Robie Allan Bombardelli

    2005-03-01

    Full Text Available O experimento avaliou o efeito de diferentes graus de moagem dos alimentos sobre o desempenho de larvas de tilápia do Nilo no período de reversão sexual. O delineamento experimental foi inteiramente casualizado com 4 tratamentos e 6 repetições. Os tratamentos foram os graus de moagem dos alimentos em peneira de malhas de 0,25; 0,50; 0,70 e 1,00 mm. Utilizou-se uma ração de modo a atender às necessidades nutricionais da espécie. Foram avaliados peso (PFM, comprimento (CFM, ganho de peso diário (GPD, fator de condição (FC e sobrevivência (S. Os dados foram submetidos à ANOVA e, à análise de regressão em caso de evidência de diferença significativa (P = 0,05. Apenas PFM, GPD e FC apresentaram efeito dos tratamentos, mostrando efeito quadrático (P This work evaluated the effect of different milling degree of feeds on Nile tilapia performance during sex reversal period. A completely randomized design with four treatments and six replicates was utilized. The treatments were the milling degree of feed by 0.25, 0.50, 0.70, and 1.00 mm screen. The diets used fulfilled larvae necessity. Data of weight (W, length (L, daily gain weight (DGW, factor condition (FC and survival (S were evaluated. Data were submitted to ANOVA and regression analysis in case of significant difference were detected (P = 0.05. Only W, DGW and FC presented significant difference between treatments, showing a quadratic effect (P < 0.05 and better results to 0.60, 0.60 and 0.63 mm of feed milling degree, respectively. Diet with milling degree of 0.60 mm screen was recommended to Nile tilapia reversion phase

  20. Discussion on the tropospheric concentrations of FC21

    Energy Technology Data Exchange (ETDEWEB)

    Crescentini, G.; Mangani, F.; Mastrogiamcomo, A.R.; Cappiello, A.; Bruner, F.

    1986-01-01

    FC21 tropospheric mixing ratios measured in air samples collected at different locations in the world are presented. Results of a campaign carried out at two locations in the Sahara desert where FC21 and FC11 mixing ratios were simultaneously determined in 180 samples are also shown. Though scattered high values have been found, the average background concentration of FC21 ranged between 0 and 1 pptv. 9 references, 1 figure, 2 tables.

  1. Esophageal contractions in type 3 achalasia esophagus: simultaneous or peristaltic?

    Science.gov (United States)

    Kim, Tae Ho; Patel, Nirali; Ledgerwood-Lee, Melissa; Mittal, Ravinder K

    2016-05-01

    Absence of peristalsis and impaired relaxation of lower esophageal sphincter are the hallmarks of achalasia esophagus. Based on the pressurization patterns, achalasia has been subdivided into three subtypes. The goal of our study was to evaluate the esophageal contraction pattern and bolus clearance in type 3 achalasia esophagus. High-resolution manometry (HRM) recordings of all patients diagnosed with achalasia esophagus in our center between the years 2011 and 2013 were reviewed. Recordings of 36 patients with type 3 achalasia were analyzed for the characteristics of swallow-induced "simultaneous esophageal contraction." The HRM impedance recordings of 14 additional patients with type 3 achalasia were analyzed for bolus clearance from the impedance recording. Finally, the HRM impedance along with intraluminal ultrasound imaging was conducted in six patients to further characterize the simultaneous esophageal contractions. Among 187 achalasia patients, 30 were type 1, 121 type 2, and 36 type 3. A total of 434 swallows evaluated in type 3 achalasia patients revealed that 95% of the swallow-induced contractions met criteria for simultaneous esophageal contraction, based on the onset of contraction. Interestingly, the peak and termination of the majority of simultaneous esophageal contractions were sequential. The HRM impedance revealed that 94% of the "simultaneous contractions" were associated with complete bolus clearance. Ultrasound image analysis revealed that baseline muscle thickness of patients in type 3 achalasia is larger than normal but the pattern of axial shortening is similar to that in normal subjects. The majority of esophageal contractions in type 3 achalasia are not true simultaneous contractions because the peak and termination of contraction are sequential and they are associated with complete bolus clearance.

  2. Structural insights into the interaction of human IgG1 with FcγRI: no direct role of glycans in binding

    Energy Technology Data Exchange (ETDEWEB)

    Oganesyan, Vaheh, E-mail: oganesyanv@medimmune.com; Mazor, Yariv; Yang, Chunning; Cook, Kimberly E.; Woods, Robert M. [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States); Ferguson, Andrew [AstraZeneca Pharmaceuticals, 35 Gatehouse Drive, Mailstop E3, Waltham, MA 02451 (United States); Bowen, Michael A.; Martin, Tom; Zhu, Jie; Wu, Herren; Dall’Acqua, William F., E-mail: oganesyanv@medimmune.com [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States)

    2015-10-31

    In an effort to identify the critical structural features responsible for the high-affinity interaction of IgG1 Fc with FcγRI, the structure of the corresponding complex was solved at a resolution of 2.4 Å. The three-dimensional structure of a human IgG1 Fc fragment bound to wild-type human FcγRI is reported. The structure of the corresponding complex was solved at a resolution of 2.4 Å using molecular replacement; this is the highest resolution achieved for an unmutated FcγRI molecule. This study highlights the critical structural and functional role played by the second extracellular subdomain of FcγRI. It also explains the long-known major energetic contribution of the Fc ‘LLGG’ motif at positions 234–237, and particularly of Leu235, via a ‘lock-and-key’ mechanism. Finally, a previously held belief is corrected and a differing view is offered on the recently proposed direct role of Fc carbohydrates in the corresponding interaction. Structural evidence is provided that such glycan-related effects are strictly indirect.

  3. Identification of antibody glycosylation structures that predict monoclonal antibody Fc-effector function.

    Science.gov (United States)

    Chung, Amy W; Crispin, Max; Pritchard, Laura; Robinson, Hannah; Gorny, Miroslaw K; Yu, Xiaojie; Bailey-Kellogg, Chris; Ackerman, Margaret E; Scanlan, Chris; Zolla-Pazner, Susan; Alter, Galit

    2014-11-13

    To determine monoclonal antibody (mAb) features that predict fragment crystalizable (Fc)-mediated effector functions against HIV. Monoclonal antibodies, derived from Chinese hamster ovary cells or Epstein-Barr virus-immortalized mouse heteromyelomas, with specificity to key regions of the HIV envelope including gp120-V2, gp120-V3 loop, gp120-CD4(+) binding site, and gp41-specific antibodies, were functionally profiled to determine the relative contribution of the variable and constant domain features of the antibodies in driving robust Fc-effector functions. Each mAb was assayed for antibody-binding affinity to gp140(SR162), antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and for the ability to bind to FcγRIIa, FcγRIIb and FcγRIIIa receptors. Antibody glycan profiles were determined by HPLC. Neither the specificity nor the affinity of the mAbs determined the potency of Fc-effector function. FcγRIIIa binding strongly predicted ADCC and decreased galactose content inversely correlated with ADCP, whereas N-glycolylneuraminic acid-containing structures exhibited enhanced ADCP. Additionally, the bi-antenary glycan arm onto which galactose was added predicted enhanced binding to FcγRIIIa and ADCC activity, independent of the specificity of the mAb. Our studies point to the specific Fc-glycan structures that can selectively promote Fc-effector functions independently of the antibody specificity. Furthermore, we demonstrated antibody glycan structures associated with enhanced ADCP activity, an emerging Fc-effector function that may aid in the control and clearance of HIV infection.

  4. Comportamento ingestivo de ovinos alimentados com dietas compostas de silagem de capim-elefante amonizada ou não e subprodutos agroindustriais Ingestive behaviour of sheep fed with ammoniated or non-ammoniated elephantgrass silage and agro industrial by-products

    Directory of Open Access Journals (Sweden)

    Gleidson Giordano Pinto de Carvalho

    2006-08-01

    Full Text Available Foram estudados os efeitos do uso de silagem de capim-elefante amonizada ou não com uréia (5% na base da MS e da substituição do concentrado (milho e farelo de soja por farelo de cacau (FC ou torta de dendê (TD na dieta sobre o comportamento ingestivo de ovinos Santa Inês. Dezoito ovinos machos não-castrados (peso médio inicial de 22,62 kg, alojados em baias individuais, foram distribuídos em delineamento experimental inteiramente casualizado, com seis tratamentos, dois volumosos (silagem de capim-elefante amonizada ou não com uréia e três níveis de substituição do concentrado (milho + farelo de soja por farelo de cacau ou torta de dendê (0% FC e TD, 40% FC e 40% TD na dieta, fornecida na proporção de 60:40 volumoso:concentrado. O período experimental foi de 78 dias, sendo 15 dias destinados à adaptação dos animais às dietas. Os animais foram observados a cada cinco minutos, durante dois períodos de 24 horas/dia, no final do período experimental. Foram registrados o tempo despendido em alimentação, ruminação e ócio e o número e o tempo de mastigações merícicas por bolo ruminado. Não houve diferença entre os tempos de alimentação, ruminação e ócio. A amonização do capim-elefente e a inclusão do farelo de cacau no concentrado aumentaram a eficiência de ruminação, mas a maioria dos parâmetros do comportamento ingestivo avaliados não sofreu alterações.The effects of feeding elephantgrass silage ammoniated or not with urea (5% DM basis and the concentrate replacement (corn and soybean meal by cocoa meal (CM or palm cake (PC on the ingestive behaviour of 18 Santa Inês non-castrated male sheep averaging 22.62 kg of initial body weight were studied. The animals were allotted to individual pensas a completely randomized design with six treatments, two roughages (elephantgrass silage ammoniated with urea or not and three concentrate replacement level with by cocoa meal or palm cake (0% CM and PC, 40% CM

  5. Debt renegotiation with incomplete contract

    Directory of Open Access Journals (Sweden)

    Paulo de Melo Jorge Neto

    2005-09-01

    Full Text Available A debt contract usually does not include a provision about renegotiation. The right to seize the borrower’s asset and the rules of this process are usually stipulated in the contract. Such a promise not to renegotiate is not credible since renegotiation can mitigate the dead-weight loss of liquidating insolvent borrowers. Once the initial contract may not consider the renegotiation procedure and renegotiation may occur, this paper investigates why a complete contract is not offered. It shows that the lender does not need to stipulate the renegotiation procedure on the initial contract because he is indifferent about committing or not to the terms of a contract. This indicates that a complete contract gives the lender the same expected return as an incomplete contract, in which the renegotiation process is determined after the occurrence of default.Um contrato de débito geralmente não inclui uma cláusula sobre renegociação. O direito de liquidar os ativos do tomador e as regras do processo são habitualmente estipuladas no contrato. Tal promessa de não renegociar não é crível, já que a renegociação pode mitigar a perda bruta de se liquidar tomadores insolventes. Uma vez que o contrato inicial pode não considerar os procedimentos de renegociação, e esta pode, de fato, vir a ocorrer, este artigo investiga a razão de um contrato completo não ser ofertado. Mostra-se que o emprestador não precisa estipular os procedimentos de renegociação no contrato inicial porque ele é indiferente entre se comprometer ou não aos termos do contrato. Isto indica que um contrato completo dá ao emprestador o mesmo retorno esperado de um contrato incompleto, no qual os procedimentos de renegociação são determinados após a declaração de default.

  6. Final Report: Performance Engineering Research Institute

    Energy Technology Data Exchange (ETDEWEB)

    Mellor-Crummey, John [Rice Univ., Houston, TX (United States)

    2014-10-27

    This document is a final report about the work performed for cooperative agreement DE-FC02-06ER25764, the Rice University effort of Performance Engineering Research Institute (PERI). PERI was an Enabling Technologies Institute of the Scientific Discovery through Advanced Computing (SciDAC-2) program supported by the Department of Energy's Office of Science Advanced Scientific Computing Research (ASCR) program. The PERI effort at Rice University focused on (1) research and development of tools for measurement and analysis of application program performance, and (2) engagement with SciDAC-2 application teams.

  7. Traces of pFc' in IVIG interact with human IgG Fc domains and counteract aggregation

    NARCIS (Netherlands)

    Rispens, Theo; Himly, Martin; Ooievaar-de Heer, Pleuni; den Bleker, Tamara H.; Aalberse, Rob C.

    2010-01-01

    To prevent multimer formation, intravenous immunoglobulin (IVIG) is often treated with traces of pepsin. So far, the mechanism behind this treatment has been unclear. Recently, we reported that human IgG4 binds other IgG molecules via Fc-Fc interactions. Here we show that IVIG treated with traces of

  8. Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge

    Science.gov (United States)

    Konduru, Krishnamurthy; Shurtleff, Amy C.; Bradfute, Steven B.; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

    2016-01-01

    Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105−106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

  9. Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

    Science.gov (United States)

    Konduru, Krishnamurthy; Shurtleff, Amy C; Bradfute, Steven B; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

    2016-01-01

    Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

  10. Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

    Directory of Open Access Journals (Sweden)

    Krishnamurthy Konduru

    Full Text Available Ebola virus (EBOV, a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data

  11. Microgrid Design, Development and Demonstration - Final Report for Phase I and Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Bose, Sumit [GE Global Research Center, Niskayuna, NY (United States); Krok, Michael [GE Global Research Center, Niskayuna, NY (United States)

    2011-02-08

    This document constitutes GE’s final report for the Microgrid Design, Development and Demonstration program for DOE’s Office of Electricity Delivery and Energy Reliability, Award DE-FC02-05CH11349. It contains the final report for Phase I in Appendix I, and the results the work performed in Phase II. The program goal was to develop and demonstrate a Microgrid Energy Management (MEM) framework for a broad set of Microgrid applications that provides unified controls, protection, and energy management. This project contributed to the achievement of the U.S. Department of Energy’s Renewable and Distributed Systems Integration Program goals by developing a fully automated power delivery microgrid network that: - Reduces carbon emissions and emissions of other air pollutants through increased use of optimally dispatched renewable energy, - Increases asset use through integration of distributed systems, - Enhances reliability, security, and resiliency from microgrid applications in critical infrastructure protection, constrained areas of the electric grid, etc. - Improves system efficiency with on-site, distributed generation and improved economic efficiency through demand-side management.

  12. Contract Attorneys Course Deskbook. Volume 1

    Science.gov (United States)

    2007-06-21

    included in a contract in violation of statutory or regulatory criteria will be read out of a contract. Empresa de Viacao Terceirense, ASBCA No. 49827...for upward and downward revision of the stated contract price upon the occurrence of specified contingencies. See Transportes Especiales de ...4th Infantry Division, Fort Hood Texas, 2002-2005; Assistant Operations Officer/Test Control Officer, Military Entrance Processing Station, Des

  13. Chicken IgY Fc expressed by Eimeria mitis enhances the immunogenicity of E. mitis.

    Science.gov (United States)

    Qin, Mei; Tang, Xinming; Yin, Guangwen; Liu, Xianyong; Suo, Jingxia; Tao, Geru; Ei-Ashram, Saeed; Li, Yuan; Suo, Xun

    2016-03-21

    Eimeria species are obligate intracellular apicomplexan parasites, causing great economic losses in the poultry industry. Currently wild-and attenuated- type anticoccidial vaccines are used to control coccidiosis. However, their use in fast growing broilers is limited by vaccination side effects caused by medium and/or low immunogenic Eimeria spp. There is, therefore, a need for a vaccine with high immunogenicity for broilers. The avian yolk sac IgY Fc is the avian counterpart of the mammalian IgG Fc, which enhances immunogenicity of Fc-fusion proteins. Here, we developed a stable transgenic Eimeria mitis expressing IgY Fc (Emi.chFc) and investigated whether the avian IgY Fc fragment enhances the immunogenicity of E. mitis. Two-week-old broilers were immunized with either Emi.chFc or wild type Eimeria and challenged with wild type E. mitis to analyze the protective properties of transgenic Emi.chFc. Chickens immunized with Emi.chFc had significantly lower oocyst output, in comparison with PBS, mock control (transgenic E. mitis expressing HA1 from H9N2 avian influenza virus) and wildtype E. mitis immunized groups after challenge, indicating that IgY Fc enhanced the immunogenicity of E. mitis. Our findings suggest that IgY Fc-expressing Eimeria may be a better coccidiosis vaccine, and transgenic Eimeria expressing Fc-fused exogenous antigens may be used as a novel vaccine-delivery vehicle against a wide variety of pathogens.

  14. Relevancia de los diferentes momentos del juego y de las acciones a balón parado (ABP en los rendimientos del FC Barcelona y Real Madrid durante la liga nacional de fútbol profesional 2011/12

    Directory of Open Access Journals (Sweden)

    Xavier Planes i Fontestad

    2015-08-01

    Full Text Available El estudio se centra en la relevancia de las fases dinámicas y estáticas en los rendimientos del FC Barcelona y Real Madrid. Utilizamos la metodología observacional con el fin de tratar de asociar los diferentes Momentos o Fases del juego (MJ y las Acciones a Balón Parado (ABP con la obtención de cada uno de los goles. Para conseguirlo, hemos creado un instrumento de observación ad hoc (IOX y hemos utilizado dos instrumentos de registro (LINCE y MOTS. Para el análisis de los datos del registro y la obtención de resultados, hemos utilizado las técnicas de comparación de proporciones con el software Statgraphics, habiendo encontrado, inicialmente, diferencias significativas entre los dos equipos únicamente en la fase defensiva.

  15. Rapid polyclonal desensitization with antibodies to IgE and FcεRIα.

    Science.gov (United States)

    Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Lewkowich, Ian; Morris, Suzanne C; Finkelman, Fred D

    2013-06-01

    Rapid desensitization, a procedure in which persons allergic to an antigen are treated at short intervals with increasing doses of that antigen until they tolerate a large dose, is an effective, but risky, way to induce temporary tolerance. We wanted to determine whether this approach can be adapted to suppress all IgE-mediated allergies in mice by injecting serially increasing doses of monoclonal antibodies (mAbs) to IgE or FcεRIα. Active and passive models of antigen- and anti-IgE mAb-induced IgE-mediated anaphylaxis were used. Mice were desensitized with serially increasing doses of anti-IgE mAb, anti-FcεRIα mAb, or antigen. Development of shock (hypothermia), histamine and mast cell protease release, cytokine secretion, calcium flux, and changes in cell number and FcεRI and IgE expression were evaluated. Rapid desensitization with anti-IgE mAb suppressed IgE-mediated immediate hypersensitivity; however, some mice developed mild anaphylaxis during desensitization. Rapid desensitization with anti-FcεRIα mAb that only binds FcεRI that is not occupied by IgE suppressed both active and passive IgE-mediated anaphylaxis without inducing disease. It quickly, but temporarily, suppressed IgE-mediated anaphylaxis by decreasing mast cell signaling through FcεRI, then slowly induced longer lasting mast cell unresponsiveness by removing membrane FcεRI. Rapid desensitization with anti-FcεRIα mAb was safer and longer lasting than rapid desensitization with antigen. A rapid desensitization approach with anti-FcεRIα mAb safely desensitizes mice to IgE-mediated anaphylaxis by inducing mast cell anergy and later removing all mast cell IgE. Rapid desensitization with an anti-human FcεRIα mAb may be able to prevent human IgE-mediated anaphylaxis. Copyright © 2013 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.

  16. Administrative contracts

    Directory of Open Access Journals (Sweden)

    Vukićević-Petković Milica

    2015-01-01

    Full Text Available Administrative contracts are a special type of contract where usually one of the contracting parties is a public law body and which is concluded for the performance of public service and the realization of a public interest. They go a long way since its inception to its eventual final acceptance of all the legal systems. One of the enduring characteristics of this type of contract is their disquised or unnoticed existence. This is why only monitoring their development may lead to a complete understanding of the importance and essence of this institution as well as the need for its complete legal regulation.

  17. Firm Reorganization : Social Control or Social Contract?

    NARCIS (Netherlands)

    Aalbers, Hendrik Leendert; Dolfsma, Wilfred; Blinde-Leerentveld, Rowan

    Firm reorganizations deeply affect employees. Management can reorganize in different ways, focusing on costs or acknowledging the involvement of employees. The latter implies following a social contract that complements incomplete (formal) labor contracts. Little is known about how the way in which

  18. Vermicompostagem de lodo de esgoto urbano e bagaço de cana-de-açúcar Vermicomposting of urban sewage sludge and sugarcane bagasse

    Directory of Open Access Journals (Sweden)

    Carlos D. da Silva

    2002-12-01

    Full Text Available Com o objetivo de se avaliar alterações químicas no substrato orgânico no decorrer do processo de vermicompostagem de diferentes combinações de lodo de esgoto urbano (LEU com bagaço de cana-de-açúcar (BC, além de sua qualidade final como adubo orgânico, realizou-se um experimento em laboratório e campo. Os vermicompostos foram obtidos a partir dos tratamentos T1 = 150 kg de LEU; T2 = 121,6 kg de LEU + 97,30 kg de BC; T3 = 59 kg de LEU + 97,30 kg de BC; T4 = 35,5 kg de LEU + 97,30 kg de BC e T5 = 23,10 kg de LEU + 97,30 kg de BC. Para a realização do processo de vermicompostagem, foram utilizadas minhocas vermelhas-da-Califórnia (Eisenia fetida. As características químicas determinadas nos vermicompostos produzidos indicaram que os mesmos podem ser utilizados como adubo orgânico, principalmente no que se refere ao conteúdo de matéria orgânica, pH, relação C/N, concentração de nitrogênio e fósforo. As concentrações de metais pesados situaram-se abaixo dos limites de toxicidade, considerados pela legislação internacional. Aumento da proporção de LEU como substrato proporcionou aumento na concentração final de N, Ca e Mg, diminuídas de K.The purpose of the present study was to evaluate the chemical alterations in the substrate with time of the vermicomposting involving different combinations of urban sewage sludge (USS and sugarcane bagasse (SB, besides it's quality as organic fertilizer. The vermicomposts were obtained from the treatments T1= 150 kg of USS; T2 = 121.6 kg of USS + 97.30 kg of SB; T3 = 59 kg of USS + 97.30 kg of SB; T4 = 35.5 kg of USS + 97.30 kg of SB; T5= 23.10 kg of USS + 97.30 kg of SB. For the vermicomposting process, Red-California earthworm (Eisenia fetida was utilized. Chemical characteristics determined in the vermicomposts indicate that it can be used as organic fertilizer, mainly with regard to organic matter content, pH, C/N ratio, nitrogen and phosphorus levels. Heavy metal

  19. ADVANCED COMPRESSOR ENGINE CONTROLS TO ENHANCE OPERATION, RELIABILITY AND INTEGRITY

    Energy Technology Data Exchange (ETDEWEB)

    Gary D. Bourn; Jess W. Gingrich; Jack A. Smith

    2004-03-01

    This document is the final report for the ''Advanced Compressor Engine Controls to Enhance Operation, Reliability, and Integrity'' project. SwRI conducted this project for DOE in conjunction with Cooper Compression, under DOE contract number DE-FC26-03NT41859. This report addresses an investigation of engine controls for integral compressor engines and the development of control strategies that implement closed-loop NOX emissions feedback.

  20. The concession contracts assignment: general issues and controversies; A cessao de direitos e obrigacoes no contrado de concessao: aspectos gerais e questoes controversas

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, Renata Gualberto Cordeiro [PETROBRAS, Rio de Janeiro, RJ (Brazil)

    2008-07-01

    Considering the activities of exploration and production of oil and natural gas and the concession regimen applicable to them in Brazil, the assignment of rights and obligations of the concession contract is analyzed from the points of view of the Petroleum Law and the contract itself. This paper intend to address the legal aspects that support the general legal authorization and the rules of the concession contract, as well as the role of ANP in the approval of the transfer and in the development of technical rules, regarding its function as a regulatory agency. Two controversial issues, the transfer with retroactive effects and the transfer of part of the concession area, are analyzed in light of the general features of the transfer of rights and obligations. Finally, the 'cessao de fato' and its consequences will be considered for the study of assignment of rights with retroactive effects and the operations of sole risk.. (author)

  1. Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function.

    Science.gov (United States)

    Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela

    2016-02-05

    The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry

  2. Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function*

    Science.gov (United States)

    Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela

    2016-01-01

    The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823

  3. El Señor de los Anillos. El retorno del Rey", soberbio final de la Trilogía

    OpenAIRE

    Alonso, Juan

    2015-01-01

    The Lord of the Rings. The Return of the King (2003) culmina de forma magistral la trilogía que había iniciado apoteósicamente The Fellowship of the Ring (2001) y continuado con The Two Towers (2002). En ella podemos ver el desarrollo de las dos historias principales que se habían originado tras la división de La Compañía en el final de la primera entrega: por un lado, Sam y Frodo con la misión original de destruir el Anillo; por el otro, Aragorn, Legolas, Gimli, Pippin, Merry y Gandalf, que ...

  4. Dicty_cDB: FC-AJ15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

  5. 25 CFR 900.133 - Does the declination process or the Contract Dispute Act apply to construction contract...

    Science.gov (United States)

    2010-04-01

    ...-DETERMINATION AND EDUCATION ASSISTANCE ACT Construction § 900.133 Does the declination process or the Contract... 25 Indians 2 2010-04-01 2010-04-01 false Does the declination process or the Contract Dispute Act apply to construction contract amendments proposed either by an Indian tribe or tribal organization or...

  6. Desempenho produtivo de Pseudoplatystoma corruscans estocados em sistemas de criação: semi-intensivo (viveiro escavado e intensivo (tanque-rede Growth performance of Pseudoplatystoma corruscans stocked in rearing systems: semi-intensive (ponds and intensive (cages

    Directory of Open Access Journals (Sweden)

    Andressa Daniela de Sousa Liranço

    2011-03-01

    were: temperature = 24.08°C; pH=6.89; dissolved oxygen = 7.57mg L-1. The values of mean final length (P=74.07±4.34cm; C=70.33±5.02cm and final weight (P=3.41±0.52kg; C=2.94±0.60kg they showed similar development in both systems. Means of factor condition - K - (0.009-0.036; daily weight gain - DWG - (9.29g day-1-8.95g day-1; feed conversion- FC - (3.09-4.15; Total ration consume - TRC - (29.6g day-1-74.16 g day-1; growing index - IC - (0.219-0.215; survival - S - (97.33-90.67% for P e C, respectively. Through the variance of analysis can be verified that there are significative interactions of the parameters between the culture systems and months (P<0.05. The produced weight of fish was R$ 8.76 (US$ 2.85 and R$ 8.73 (US$ 2.33 for P and C. Although P showed best performance during the period and economic vantage, the growing index demonstrated that both systems had similar development.

  7. 24 CFR 891.595 - HAP contract extension or renewal.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract extension or renewal... Handicapped-Section 8 Assistance § 891.595 HAP contract extension or renewal. Upon expiration of the term of the HAP contract, HUD and the Borrower may agree (subject to available funds) to extend the term of...

  8. Bacteria and viruses modulate FcεRI-dependent mast cell activity 

    Directory of Open Access Journals (Sweden)

    Aleksandra Słodka

    2013-03-01

    Full Text Available Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation. 

  9. Generation of high-affinity, internalizing anti-FGFR2 single-chain variable antibody fragment fused with Fc for targeting gastrointestinal cancers.

    Science.gov (United States)

    Borek, Aleksandra; Sokolowska-Wedzina, Aleksandra; Chodaczek, Grzegorz; Otlewski, Jacek

    2018-01-01

    Fibroblast growth factor receptors (FGFRs) are promising targets for antibody-based cancer therapies, as their substantial overexpression has been found in various tumor cells. Aberrant activation of FGF receptor 2 (FGFR2) signaling through overexpression of FGFR2 and/or its ligands, mutations, or receptor amplification has been reported in multiple cancer types, including gastric, colorectal, endometrial, ovarian, breast and lung cancer. In this paper, we describe application of the phage display technology to produce a panel of high affinity single chain variable antibody fragments (scFvs) against the extracellular ligand-binding domain of FGFR2 (ECD_FGFR2). The binders were selected from the human single chain variable fragment scFv phage display libraries Tomlinson I + J and showed high specificity and binding affinity towards human FGFR2 with nanomolar KD values. To improve the affinity of the best binder selected, scFvF7, we reformatted it to a bivalent diabody format, or fused it with the Fc region (scFvF7-Fc). The scFvF7-Fc antibody construct presented the highest affinity for FGFR2, with a KD of 0.76 nM, and was selectively internalized into cancer cells overexpressing FGFR2, Snu-16 and NCI-H716. Finally, we prepared a conjugate of scFvF7-Fc with the cytotoxic drug monomethyl-auristatin E (MMAE) and evaluated its cytotoxicity. The conjugate delivered MMAE selectively to FGFR2-positive tumor cells. These results indicate that scFvF7-Fc-vcMMAE is a highly potent molecule for the treatment of cancers with FGFR2 overexpression.

  10. Bloqueio do plexo braquial pela via posterior com uso de neuroestimulador e ropivacaína a 0,5% Bloqueo del plexo braquial por la vía posterior con el uso de neuroestimulador y ropivacaína a 0,5% Posterior brachial plexus block with nerve stimulator and 0.5% ropivacaine

    Directory of Open Access Journals (Sweden)

    Lúcia Beato

    2005-08-01

    , scheduled for shoulder, clavicle and proximal humerus surgery, who were submitted to posterior brachial plexus block with the aid of a nerve stimulator starting at 1 mA. When adequate muscle contraction was obtained, the current was decreased to 0.5 mA. If the response persisted, 40 mL of 0.5% ropivacaine was injected. The following parameters were evaluated: block onset, analgesia and motor block duration, complications and side effects. RESULTS: Blockade was effective in 20 out of 22 patients, mean onset time was 15.52 min, mean surgical duration was 1.61 h. Mean analgesia duration was 15.85 h and mean motor block duration was 11.16 h. There were no clinical signs or symptoms of toxic effects of local anesthetics and no patient presented side effects. CONCLUSIONS: Posterior brachial plexus block with the aid of nerve stimulator provides effective anesthesia, is very comfortable for patients and easy to perform.

  11. FcεRI γ-Chain Negatively Modulates Dectin-1 Responses in Dendritic Cells

    Directory of Open Access Journals (Sweden)

    Yi-Gen Pan

    2017-10-01

    Full Text Available The inhibitory effect of immunoreceptor tyrosine-based activation motif (ITAM-containing adapters DAP12 and FcεRI γ-chain (FcRγ has been found in many immune functions. Herein, we have further explored the role of these adapters in C-type lectin receptors response. We identified that FcRγ, but not DAP12, could negatively regulate the Dectin-1 responses in dendritic cells (DCs. Loss of Fcor both DAP12 and FcRγ enhanced the maturation and cytokine production in DCs upon Dectin-1 activation compared to normal cells, whereas DCs lacking only DAP12 showed little changes. In addition, increments of T cell activation and T helper 17 polarization induced by FcRγ-deficient DCs were observed both in vitro and in vivo. Examining the Dectin-1 signaling, we revealed that the activations of several signaling molecules were augmented in FcRγ-deficient DCs stimulated with Dectin-1 ligands. Furthermore, we demonstrated that the association of phosphatases SHP-1 and PTEN with FcRγ may contribute to the negative regulation of FcRγ in Dectin-1 activation in DCs. These results extend the inhibitory effect of ITAM-containing adapters to Dectin-1 response in immune functions, even though Dectin-1 contains an ITAM-like intracellular domain. According to the role of Dectin-1 in responding to microbes and tumor cells, our finding may have applications in the development of vaccine and cancer therapy.

  12. 16 CFR 700.8 - Warrantor's decision as final.

    Science.gov (United States)

    2010-01-01

    ... jurisdiction over suits for breach of warranty and service contract. ... decision as final. A warrantor shall not indicate in any written warranty or service contract either... party is final or binding in any dispute concerning the warranty or service contract. Nor shall a...

  13. Usefulness of FC-TRIPLEX Chagas/Leish IgG1 as confirmatory assay for non-negative results in blood bank screening of Chagas disease.

    Science.gov (United States)

    Campos, Fernanda Magalhães Freire; Repoles, Laura Cotta; de Araújo, Fernanda Fortes; Peruhype-Magalhães, Vanessa; Xavier, Marcelo Antônio Pascoal; Sabino, Ester Cerdeira; de Freitas Carneiro Proietti, Anna Bárbara; Andrade, Mariléia Chaves; Teixeira-Carvalho, Andréa; Martins-Filho, Olindo Assis; Gontijo, Célia Maria Ferreira

    2018-04-01

    A relevant issue in Chagas disease serological diagnosis regards the requirement of using several confirmatory methods to elucidate the status of non-negative results from blood bank screening. The development of a single reliable method may potentially contribute to distinguish true and false positive results. Our aim was to evaluate the performance of the multiplexed flow-cytometry anti-T. cruzi/Leishmania IgG1 serology/(FC-TRIPLEX Chagas/Leish IgG1) with three conventional confirmatory criteria (ELISA-EIA, Immunofluorescence assay-IIF and EIA/IIF consensus criterion) to define the final status of samples with actual/previous non-negative results during anti-T. cruzi ELISA-screening in blood banks. Apart from inconclusive results, the FC-TRIPLEX presented a weak agreement index with EIA, while a strong agreement was observed when either IIF or EIA/IIF consensus criteria were applied. Discriminant analysis and Spearman's correlation further corroborates the agreement scores. ROC curve analysis showed that FC-TRIPLEX performance indexes were higher when IIF and EIA/IIF consensus were used as a confirmatory criterion. Logistic regression analysis further demonstrated that the probability of FC-TRIPLEX to yield positive results was higher for inconclusive results from IIF and EIA/IIF consensus. Machine learning tools illustrated the high level of categorical agreement between FC-TRIPLEX versus IIF or EIA/IIF consensus. Together, these findings demonstrated the usefulness of FC-TRIPLEX as a tool to elucidate the status of non-negative results in blood bank screening of Chagas disease. Copyright © 2018. Published by Elsevier B.V.

  14. 34 CFR 97.118 - Applications and proposals lacking definite plans for involvement of human subjects.

    Science.gov (United States)

    2010-07-01

    ... Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.118 Applications and proposals lacking definite plans..., or contracts are submitted to departments or agencies with the knowledge that subjects may be...

  15. A 6-month study comparing efficacy, safety, and tolerability of the preservative-free fixed combination of tafluprost 0.0015% and timolol 0.5% versus each of its individual preservative-free components.

    Science.gov (United States)

    Pfeiffer, Norbert; Traverso, Carlo E; Lorenz, Katrin; Saarela, Ville; Liinamaa, Johanna; Uusitalo, Hannu; Astakhov, Yury; Boiko, Ernest; Ropo, Auli

    2014-12-01

    The efficacy, safety and tolerability of the preservative-free (PF) fixed combination (FC) of tafluprost 0.0015% and timolol 0.5% (once daily) were compared to those of the individual components (PF tafluprost 0.0015% once daily and PF timolol 0.5% twice daily) in patients with open-angle glaucoma or ocular hypertension inadequately controlled on prior timolol or prostaglandin monotherapy for 6 months. A stratified, double-masked, randomized, multicenter phase III study was conducted. A total of 189 prior timolol users were randomized within the timolol stratum (TS) to receive either FC (n = 95) or timolol 0.5% (TIM; n = 94). Furthermore, a total of 375 prior prostaglandin analog (PGA) users were randomized within the prostaglandin stratum (PS) to receive either FC (n = 188) or tafluprost 0.0015% (TAF; n = 187). To be eligible for participation in the study, the patients were required to have an intraocular pressure (IOP) of ≥22 mmHg when on timolol (TIM) or of ≥20 mmHg when on PGA in either treated eye at the screening and end-of-run-in visits. In addition to these, the study included visits at baseline, 2 and 6 weeks, 3 and 6 months and at a post-study visit. IOP was measured at 8 a.m., 10 a.m., 4 p.m., and 8 p.m. In the TS, a significant reduction from baseline IOP was seen with FC and TIM throughout the study. Average diurnal IOP change from baseline at month 3 was -8.55 mmHg (32%) for FC and -7.35 mmHg (28%) for TIM. The model-based treatment difference (FC-TIM) was -0.885 mmHg [95% confidence interval (CI) -1.745 to -0.024; p = 0.044] demonstrating the superiority of FC over TIM. In the PS, a significant reduction in IOP was seen with both FC and TAF throughout the study. The average diurnal IOP change from baseline at month 3 was -8.61 mmHg (33%) for FC and -7.23 mmHg (28%) for TAF. The model-based treatment difference (FC-TAF) was -1.516 mmHg (95% CI -2.044 to -0.988; p preservative-free fixed combination of tafluprost and

  16. Estudo comparativo do efeito de solução de NaF a 0,5%, através de bochecho, escovação e ambos, na prevenção da cárie dental A comparative study of the effect of a 0.5% NaF solution, used in mouthwashing or toothbrushing or both, in the prevention of dental caries

    Directory of Open Access Journals (Sweden)

    Roberto Augusto Castellanos

    1983-12-01

    Full Text Available Foi realizado estudo a fim de comparar o efeito na redução do ataque de cárie de uma solução de fluoreto de sódio, na concentração de 0,5% aplicada sob a forma de bochecho, escovação, escovação e bochecho, uma vez por semana, sob supervisão, durante um período escolar de 10 meses em 424 escolares de 9 a 10 anos de idade matriculados em cinco escolas estaduais do Estado de São Paulo (Brasil. As crianças foram distribuídas igualmente em três grupos experimentais e um grupo controle, de acordo com a idade dental (nº de superfícies de dentes permanentes irrompidas e experiência anterior de cárie (CPO-S. Foram examinadas 307 crianças e os resultados mostraram que houve uma redução, estatisticamente significante ao nível de 0,05, de ataque de cárie entre os grupos experimentais e controle, da ordem de 35,19% para o grupo de bochecho (grupo I, de 37,91% para o grupo de escovação (grupo II, e de 49,77% para o grupo de escovação e bochecho (grupo IV. Quando comparados os grupos experimentais entre si não houve diferenças estatisticamente significantes ao nível de 0,05.A comparative study of the anticariogenic effect of sodium fluoride solution, with a concentration of 0.5%, applied weekly and under supervision, in mouthwashing and toothbrushing, used independently and in combination, was carried out on 424 children of 9 and 10 years of age from five public schools in S. Paulo, Brazil, over a period of 10 school months. The children were equally divided into three experimental groups and one control group according to the dental age (number of erupted permanent teeth surfaces and history of caries (DMF-S. Three hundred and seven children were examined at the end of the study and the results show a statistically significant decrease at the 0.05 level, between the experimental groups and control group, in the incidence of caries - 35.19% for the mouthwashing group (Group I; 37.91% for the toothbrushing group (Group II; and

  17. Avaliação de desempenho da Agência Nacional de Vigilância Sanitária no modelo de contrato de gestão The Brazilian National Health Surveillance Agency performance evaluation at the management contract model

    Directory of Open Access Journals (Sweden)

    Elka Maltez de Miranda Moreira

    2010-11-01

    Full Text Available A Agência Nacional de Vigilância Sanitária (Anvisa é acompanhada pelo Ministério da Saúde mediante contrato de gestão, instrumento de avaliação de desempenho. Realizou-se estudo de caso mediante entrevistas semiestruturadas com atores selecionados e análise documental, objetivando descrever e analisar o modelo de avaliação de desempenho da Anvisa, com vistas à finalidade da instituição, de acordo com as seguintes categorias analíticas: formalização do contrato de gestão, instrumentos de avaliação, sujeito avaliador e desempenho institucional. As entrevistas semiestruturadas e a análise documental indicam que a Anvisa celebrou um contrato de gestão, em 1999, atualizado por quatro termos aditivos. O avaliador interno é representado pela Diretoria Colegiada e Núcleo de Assessoramento à Gestão Estratégica; o avaliador externo, por uma Comissão de Avaliação constituída pelo Ministério da Saúde. Identificaram-se três fases do modelo avaliativo: estruturação do novo modelo de gestão (1999-2000, legitimação ante o segmento produtivo (2001-2004 e ampliação da legitimação (2005. O melhor desempenho ocorreu em 2000 (86,05%, e o pior em 2004 (40,00%. Verificou-se que o modelo de avaliação pouco avançou em direção à finalidade institucional e aferição da efetividade das ações realizadas.The Brazilian National Health Surveillance Agency (Anvisa is supervised by the Ministry of Health by means of a management contract, a performance evaluation tool. This case study was aimed at describing and analyzing Anvisa's performance evaluation model based on the agency's institutional purpose, according to the following analytical categories: the management contract formalization, evaluation tools, evaluators and institutional performance. Semi-structured interviews and document analysis revealed that Anvisa signed only one management contract with the Ministry of Health in 1999, updated by four additive terms. The

  18. POTÊNCIA E CAPACIDADE ANAERÓBIA EM ATLETAS DE KARATE

    Directory of Open Access Journals (Sweden)

    Keith Sato Urbinati

    2011-01-01

    Full Text Available O objetivo do presente estudo foi verificar o nível de potência muscular, bem como a intensidade de esforço durante prova de potência e capacidade anaeróbia em atletas de Karate. Participaram do estudo treze karatekas especialistas em prova de kumitê (luta,sexo masculino, idade média de 20,7±3,79 anos. Realizou-se a avaliação de potência e capacidade anaeróbia (Wingate test, com coleta das variáveis fisiológicas:frequência cardíaca (FC, pressão arterial (PA e lactato sanguíneo (LAC de repouso, imediatamente após e em 5 min de recuperação. Para verificar se ocorrem diferenças nas variáveis fisiológicas durante o teste, realizou-se análise de variância, post hoc de Bonferronie (p?0,05. Verificou-se potência de pico(PP de 8,77 ± 0,99 W/kg-1, potência média (PM de 5,13± 0,49 W.kg-1 e % de fadiga de 50,5 ± 6,45%. Para as variáveis fisiológicas,a FC (F=9,79; p=0,00 pós-teste de Wingate foi estatisticamente maior e diferenteda FC de repouso e recuperação. Não foram encontradas diferenças nos níveis pressatórios e nas concentrações de LAC. Em relação aos valores de FC e LAC tais variáveis pós-teste não se apresentaram elevados. Os valores de potência anaeróbia estão de acordo com a necessidade da modalidade esportiva. Assim, verificou-se menores intensidades de esforço em teste de Wingate quando comparados a de situação real de competição. O nível de potência muscular parece estar adequado ao kumitê.

  19. The Fc-receptor III of cultured human monocytes. Structural similarity with FcRIII of natural killer cells and role in the extracellular lysis of sensitized erythrocytes

    NARCIS (Netherlands)

    Klaassen, R. J.; Ouwehand, W. H.; Huizinga, T. W.; Engelfriet, C. P.; von dem Borne, A. E.

    1990-01-01

    FcRIII is not present on peripheral blood monocytes, but becomes expressed upon culturing and can be demonstrated on tissue macrophages. We studied the expression of FcRIII of cultured monocytes in detail and compared its structure with FcRIII of neutrophils and NK cells. The cell density of FcRIII

  20. Estudo comparativo entre bupivacaína a 0,5% e mistura enantiomérica de bupivacaína (S75-R25 a 0,5% em anestesia peridural Estudio comparativo entre bupivacaína a 0,5% y mezcla enantiomérica de bupivacaína (S75-R25 a 0,5% en anestesia peridural Comparative study between 0.5% bupivacaine and 0.5% enantiomeric mixture of bupivacaine (S75-R25 in epidural anesthesia

    Directory of Open Access Journals (Sweden)

    Rosane Fossatti Gonçalves

    2003-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A mistura enantiomérica de bupivacaína (S75-R25 vem sendo empregada pela sua propriedade anestésica com menor toxicidade do que a bupivacaína racêmica. O objetivo deste estudo é comparar a bupivacaína a 0,5% com a mistura enantiomérica de bupivacaína a 0,5% (S75-R25 em anestesia peridural. MÉTODO: Foram incluídos no estudo 44 pacientes divididos em dois grupos (n=22 denominados de Bupivacaína e S75-R25. Os pacientes foram medicados com midazolam por via venosa. A anestesia peridural foi realizada no espaço L3-L4 ou L2-L3, e administrado 16 a 24 ml da solução do anestésico local. O grupo Bupivacaína recebeu bupivacaína a 0,5% com vasoconstritor. O grupo S75-R25 recebeu a mistura enantiomérica de bupivacaína a 0,5% com vasoconstritor. Foram avaliados a temperatura do membro inferior antes e após o bloqueio peridural, o tempo de latência do bloqueio, o tipo de alteração referida pelo paciente, possíveis falhas sensoriais, nível sensorial metamérico e o grau de bloqueio motor. Na sala de recuperação pós-anestésica, foi anotado o tempo de requisição do primeiro analgésico. RESULTADOS: Fizeram parte da avaliação final 41 pacientes. Os grupos foram demograficamente semelhantes. A dose per-operatória de midazolam, o volume de anestésico local por via peridural, o tempo de latência para a instalação do bloqueio, falhas sensoriais a picada da agulha, temperatura do membro inferior nos diferentes tempos, o tipo de sensação parestésica, e o nível anestésico em dermátomos foram semelhantes entre os grupos. O grau de bloqueio motor foi mais intenso para o grupo Bupivacaína, comparado ao grupo S75-R25 (p = 0,0117. O tempo para requisição do primeiro analgésico no período pós-operatório foi superior para o grupo S75-R25, comparado ao grupo Bupivacaína (596 ± 436 minutos versus 463 ± 270 minutos, respectivamente; p = 0,04572. A incidência de efeitos adversos foi semelhante entre

  1. Single chain Fc-dimer-human growth hormone fusion protein for improved drug delivery.

    Science.gov (United States)

    Zhou, Li; Wang, Hsuan-Yao; Tong, Shanshan; Okamoto, Curtis T; Shen, Wei-Chiang; Zaro, Jennica L

    2017-02-01

    Fc fusion protein technology has been successfully used to generate long-acting forms of several protein therapeutics. In this study, a novel Fc-based drug carrier, single chain Fc-dimer (sc(Fc) 2 ), was designed to contain two Fc domains recombinantly linked via a flexible linker. Since the Fc dimeric structure is maintained through the flexible linker, the hinge region was omitted to further stabilize it against proteolysis and reduce FcγR-related effector functions. The resultant sc(Fc) 2 candidate preserved the neonatal Fc receptor (FcRn) binding. sc(Fc) 2 -mediated delivery was then evaluated using a therapeutic protein with a short plasma half-life, human growth hormone (hGH), as the protein drug cargo. This novel carrier protein showed a prolonged in vivo half-life and increased hGH-mediated bioactivity compared to the traditional Fc-based drug carrier. sc(Fc) 2 technology has the potential to greatly advance and expand the use of Fc-technology for improving the pharmacokinetics and bioactivity of protein therapeutics. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Increase in neutrophil Fc gamma receptor I expression following interferon gamma treatment in rheumatoid arthritis.

    Science.gov (United States)

    Goulding, N J; Knight, S M; Godolphin, J L; Guyre, P M

    1992-04-01

    The therapeutic potential of interferon gamma (IFN gamma) in a number of disease states is still being explored, but progress is hampered by the lack of a suitable measure of in vivo biological activity. To assess the in vivo biological effects of recombinant human IFN gamma (rhIFN gamma), 14 patients were studied in a randomised, prospective, double blind, placebo controlled trial of this cytokine for the treatment of rheumatoid arthritis. The levels of Fc gamma receptors on peripheral blood neutrophils were measured at baseline and after 21 days of once daily, subcutaneous injections of rhIFN gamma or placebo. An induction of neutrophil Fc gamma receptor type I (Fc gamma RI) was seen in the group of patients receiving recombinant human rhIFN gamma but not in those receiving placebo. No change in the expression of Fc gamma RII or Fc gamma RIII was detected. The amount of induction of Fc gamma RI detected on the neutrophils of patients receiving rhIFN gamma did not correlate with clinical measures of response at either 21 days or at the end of the study (24 weeks). No significant clinical responses were observed in the rhIFN gamma group at these times. These data confirm that the reported in vitro effect of IFN gamma on human neutrophil Fc receptor expression can be reproduced in vivo.

  3. IAEA research contracts. Second annual report

    International Nuclear Information System (INIS)

    1962-01-01

    During the period in which the Agency's research programme has been operative, nearly 150 research contracts have been placed with institutions in 35 Member States. While considerable emphasis was placed initially on research of a more fundamental nature - as reflected by the summaries presented herein of work under contracts awarded in the early stages of the programme - recent policy has shifted the major emphasis toward research of a practical nature, as the results of this type of research are likely to be of more immediate interest to Member States, and particularly to the developing nations. In every case, the summary of the contractor's final report has been prepared by that member of the Agency's scientific staff who has been closely connected with that particular subject of research. Thus, the scientific data reported in the summary remain the responsibility of the contractor, the Agency being responsible for any additional observations. The reports of the following contracts are included: Research Contract No. 1, Factors controlling the distribution of fission products in the biosphere; Research Contract No. 4, The development of a method of non-destructive analysis to determine the U-235 and Pu content of irradiated fuel elements that are in storage under water and that have been out of the reactor for periods of more than one month; Research Contract No. 5, Non-destructive method for evaluating the U-235 and Pu content of irradiated fuel elements; Research Contract No. 19, Studies of contamination in local marine resources, and more specifically the determination of horizontal and vertical diffusion rates in Suruga Bay; Research Contract No. 22, A study of the uptake, accumulation and loss of radioactive material by marine bacteria; Research Contract No. 26, (a) Red cell life span in patients with congenital or acquired haemolytic anaemia using Cr-51 and pie-operative spleen scanning; (b) The aeriology of tropical iron deficiency anaemia using Fe-59 in

  4. IAEA research contracts. Second annual report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1962-07-01

    During the period in which the Agency's research programme has been operative, nearly 150 research contracts have been placed with institutions in 35 Member States. While considerable emphasis was placed initially on research of a more fundamental nature - as reflected by the summaries presented herein of work under contracts awarded in the early stages of the programme - recent policy has shifted the major emphasis toward research of a practical nature, as the results of this type of research are likely to be of more immediate interest to Member States, and particularly to the developing nations. In every case, the summary of the contractor's final report has been prepared by that member of the Agency's scientific staff who has been closely connected with that particular subject of research. Thus, the scientific data reported in the summary remain the responsibility of the contractor, the Agency being responsible for any additional observations. The reports of the following contracts are included: Research Contract No. 1, Factors controlling the distribution of fission products in the biosphere; Research Contract No. 4, The development of a method of non-destructive analysis to determine the U-235 and Pu content of irradiated fuel elements that are in storage under water and that have been out of the reactor for periods of more than one month; Research Contract No. 5, Non-destructive method for evaluating the U-235 and Pu content of irradiated fuel elements; Research Contract No. 19, Studies of contamination in local marine resources, and more specifically the determination of horizontal and vertical diffusion rates in Suruga Bay; Research Contract No. 22, A study of the uptake, accumulation and loss of radioactive material by marine bacteria; Research Contract No. 26, (a) Red cell life span in patients with congenital or acquired haemolytic anaemia using Cr-51 and pie-operative spleen scanning; (b) The aeriology of tropical iron deficiency anaemia using Fe-59 in

  5. Força muscular de atletas de voleibol de 9 a 18 anos através da dinamometria computadorizada Fuerza muscular de atletas de voleibol de 9 a 18 años a través de la dinamometria computarizada Muscular strength of 9-18-year old volleyball athletes through computational dynamometry

    Directory of Open Access Journals (Sweden)

    Patrícia Schneider

    2004-04-01

    Full Text Available O objetivo deste estudo foi descrever e comparar as forças musculares isométrica e isocinética em diferentes graus maturacionais de meninos e meninas atletas de voleibol. Participou do estudo um total de 66 crianças e adolescentes saudáveis, em treinamento esportivo competitivo. Dos 37 meninos, 10 eram pré-púberes (PP, 15 púberes (PU e 12 pós-púberes (PO. Das 29 meninas, 11 eram PP, 13 PU e 5 PO. Foi utilizado um dinamômetro computadorizado (Cybex Norm para medir a força isocinética de flexão do cotovelo (FC e de extensão de joelho (EJ nas velocidades de 60 e 90º.s-1. A força isométrica foi medida nos mesmos exercícios nos ângulos de 60 e 90º (FC, e 45 e 60º (EJ. Utilizou-se a ANOVA para comparações entre os gêneros e graus maturacionais, e o teste post hoc de Tuckey. O nível de significância considerado foi de p El objetivo de este estudio fué describir y comparar las fuerzas musculares isométrica e isocinética en diferentes grados maduracionales de niños y niñas atletas de voleibol. Participó del estudio un total de 66 niños y adolescentes, en tratamiento deportivo competitivo. De los 37 niños, 10 eran pre-púberes (PP, 15 púberes (PU y 12 post-púberes (PO. De las 29 niñas, 11 eran PP, 13 PU e 5 PO. Fué utilizado un dinamómetro computarizado (Cybex Norm para medir la fuerza isocinética de flexión de codo (FC y extensión de rodilla (EJ en las velocidades de 60 y 90º.s-1. La fuerza isométrica fue medida en los mismos ejercicios en los ángulos de 60 y 90º (FC, y 45 y 60º (EJ. Se utilizó la ANOVA para comparaciones entre los géneros y grados maduracionales y el test post hoc de Tuckey. El nivel de significancia considerado fue de p The objective of this work was to describe and to compare the isometric and isokinetic muscular strength at different maturational degree of boys and girls volleyball athletes. 66 healthy children and youth participated in the study in a competitive sportive training

  6. Effects of altered FcγR binding on antibody pharmacokinetics in cynomolgus monkeys

    Science.gov (United States)

    Leabman, Maya K; Meng, Y Gloria; Kelley, Robert F; DeForge, Laura E; Cowan, Kyra J; Iyer, Suhasini

    2013-01-01

    Antibody interactions with Fcγ receptors (FcγRs), like FcγRIIIA, play a critical role in mediating antibody effector functions and thereby contribute significantly to the biologic and therapeutic activity of antibodies. Over the past decade, considerable work has been directed towards production of antibodies with altered binding affinity to FcγRs and evaluation of how the alterations modulate their therapeutic activity. This has been achieved by altering glycosylation status at N297 or by engineering modifications in the crystallizable fragment (Fc) region. While the effects of these modifications on biologic activity and efficacy have been examined, few studies have been conducted to understand their effect on antibody pharmacokinetics (PK). We present here a retrospective analysis in which we characterize the PK of three antibody variants with decreased FcγR binding affinity caused by amino acid substitutions in the Fc region (N297A, N297G, and L234A/L235A) and three antibody variants with increased FcγRIIIA binding affinity caused by afucosylation at N297, and compare their PK to corresponding wild type antibody PK in cynomolgus monkeys. For all antibodies, PK was examined at a dose that was known to be in the linear range. Since production of the N297A and N297G variants in Chinese hamster ovary cells results in aglycosylated antibodies that do not bind to FcγRs, we also examined the effect of expression of an aglycosylated antibody, without sequence change(s), in E. coli. All the variants demonstrated similar PK compared with that of the wild type antibodies, suggesting that, for the six antibodies presented here, altered FcγR binding affinity does not affect PK. PMID:24492343

  7. Fc-receptors and surface immunoglobulins in cells of the hairy cell leukemia

    International Nuclear Information System (INIS)

    Rieber, E.P.; Linke, R.P.; Riethmueller, G.; Heyden, H.W. von; Waller, H.D.

    1976-01-01

    Using 125 I-labelled aggregated IgG in a quantitative assay a strong expression of Fc-receptors was found on the leukemic cells of a patient with hairy cell leukemia. The Fc-receptor activity on these cells was much higher than that on monocytes and B-lymphocytes from normal blood. Surface immunoglobulins were detected by radioautography using radioactively labelled (Fab') 2 -fragments of monospecific antibodies directed against immunoglobulin heavy chains. Prior to radioautography the cells were stained for the tartrate resistant acid phosphatase. It is found that all cells containing this enzyme bore delta-chains on their surface. On more than 90% of these cells a simultaneous expression of μ-chains was detected. γ-chains could only be demonstrated on cells which were negative for the tartrate resistant acid phosphatase; part of these cells, however, were hairy cells by morphological criteria. (orig.) [de

  8. Effect of trastuzumab interchain disulfide bond cleavage on Fcγ receptor binding and antibody-dependent tumour cell phagocytosis.

    Science.gov (United States)

    Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Ootsubo, Michiko; Izawa, Ken-ichi; Kohroki, Junya; Masuho, Yasuhiko

    2016-01-01

    The Fc domain of human IgG1 binds to Fcγ receptors (FcγRs) to induce effector functions such as phagocytosis. There are four interchain disulfide bonds between the H and L chains. In this study, the disulfide bonds within the IgG1 trastuzumab (TRA), which is specific for HER2, were cleaved by mild S-sulfonation or by mild reduction followed by S-alkylation with three different reagents. The cleavage did not change the binding activities of TRA to HER2-bearing SK-BR-3 cells. The binding activities of TRA to FcγRIIA and FcγRIIB were greatly enhanced by modification with mild reduction and S-alkylation with ICH2CONH2 or N-(4-aminophenyl) maleimide, while the binding activities of TRA to FcγRI and FcγRIIIA were decreased by any of the four modifications. However, the interchain disulfide bond cleavage by the different modifications did not change the antibody-dependent cell-mediated phagocytosis (ADCP) of SK-BR-3 cells by activated THP-1 cells. The order of FcγR expression levels on the THP-1 cells was FcγRII > FcγRI > FcγRIII and ADCP was inhibited by blocking antibodies against FcγRI and FcγRII. These results imply that the effect of the interchain disulfide bond cleavage on FcγRs binding and ADCP is dependent on modifications of the cysteine residues and the FcγR isotypes. © The Authors 2015. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  9. Alternatives of Treatment and Final Disposition of the Solid Hospital residuals; Alternativas de Tratamiento y Disposicion Final de los Residuos Solidos Hospitalarios

    Energy Technology Data Exchange (ETDEWEB)

    Meza Monge, K

    1998-07-01

    The current handling, treatment and final disposition of the hospital solid waste in Costa Rica are considered inadequate or at least insufficient. This situation represents a serious danger for the population's health and the environment, because they are exposed to infectious agents, toxic substances and even radioactive products that are generated among the residuals of the centers of health. This work, alternatives propose for the treatment and adequate final disposition of the solid waste produced in the hospitals of the country. They take into consideration the characteristics that present these residuals, the advantages and disadvantages of each one of the existent techniques and the technical and economic possibilities of the country. For this purpose, in first instance, a revision about the properties, the quality and the quantity of the solid waste produced by the national hospital centers was carried out. Also, a diagnostic of the current situation of the treatment and final disposition of these residuals in some of the most important hospitals of the country, as well as of the possibilities of physical space with that they count on was carried out. Then, the existent different treatment techniques and final disposition for the solid waste that comes from the centers of health are described, as well as their advantages and disadvantages and a comparative analysis of the same ones is carried out. The objective is completed, since alternatives of treatment and final disposition that are considered appropriate for this type of residuals are planned. Nevertheless, in the future, more detailed investigations and studies of feasibility, with the purpose of developing handling programs and elimination of the solid waste for each one of the hospital centers in Costa Rica should be carried out. (Author) [Spanish] El actual manejo, tratamiento y disposicion final de los desechos solidos hospitalarios en Costa Rica se considera inadecuado o cuando menos

  10. Final Technical Report - Period of Performance: 09/01/97 to 05/14/15

    International Nuclear Information System (INIS)

    De Long, Lance Eric

    2016-01-01

    Prior to 1997, the PI had studied the unusual upper critical magnetic field phase boundaries of several novel or exotic types of superconductors, including charge density wave materials such as NbSe_2, organic superconductors such as K-(ET)_2Cu[N(CN)_2]Br, high-temperature oxide superconductors such as (Ba,K)BiO_3 and the cuprates, heavy fermion superconductors such as U_6Fe, UBe_1_3, URu_2Si_2 and UPt_3, and re-entrant Kondo alloys such as (La,Ce)Al_2 and ferromagnetic superconductors such as ErRh_4B_4. Most of these materials exhibited marked positive or negative curvature of H_C_2(T) which could not be explained by traditional pair-breaking models. It became clear that many of these materials had very short coherence lengths that made quantized vortices highly mobile (depinned) near the phase boundary, and the fundamental, equilibrium H_C_2(T) difficult to measure using finite field or current drives. These problems made the underlying physics obscure, and led to erroneous interpretations of experimental data in terms of models of exotic superconducting pairing mechanisms. Around 1995, these issues led the PI to take advantage of modern electron beam lithography techniques for patterning superconducting and ferromagnetic thin films on the nanoscale. Primarily due to strong magnetic shape anisotropy effects, EBL patterning has led to enhanced control of the spatial distribution and dynamics of topological defects such as domain walls and magnetic vortices, which can create serious energy dissipation and other limitations for modern devices. Moreover, finite size and interface effects also strongly alter phase transition temperatures and phase boundaries of superconducting and magnetic films, as well as introduce barriers to equilibration, enhanced fluctuations and alter magnetic relaxation. Geometrical frustration and spin ice behavior can also be systematically controlled in patterned film media. Film patterning thus provides an excellent tool for conducting

  11. Genesis of multipeaked waves of the esophagus: repetitive contractions or motion artifact?

    Science.gov (United States)

    Sampath, Neha J; Bhargava, Valmik; Mittal, Ravinder K

    2010-06-01

    Multipeaked waves (MPW) in the distal esophagus occur frequently in patients with esophageal spastic motor disorders and diabetes mellitus and are thought to represent repetitive esophageal contractions. We aimed to investigate whether the relative motion between a stationary pressure sensor and contracted peristaltic esophageal segment that moves with respiration leads to the formation of MPW. We mathematically modeled the effect of relative movement between a moving pressure segment and a fixed pressure sensor on the pressure waveform morphology. We conducted retrospective analysis of 100 swallow-induced esophageal contractions in 10 patients, who demonstrated >30% MPW on high-resolution manometry (HRM) during standardized swallows. Finally, using HRM, we determined the effects of suspended breathing and hyperventilation on the waveform morphology in 10 patients prospectively. Modeling revealed that relative movement between a stationary pressure sensor and a moving contracted segment, contraction duration, contraction amplitude, respiratory frequency, and depth of respiration affects the waveform morphology. Retrospective analysis demonstrated a close temporal association with the onset of second and subsequent contractions in MPW with respiratory phase reversals. Numbers of peaks in MPW and respiratory phase reversals were closely related to the duration of contraction. In the prospective study, suspended breathing and hyperventilation resulted in a significant decrease and increase in the MPW frequency as well as the number of peaks within MPW respectively. We conclude that MPW observed during clinical motility studies are not indicative of repetitive esophageal contraction; rather they represent respiration-related movement of the contracted esophageal segment in relation to the stationary pressure sensor.

  12. Multiple Plasmodium falciparum erythrocyte membrane protein 1 variants per genome can bind IgM via its Fc fragment Fcμ

    DEFF Research Database (Denmark)

    Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav

    2015-01-01

    with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... resemble the rosette-mediating and IgM-binding PfEMP1 HB3VAR06, but none of them mediated formation of rosettes. We could map the capacity for Fc-specific IgM binding to DBLε domains near the C terminus for three of the four PfEMP1 proteins tested. Our study provides new evidence regarding Fc...

  13. Final PHP bench-scale report for the DOE-ID/SAIC sole source contract

    International Nuclear Information System (INIS)

    1997-04-01

    The Plasma Hearth Process (PHP) Technology Development Project was established to develop, test, and evaluate a new concept for treating mixed waste. The new concept uses direct current (dc) transferred-arc plasma torch technology to process mixed waste into a glass-like end-product. Under the cognizance of the US Department of Energy (DOE) Office of Technology Development (OTD) Mixed Waste Focus Area (MWFA), the technology is being explored for its potential to treat mixed waste. Because it is a mature technology, well-understood and commercially available, it is expected to develop rapidly in this new application. This report summarizes the radioactive bench-scale system activities funded under PHP Sole Source Contract DE-AC07-94ID13266 through the end of the contract

  14. Desarrollo y optimización de una jalea de piroxicam 0,5 % Development and optimization related to a 0.5 % Piroxican jelly

    Directory of Open Access Journals (Sweden)

    Oscar García Pulpeiro

    2009-12-01

    Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.For the first time in Cuba a 0.5 % Piroxican jelly formula was developed. The point of reference was the leader formula from FELEDENE GELâ; market which underwent some modifications. During first assessments four experiments were carried out as basis for the later stage of formula design and optimization. An experimental design with mixture was applied using as independent variables the concentration of Carbopol 940, Trietanolamine, and Hidroxypropyl methylcellulose. Influence of these components on pH, the extensibility area, and on some organoleptic properties. From these results, an optimal formula was selected.

  15. Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte = Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations

    Directory of Open Access Journals (Sweden)

    André Carlos Silva Pimentel

    2007-04-01

    Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramentecasualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre otratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. Anexperiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC andcharacteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.

  16. Law of contracts in Lex Baiuvariorum

    Directory of Open Access Journals (Sweden)

    Nótári Tamás

    2013-01-01

    Full Text Available This paper intends to analyze the contractual provisions of Lex Baiuvariorum, the written Bavarian Volksrecht3 created between 737 and 743. As part of that, first, it will examine the required formalities of entering into a contract, documentary evidence and testimony (I., then the issues of invalidity (II., implied warranty and buying stolen things (III., regulation of contractual safeguards (IV., finally, other contracts touched upon in the code (V.. Concerning sedes materiae it should be stated in advance that provisions regarding exchange of goods can be found primarily in two titles of the code: title eleven (De venditionibus and title nine (De furto-the latter sets out the rules on selling stolen things, i.e., implied warranty claims, which pay regard to the relation between the person who has been robbed and the person who buys the thing in good faith, on the one hand, and between seller and buyer, on the other. 4 Certain provisions, for example, regarding prohibition to sell things in action can be found in title fifteen (De commendatis et commodatis.

  17. Avaliar clinicamente uma solução contendo 0,12% de clorexidina, 0,05% de cetilpiridínico, e 0,05% de fluoreto de sódio na formação da placa e manchamento dental

    OpenAIRE

    Silva, Wagner Chagas da

    2008-01-01

    Apesar de sua eficácia no combate de infecções orais, a pigmentação de dentes e língua associada ao uso de soluções de clorexedina é um dos efeitos adversos que mais desencoraja o uso deste antisséptico por tempo prolongado. O objetivo deste estudo foi analisar o efeito da solução para bochecho contendo 0,12% de clorexidina, 0,05% de cetilpiridínio e 0,05% de fluoreto de sódio, na atividade anti- placa e formação da pigmentação extrínseca dental e da língua. Participara...

  18. Efectos del entrenamiento continuo e interválico de carga externa similar sobre la frecuencia cardiaca Effects of continuous and interval training similar external load on heart rate

    Directory of Open Access Journals (Sweden)

    J. L. Tuimil

    2010-09-01

    Full Text Available

     

    Los objetivos de este estudio fueron comparar la frecuencia cardíaca (FC media entre dos tipos de entrenamiento de carga externa equiparada basados en la carrera, la relación de la velocidad aeróbica máxima (VAM con la F.C. de reserva (FCR y los efectos de estos dos tipos de entrenamiento sobre la F.C. basal (FCB. El estudio se llevó a cabo con ocho estudiantes de educación física (23,25 años; VAM: 17,93 Km.h-1 que realizaron dos tipos de entrenamiento: CC =8 km al 70%VAM y CI= 4x(1000m al 90%VAM+1000m al 50% VAM. Se registró la FC durante el entrenamiento y la FCB antes y después del mismo. La diferencia de la FC media entre ambos métodos no fue estadísticamente significativa, sin embargo las medias del CC (FCCC (Z=2,240; p<0,05 y CI (FCCI (Z=2,380; p<0,05 fueron significativamente más elevadas que la calculada al 70% de FCR. La FCB se elevó de forma significativa (Z=2,319; p=0.020 solamente después del entrenamiento CI. En conclusión, dos métodos de entrenamiento distintos, pero de intensidad media similar, pueden dar lugar a una FC media también similar. La intensidad de carrera programada en función de la VAM es significativamente superior a la programada en función de la FCR. El entrenamiento interválico puede tener un mayor efecto sobre el incremento de la FCB.
    PALABRAS CLAVE: Frecuencia cardíaca media, frecuencia cardíaca de reserva, frecuencia cardíaca basal, VAM, carrera continua, carrera interválica.

    The aims of this study were to compare the mean heart rate response in two training methods of equal average intensity based on running, the relationship of the maximal aerobic speed (VAM with the reserve heart rate (FCR and the effects of these modes of training on the basal heart rate (FCB. The study was carried out with eight physical activity students (23,25 years old; VAM: 17,93 Km.h-1

  19. Estudo do crescimento inicial de plântulas de Cereus jamacaru DC em diferentes substratos

    Directory of Open Access Journals (Sweden)

    Wanderlucia Silva Rodrigues

    2014-12-01

    Full Text Available O presente trabalho objetivou avaliar o desenvolvimento de mudas de Cereus jamacaru DC, em substratos a base de fibra de coco e casca de arroz carbonizada. Os tratamentos utilizados foram dispostos em um delineamento inteiramente casualizado constituídos por cinco substratos a base de fibra de coco (FC e casca de arroz carbonizado (CAC, misturados com diferentes proporções volumétricas. Os tratamentos constituíram-se dos substratos 100% FC (T1, 100% CAC (T2, 75%FC+25%CAC (T3, 50%FC+50%CAC (T4, e 25%FC+75%CAC (T5. Cada tratamento foi composto por 14 repetições com 2 plantas por tratamento. Caixas de plástico transparente foram utilizados como recipientes. Aos 125 dias após o transplantio, foram avaliadas as seguintes variáveis das plântulas: comprimento, número, massa fresco e massa seco de raiz; massa fresco e massa seco da parte aérea; comprimento da parte aérea. Nas condições do experimento, conclui-se que o substrato composto somente por fibra de coco apresentou melhores resultados em todas as variáveis analisadas.

  20. Raquianestesia unilateral com baixa dose de bupivacaína a 0,5% hiperbárica Raquianestesia unilateral con baja dosis de bupivacaína a 0,5% hiperbárica Unilateral spinal anesthesia with low 0.5% hyperbaric bupivacaine dose

    Directory of Open Access Journals (Sweden)

    Luiz Eduardo Imbelloni

    2004-10-01

    punta cortante, lenta velocidad de inyección y la posición lateral han sido relatados como facilitadores de la producción de raquianestesia unilateral. El presente estudio longitudinal investiga el grado de raquianestesia unilateral utilizando 5 mg de bupivacaína a 0,5% hiperbárica inyectada a través de aguja 27G tipo Quincke en el paciente en decúbito lateral, con miembro a ser operado vuelto para abajo. MÉTODO: Raquianestesia con 0,5% de bupivacaína fue realizada a través de aguja 27G Quincke en 30 pacientes estado físico ASA I y II sometidos a cirugías ortopédicas. La punción subaracnóidea fue realizada con el paciente previamente colocado con el lado a ser operado vuelto para abajo y fueron inyectados 5 mg de bupivacaína a 0,5% hiperbárica en la velocidad de 1 ml.15s-1. Bloqueos sensitivo y motor (picada de aguja y escala de 0 a 3 fueron comparados entre los lados a ser operados y el contralateral. RESULTADOS: Los bloqueos motor y sensitivo entre el lado operado y el contralateral fueron significativamente diferentes en todos los momentos. Raquianestesia unilateral fue obtenida en 85,7% de los pacientes. Estabilidad hemodinámica fue observada en todos los pacientes. Ningún paciente desenvolvió cefalea pós-raquianestesia. CONCLUSIONES: En las condiciones de este estudio la bupivacaína hiperbárica a 0,5% (5 mg proporcionó un predominante bloqueo unilateral. Veinte minutos fueron suficientes para la instalación del bloqueo. Las principales ventajas de la raquianestesia unilateral son la estabilidad hemodinámica, la satisfacción del paciente y recuperación mas rápida de la anestesia.BACKGROUND AND OBJECTIVES: Unilateral spinal anesthesia may be advantageous, especially for outpatient procedures. Low anesthetic doses, pencil point or cutting point needles, slow injection rate and the lateral position have been reported as helping unilateral spinal anesthesia technique. This longitudinal study aimed at investigating the depth of unilateral

  1. Present and future of crowdfunding as source of entrepreneurial financing

    OpenAIRE

    Peñarroya Romero, Iván

    2017-01-01

    Treball Final de Grau en Finances i Comptabilitat. Codi: FC1049. Curs acadèmic: 2016/2017 New financing techniques have emerged due to the recently experienced deep crisis. In a changing technological environment any individual with an innovative business idea and an achievable entrepreneurial project can easily undertake it without resorting to traditional banking. As a result of the new Fintech technology, a word stemming from a contraction of the words “finance” and “technology”, it may...

  2. Inhibición dual de la neprilisina y del receptor de la angiotensina (ARNI: una alternativa en los pacientes con falla cardiaca

    Directory of Open Access Journals (Sweden)

    Beatriz Wills

    2016-03-01

    Full Text Available La falla cardiaca (FC es la causa más común de admisión hospitalaria en adultos en el mundo. Además, de su importante prevalencia la FC tiene un alta tasa de mortalidad, se estima que aproximadamente el 50% de los pacientes con FC mueren a los 5 años posterior al egreso hospitalario. Esto ha motivado el desarrollo de nuevas terapias seguras y efectivas para el manejo de esta entidad. El LCZ696 es un inhibidor dual de la neprilisina y del receptor de angiotensina II que demostró en estudios de fase III disminuir el desenlace primario de muerte cardiovascular y hospitalización por empeoramiento de la FC y muerte global. Probablemente el LCZ696 se convertirá en la piedra angular del manejo en pacientes con FC con fracción de eyección deprimida.

  3. Evaluación de un Secador Intermitente de Flujos Concurrentes (IFC para Café

    Directory of Open Access Journals (Sweden)

    Ospina Machado Julio E.

    1991-09-01

    Full Text Available En Colombia, el secado de café pergamino, beneficiado por vía húmeda se realiza en dos sistemas: al sol y mecánico. El secado mecánico más utilizado es el estático, el cual presenta algunas desventajas, entre ellas, la desuniformidad en el contenido de humedad final del grano. Con el fin de disponer de una tecnología alterna de secado, el Centro Nacional de Investigaciones del Café (CENICAFE, desarrolló un proyecto de investigación sobre secado dinámico, para lo cual diseñó y evaluó un secador intermitente de flujos concurrentes (FC. En este trabajo se presentan los resultados de la evaluación de un secador tipo IFC de capacidad de 500 kg de café pergamino seco (c.p.s. y el sistema de transporte utilizado durante el secado. Las diferencias del contenido de humedad final de la masa de grano fue menor al 1% base seca (b.s. Las mejores condiciones de operación del secador fueron: temperatura del aire de secado, 80°C; flujo de grano, 0,04 m3/ min.m2 (volumen de grano; flujo de aire, 210 m3 / min.ton de café pergamino seco y tiempo de secado, 28 horas; incluyendo dos horas de aireación al final del proceso. Como resultado del análisis de calidad del café pergamino seco se encontró un promedio de 0,6% de grano pelado y una cantidad de pasillas en la almendra inferior al 5%. Después de cuatro meses de almacenamiento del café, en condiciones ambientales diferentes, la prueba de taza dio un café bueno (aroma. y sabor normal. El consumo de combustible (ACP M en promedio fue de 0,5 galones por hora y un rendimiento térmico de 5.600 KJ/ kg de agua evaporada. El transportador de cangilones de descarga por gravedad demostró ser una buena alternativa para mover el grano en este sistema de secado.

  4. Anti-influenza Hyperimmune Immunoglobulin Enhances Fc-functional Antibody Immunity during Human Influenza Infection.

    Science.gov (United States)

    Vanderven, Hillary A; Wragg, Kathleen; Ana-Sosa-Batiz, Fernanda; Kristensen, Anne B; Jegaskanda, Sinthujan; Wheatley, Adam K; Wentworth, Deborah; Wines, Bruce D; Hogarth, P Mark; Rockman, Steve; Kent, Stephen J

    2018-05-31

    New treatments for severe influenza are needed. Passive transfer of influenza-specific hyperimmune pooled immunoglobulin (Flu-IVIG) boosts neutralising antibody responses to past strains in influenza-infected subjects. The effect of Flu-IVIG on antibodies with Fc-mediated functions, which may target diverse influenza strains, is unclear. We studied the capacity of Flu-IVIG, relative to standard IVIG, to bind to Fc receptors and mediate antibody-dependent cellular cytotoxicity in vitro. The effect of Flu-IVIG infusion, compared to placebo infusion, was examined in serial plasma samples from 24 subjects with confirmed influenza infection in the INSIGHT FLU005 pilot study. Flu-IVIG contains higher concentrations of Fc-functional antibodies than IVIG against a diverse range of influenza hemagglutinins. Following infusion of Flu-IVIG into influenza-infected subjects, a transient increase in Fc-functional antibodies was present for 1-3 days against infecting and non-infecting strains of influenza. Flu-IVIG contains antibodies with Fc-mediated functions against influenza virus and passive transfer of Flu-IVIG increases anti-influenza Fc-functional antibodies in the plasma of influenza-infected subjects. Enhancement of Fc-functional antibodies to a diverse range of influenza strains suggests that Flu-IVIG infusion could prove useful in the context of novel influenza virus infections, when there may be minimal or no neutralising antibodies in the Flu-IVIG preparation.

  5. Complexes prepared from protein A and human serum, IgG, or Fc gamma fragments: characterization by immunochemical analysis of ultracentrifugation fractions and studies on their interconversion.

    Science.gov (United States)

    Langone, J J; Das, C; Mainwaring, R; Shearer, W T

    1985-01-01

    Protein A of Staphylococcus aureus is an Fc receptor for IgG that has been used as a therapeutic reagent to treat cancer in humans and experimental animals. We used ultracentrifugation combined with analysis of isolated fractions by radioimmunoprecipitation and competitive radioimmunoassay with chicken antibodies that bind free protein A or protein A in complexes but do bind free immunoglobulin reagents to localize and characterize the types of complexes formed with different molar ratios of 125I-protein A and human 131I-IgG alone or in serum, and 131I-Fc gamma fragments. This approach offers a distinct advantage over direct counting of radioactivity in the fractions because resolution of complexes and free reagents is much improved. With excess 131I-IgG or 131I-Fc, all the 125I-protein A is present only in complexes that contained 4 molecules of immunoglobulin reagent and 2 molecules of protein A (4:2 complexes), whereas with excess 125I-protein A the stoichiometry of the complexes was 1:1. We have also shown the preformed 4:2 and 1:1 complexes will interconvert in the presence of added excess protein A or IgG, respectively, and that fresh IgG will exchange with IgG or Fc gamma in preformed complexes. Because protein A has been found to elute from an immobilized reagent used in serotherapy of human cancer and is present in a large excess of IgG, the 4:2 complexes may play an active role in the tumoricidal or toxic reactions observed.

  6. Human IgG4 binds to IgG4 and conformationally altered IgG1 via Fc-Fc interactions

    NARCIS (Netherlands)

    Rispens, Theo; Ooievaar-de Heer, Pleuni; Vermeulen, Ellen; Schuurman, Janine; van der Neut Kolfschoten, Marijn; Aalberse, Rob C.

    2009-01-01

    The Fc fragment of IgG4 can interact with the Fc fragment of another IgG molecule. This interaction is a confounding factor when measuring IgG4 rheumatoid factor levels. Recently, we demonstrated that half-molecules of IgG4 can exchange to form a bispecific Ab. We expected these two phenomena to be

  7. Performance and behavior of dairy calves fed diets containing milk and citric flavor agents Desempenho e comportamento de bezerros leiteiros alimentados com dietas contendo agentes de flavor lácteo e cítrico

    Directory of Open Access Journals (Sweden)

    Silvane Barcelos Carlotto

    2007-06-01

    Full Text Available While young ruminants prefer milk aroma and researches about this theme are being developed, the use of citric aroma, very appetized for older ruminants, are low utilized to young animals. This work aims to compare the influence of milk and citric flavor agents on the diets of nursing dairy calves. In this trial, 12 animals of Holstein breed were distributed in a randomized block design with four treatments (concentrate without flavor agent, concentrate with milk flavor or citrus flavor, and concentrate with milk plus citrus flavor agent and three repetitions. The parameters evaluated were: concentrate dry matter intake (CDMI, hay dry matter (HDMI, milk dry matter intake (MDMI and total dry matter intake (TDMI, average weight gain (ADWG, feed conversion (FC, initial (IBW and final body weight (FBW, initial thoracic perimeter (ITP and final thoracic perimeter (FTP, initial abdominal perimeter (IAP and final abdominal perimeter (FAP, initial withers height (IWH and final withers height (FWH and animal behavior. The CDMI, HDMI and TDMI, as well as IBW, FBW, ITP, FTP, IAP, FAP, IWH and FWH did not show differences (P>0.05. The averages daily gain and feed conversion showed no differences, with means of 0.55 kg/animal and 2.09, respectively. The diets did not affect animal behavior parameters (P>0.05.Enquanto ruminantes jovens preferem aroma de leite e pesquisas sobre este tema são desenvolvidas, o uso de aroma cítrico, muito apreciado por ruminantes adultos, é pouco utilizado para animais jovens. Portanto, com este trabalho visou-se comparar a influência de aromas lácteo e cítrico nas dietas de bezerros na fase de aleitamento. Neste experimento foram utilizados 12 animais da raça Holandesa, distribuídos em um delineamento de blocos ao acaso, com quarto tratamentos (concentrado sem palatabilizante e concentrado com palatabilizante lácteo, cítrico e lácteo mais cítrico e três repetições. Foram avaliados o consumo de matéria seca do

  8. QUALIDADE DA CARNE DE PEITO DE FRANGOS DE CORTE SUBMETIDA A DIFERENTES PROCESSAMENTOS / QUALITY OF BROILER BREAST MEAT SUBJECTED TO DIFFERENT PROCESSING

    Directory of Open Access Journals (Sweden)

    Rodrigo Garófallo GARCIA

    2010-11-01

    Full Text Available O objetivo do trabalho foi avaliar as características da carne de peito de frango de corte submetida a diferentes soluções de marinação e tempo de maturação. Os tratamentos foram distribuídos em um arranjo fatorial 3x3 sendo três formas diferentes de marinação (controle-água, cloreto de sódio e glutamato monossódico e três tempos diferentes de maturação da carne na geladeira (0, 24, e 48 horas e foram avaliados o pH, perda de peso por cozimento (PPC, força de cisalhamento (FC, capacidade de retenção de água (CRA, perda de exudato (PE, dimensionamento de peito (DP e características sensoriais. O pH não houve alteração significativa (p>0,05 apresentou-se no índice de acidificação ideal. A PPC foi afetada pela marinação e tempo de maturação (p<0,05 tendo a solução salina menores perdas e a solução com glutamato maiores perdas na medida que aumentou-se o tempo de maturação. A FC mostrou que os filés marinados com a solução salina nos três tempos de maturação foram mais macios (p<0,001 que os dos tratamentos controle e glutamato. A CRA não foi influenciada pelos precessos de marinação e maturação. Na análise sensorial a maturação não favoreceu os atributos estudados e, a marinação com sal ou glutamato pode ser empregada para melhorar a maciez, suculência e palatabilidade.   Palavras-chave: qualidade de carne, filés de peito de frango.

  9. Atividade antimicrobiana, antioxidante e teor de compostos fenólicos em casca e amêndoa de frutos de manga

    Directory of Open Access Journals (Sweden)

    Kettelin Aparecida Arbos

    2013-04-01

    Full Text Available O processamento industrial de frutos de manga gera elevada quantidade de resíduos agroindustriais, representados pelas cascas e sementes (amêndoa, os quais, sem aplicação viável, acabam sendo descartados diretamente no meio ambiente. Esses resíduos são ricos em compostos bioativos, amplamente reconhecidos pelas suas propriedades promotoras da saúde e em aplicações tecnológicas. Os objetivos foram avaliar as atividades antimicrobiana e antioxidante e o teor de compostos fenólicos de dois extratos: um obtido da casca (FC e outro da amêndoa (FA de manga variedade 'Tommy Atkins'. O teor de compostos fenólicos totais variou de 3.123 a 6.644 mg de catequina/100 g. Os extratos FC e FA demonstraram relevante atividade antimicrobiana frente às cepas das bactérias Escherichia coli, Salmonella sp., Pseudomonas aeruginosa . Staphylococcus aureus, determinadas pelo método de difusão em disco. A ação antioxidante de FC e FA aumentou com o aumento das concentrações testadas, atingindo o valor máximo de 88% (FC. Em todas as concentrações testadas os extratos FC apresentaram ação antioxidante significativamente superior às respectivas concentrações dos extratos FA. Esses resultados sugerem potencial aplicação dos resíduos de manga como fonte de compostos fenólicos, substâncias antimicrobianas e antioxidantes, podendo ser explorados pelas indústrias de alimentos.

  10. La comunicación digital del FC Barcelona y del Real Madrid CF y su percepción por los periodistas deportivos / Digital communication of FC Barcelona and Real Madrid CF and its perception by sports journalists

    Directory of Open Access Journals (Sweden)

    Fernando Olabe Sánchez

    2012-12-01

    Full Text Available ResumenEl FC Barcelona y el Real Madrid CF han cambiado su modelo de gestión comunicativa, especialmente en su relación con los medios de comunicación. Favorecidos por la implantación de las TIC, los departamentos de Comunicación de estas entidades se constituyen en gatekeeper al controlar y emitir, a través de sus propios medios de comunicación, como las televisiones y radios propias y los soportes online, las informaciones que ellos mismos generan. De este modo, controlan los mensajes y los emiten directamente a sus públicos objetivos sin la intermediación de los medios convencionales, condicionando las rutinas productivas de los periodistas deportivos.El objetivo de este trabajo es mostrar la percepción que estos profesionales tienen sobre las diferentes herramientas y soportes online que los departamentos de Comunicación de estos clubes emplean en su actividad diaria con los medios.AbstractThe FC Barcelona and Real Madrid CF have changed their communicative management model, especially in its relationship with the media. Favored by the introduction of ICT, Communication departments of these entities constitute gatekeeper to control and issue, through their own media, such as television and radio stations and media own online, the information that they generate. Thus, controlling broadcast messages and their target audiences directly without the intermediation of the mainstream media, conditioning routines productive sports journalists.The aim of this paper is to show the perception that these professionals have about the different tools and online media Communication departments to use these clubs in their daily activities with the media.

  11. EFECTO DEL CONSUMO DE CREATINA SOBRE LA EJECUCIÓN DE DESTREZAS REALIZADAS EN FORMA INTERMITENTE Y DE DURACIÓN PROLONGADA

    Directory of Open Access Journals (Sweden)

    Óscar Pablo Gutiérrez Sancho

    2002-06-01

    Full Text Available Se estudió el efecto de la suplementación con creatina (Crsobre el rendimiento en natación, ciclismo y atletismo en 10 mujeres. Las participantes debían realizar 4intervalos en cada deporte a máxima intensidad, además de un segmento aeróbico de 7 min post intervaloentre el 65 - 85% de la FCmáx. En un diseño de medidas repetidas, las atletas completaron 3 condicionesexperimentales: control (CT, suplementación con creatina (CCr, y condición placebo (PL. Se registró eltiempo de cada intervalo en las diferentes condiciones y se aplicaron 3 ANOVAS de medidas repetidas paracada deporte. Se encontraron interacciones entre los tratamientos y las mediciones en ciclismo (p = .001 yatletismo (p = .002. El análisis de seguimiento para la interacción de ciclismo reveló que todas lascondiciones fueron diferentes entre sí (p < 0.05, y que éstas diferencias en los promedios se encontraban enlos intervalos 1, 2 y 4. El análisis post-hoc de Tukey mostró diferencias (p < 0.05 en el intervalo 1 entre CT(M = 78.3 ± 11.58 s y PL (M = 75.2 ± 7.62 s (p < 0.05. En el intervalo 2 las diferencias fueron entre CT(M = 77.3 ± 7.97 s y CCr (M = 75.3 ± 7.97 s (p < 0.05; y entre CT (M = 77.3 ± 7.97 s y PL (M = 74.8 ±7.28 s (p < 0.05. En el intervalo 4, CCr (M = 77.5 ± 8.29 s y PL (M = 76.4 ± 7.49 s. El análisis deseguimiento de la interacción de atletismo mostró diferencias en los intervalos 1, 3 y 4. El análisis post-hocde Tukey indicó diferencias en el intervalo 1 de atletismo entre CCr (M = 96.6 ± 13.63 s y PL (M = 90.4 ±14.08 s y entre CCr (M = 96.6 ± 13.63 s y CT (M = 91.8 ± 9.73 s (p < 0.05. En el intervalo 3 hubodiferencias entre CT (M = 94.8 ± 13.60 s y PL (M = 90.2 ± 8.97 s. Por último, en el intervalo 4 lasdiferencias fueron entre CT (M = 96.9 ± 15.18 s y CCr (M = 90.3 ± 11.84 s; y entre CT (M = 96.9 ± 15.18s y PL (M = 90.7 ± 11.35 s (p < 0.05. Se concluye que durante las etapas de atletismo hubo un efecto positivo de la

  12. Quantitative glycan profiling of normal human plasma derived immunoglobulin and its fragments Fab and Fc.

    Science.gov (United States)

    Anumula, Kalyan Rao

    2012-08-31

    Typical clinical grade human IgG (intravenous immunoglobulin, IVIG), used for carbohydrate analysis, is derived from thousands of healthy donors. Quantitative high-resolution glycan profiles of IgG and its Fc-Fab fragments are presented here. Glycan profiles were established following digestions with Fc specific endoglycosidase S and generic PNGase F under denaturing and non-denaturing (native) conditions. The native PNGase F glycan profile of IgG was similar (but not identical) to that of Endo S. Endo S profiles did not contain the glycans with bisecting GlcNAc. PNGase F glycan profiles were the same for Fc fragments that were isolated from pepsin and Ide S protease digests. Both isolated Fab fragments and the previously deglycosylated IVIG (native conditions) yielded the same glycan profile. Glycan profiles were established using high resolution HPLC with 2-aminobenzoic acid (2AA) labeling. An accurate determination of sialylation levels can be made by this method. Carbohydrate content in Fc and Fab was determined using an internal standard and corrected for both protein and glycan recoveries. Fab portion contained about 14% of the total carbohydrate which translates to 2.3 sugar chains per mol in IVIG where 2 chains are located in the CH2 domain of the Fc. Fc glycans consisted of neutral (N) 84.5%; mono-sialylated (S1) 15% and di-sialylated (S2) 0.5%. In contrast, Fab contained N, 21%; S1, 43% and S2, 36%. The distribution of bisecting N-acetylglucosamine and fucose was found to be very different in various glycans (N, S1 and S2) found in Fab and Fc. Total IgG glycan profile (Fab plus Fc) contained N, 78.5%; S1, 17% and S2, 4.5%. Percent distribution of glycans G0, G1 and G2 (with 0, 1 and 2 two galactoses) was 26, 49 and 25 respectively within the 78% of the neutral glycans. Glycan profiles were nearly the same for various clinical grade IVIG preparations from various manufacturers. A fast HPLC profiling method was developed for the separation and quantitation

  13. Características de las personas afectadas de fibrilación auricular en una consulta de cardiología

    Directory of Open Access Journals (Sweden)

    Patricia López-Mases

    Full Text Available La Fibrilación auricular (FA presenta una elevada prevalencia en los ancianos. Se plantea como objetivo describir las características de la población afectada y valorar las relaciones existentes entre los diferentes aspectos medibles. Metodología: Estudio descriptivo e inferencial con muestreo por conveniencia, seleccionando todos los pacientes con episodios de FA asociados a frecuencias cardíacas (FC superiores a 80 ppm o que hayan revertido a ritmo sinusal, con el que se obtiene una muestra de 65 personas. Se han recopilado datos sociodemográficos, tipo de FA, variaciones en FC, visitas a urgencias y complicaciones. Los datos han sido analizados mediante el programa SPSS v.17.0. Resultados: La media de edad fue de 65 años. La FA paroxística se encuentra asociada a FC iniciales superiores a las del grupo de FA persistente, el cual se relaciona con edades más avanzadas. El grupo que acude a urgencias presenta FC iniciales superiores. Existen diferencias significativas, asociando directamente las consultas al servicio de urgencias con episodios de FA con FC elevadas que obliga a la derivación. A edades avanzadas, mayor asociación en el individuo de los factores de riesgo con los que esta se relaciona. Conclusiones: La FA es una de las arritmias más prevalentes, con un alto coste sanitario y con un empeoramiento de la calidad de vida, por lo que las actividades encaminadas a la detección precoz y tratamiento adecuado son fundamentales para su mejora.

  14. 30 CFR 285.436 - Can MMS require lease or grant contraction?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS require lease or grant contraction? 285... Administration Lease Or Grant Contraction § 285.436 Can MMS require lease or grant contraction? At an interval no more frequent than every 5 years, the MMS may review your lease or grant area to determine whether the...

  15. Reproduction of the FC/DFC units in nucleoli.

    Science.gov (United States)

    Smirnov, Evgeny; Hornáček, Matúš; Kováčik, Lubomír; Mazel, Tomáš; Schröfel, Adam; Svidenská, Silvie; Skalníková, Magdalena; Bartová, Eva; Cmarko, Dušan; Raška, Ivan

    2016-04-25

    The essential structural components of the nucleoli, Fibrillar Centers (FC) and Dense Fibrillar Components (DFC), together compose FC/DFC units, loci of rDNA transcription and early RNA processing. In the present study we followed cell cycle related changes of these units in 2 human sarcoma derived cell lines with stable expression of RFP-PCNA (the sliding clamp protein) and GFP-RPA43 (a subunit of RNA polymerase I, pol I) or GFP-fibrillarin. Correlative light and electron microscopy analysis showed that the pol I and fibrillarin positive nucleolar beads correspond to individual FC/DFC units. In vivo observations showed that at early S phase, when transcriptionally active ribosomal genes were replicated, the number of the units in each cell increased by 60-80%. During that period the units transiently lost pol I, but not fibrillarin. Then, until the end of interphase, number of the units did not change, and their duplication was completed only after the cell division, by mid G1 phase. This peculiar mode of reproduction suggests that a considerable subset of ribosomal genes remain transcriptionally silent from mid S phase to mitosis, but become again active in the postmitotic daughter cells.

  16. Construction of a bimolecular fluorescence complementation (BiFC ...

    African Journals Online (AJOL)

    Protein–protein interactions are essential for signal transduction in cells. Bimolecular fluorescence complementation (BiFC) is a novel technology that utilises green fluorescent proteins to visualize protein–protein interactions and subcellular protein localisation. BiFC based on pSATN vectors are a good system for ...

  17. The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics

    Science.gov (United States)

    Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu

    2004-11-01

    (Bi3.5Nd0.5) (Ti2.97Nb0.03)O12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials.

  18. Hubungan Polimorfisme Gen FcγRIIA dengan Densitas P. falciparum dan Efikasi Dihidroartemisinin-Piperakuin

    Directory of Open Access Journals (Sweden)

    Sylvia Sance Marantina

    2016-06-01

    Full Text Available Dimorfisme FcγRlla memiliki keterkaitan dengan kemampuan inang dalam mengeliminasi parasit malaria sehingga perlu dilakukan penelitian untuk mengetahui polimorfisme alel FcγRlla dari populasi di daerah endemis malaria di Indonesia agar dapat diketahui peran imunitas dalam mengeliminasi parasit malaria. Sebanyak 120 sampel dried blood spot (DBS malaria falsifarum yang diperoleh dari studi efikasi obat DHP di lima wilayah di Indonesia dianalisis dengan polymerase chain reaction (PCR dan sekuensing untuk melihat varian alel FcγRIIa-131 serta hubungannya dengan densitas parasit dan efikasi dihidroartemisinin-piperakuin. Analisis gen FcγRIIa menunjukkan bahwa genotip RH memiliki frekuensi paling tinggi (50,8% dibandingkan RR (17,5% dan HH (31,7%. Alel R131 gen FcγRIIa menunjukkan efek protektif terhadap high density parasitemia/HDP (>5000 parasit/μL; odds ratio [OR]= 0,133, 95% confidence interval [CI]= 0,053–0,334, p< 0,001 dan berhubungan dengan keberadaan gametosit yang lebih lama pada inang (>72 jam; relative risk [RR]= 1,571, 95% confidence interval [CI]= 1,005–2,456, p= 0,090. Kata Kunci: malaria falsiparum, dihidroartemisinin-piperakuin, K13, FcγRIIa, efikasi obat Polymorphism of Human FcγRIIa and Its Association with P. falciparum Density and Efficacy of Dihydroartemisinin- Piperaquine Abstract FcγRlla dimorphism has been related to the ability of the host to eliminate malaria parasite so it is necessary to investigate the allele polymorphism FcγRlla of population in malaria-endemic areas in Indonesia in order to know the role of immunity in eliminating malaria parasite. A total of 120 samples of Dried Blood Spot (DBS falciparum malaria acquired from DHP drug efficacy studies in 5 regions in Indonesia were analyzed by Polymerase Chain Reaction (PCR and sequencing, to look at variants of FcγRIIa-131 allele and its Association with Parasite DensityandEfficacy ofDihydroartemisinin- Piperaquine. The FcγRIIa gene analysis indicated

  19. Processing and characterization of AlCoFeNiXTi{sub 0,5} (X = Mn, V) high entropy alloys; Processamento e caracterizacao de ligas de alta entropia AlCoFeNixTi{sub 0,5} (X = Mn, V)

    Energy Technology Data Exchange (ETDEWEB)

    Triveno Rios, C., E-mail: carlos.triveno@ufabc.edu.br [Universidade Federal do ABC (CECS/UFABC), Santo Andre, SP (Brazil). Engenharia de Materiais; Lopes, E.S.N.; Caram, R. [Universidade Estadual de Campinas (FEM/DEMA/UNICAMP), Campinas, SP (Brazil); Kiminami, C.S. [Universidade Federal de Sao Carlos (DEMa/UFSCar), Sao Carlos, SP (Brazil). Departamento de Engenharia de Materiais

    2014-07-01

    The microstructure of high entropy alloys consists of solid solution phases with FC and BCC simple structures, contrary to classical metallurgy where they form complex structures of intermetallic compounds. Because of this they have several attractive properties for engineering applications. In this work the AlCoFeNiMnTi{sub 0,5} and AlCoFeNiVTi{sub 0,5} alloys were processed by melting arc. Since the main objective was the microstructural and mechanical characterization of ingots as-cast. The alloys were characterized by scanning electron microscopy, X-ray diffraction, microhardness and cold compression test. The results showed that the microstructure consists mainly of dendrites and interdendritic regions consisting of metastable crystalline phases. It was also observed that the AlCoFeNiVTi{sub 0,5} alloy showed better mechanical properties than the AlCoFeNiMnTi{sub 0,5} alloy. This may be associated with differences in the parameters of formation of simple solid solution phases between the two alloys. (author)

  20. Alimentação de juvenis de carpa capim com dietas à base de farelos vegetais e forragem - doi: 10.4025/actascianimsci.v32i3.9052 Feeding grass carp juveniles with plant-protein diets and forage - doi: 10.4025/actascianimsci.v32i3.9052

    Directory of Open Access Journals (Sweden)

    Fernando Strohschein Maschke

    2010-09-01

    Full Text Available Para avaliar o potencial dos ingredientes de origem vegetal como substitutos da farinha de carne suína em dietas para Ctenopharyngodon idella Valenciennes, (1844 (carpa capim, 180 juvenis (15 por tanque foram criados durante 60 dias em sistema de recirculação de água. Foi avaliada a substituição da farinha de carne suína (FCS por farelo de canola (FC, farelo de girassol (FG e a mistura dos farelos de canola e girassol (FCG. As dietas também continham farelo de soja como fonte proteica. O consumo diário de forragem (1,24 a 2,11% do peso vivo não diferiu entre os tratamentos. Peso final, ganho em peso, taxa de crescimento específico e conversão alimentar aparente não diferiram estatisticamente entre as dietas. O rendimento de filé foi maior nos tratamentos FC e FCG, enquanto o índice digestivossomático foi maior nos tratamentos FG e FCG. Maior teor de gordura e menores teores de proteína no peixe inteiro e de cinzas no filé foram obtidos no tratamento FCG. Os filés dos tratamentos FCS e FCG apresentaram maior valor de luminosidade. Os peixes da dieta FCS apresentaram maiores valores de proteínas, triglicerídeos e colesterol total no soro. Conclui-se que os farelos de canola e girassol podem ser utilizados em dietas para recria da carpa capim.To evaluate the potential of plant-protein sources to replace porcine meat meal in diets for grass carp juveniles, 180 fish (15 per tank were reared for 60 days in a re-use water system. We evaluated the replacement of porcine meat meal (FCS for canola meal (FC, sunflower meal (FG or a mixture of canola and sunflower meal (FCG. The diets were also composed of soybean meal as a protein source. Daily forage intake ranged from 1.24 to 2.11% body weight and did not differ among treatments. Final weight, weight gain, specific growth rate and feed conversion rate did not differ statistically among diets. The fillet yield was higher in FC and FCG diets, while the digestive-somatic index was

  1. Coordinate expression of activating Fc gamma receptors I and III and inhibiting Fc gamma receptor type II in the determination of joint inflammation and cartilage destruction during immune complex-mediated arthritis.

    NARCIS (Netherlands)

    Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Boross, P.; Roth, J.; Verbeek, S.; Lent, P.L.E.M. van; Berg, W.B. van den

    2003-01-01

    OBJECTIVE: To study the role of the activating Fc gamma receptor types I and III (Fc gamma RI and Fc gamma RIII, respectively) and the inhibiting Fc gamma receptor II (Fc gamma RII) in inflammation and in various aspects of cartilage destruction during arthritis that is solely induced by immune

  2. Neutron Reflection Study of Surface Adsorption of Fc, Fab, and the Whole mAb.

    Science.gov (United States)

    Li, Zongyi; Li, Ruiheng; Smith, Charles; Pan, Fang; Campana, Mario; Webster, John R P; van der Walle, Christopher F; Uddin, Shahid; Bishop, Steve M; Narwal, Rojaramani; Warwicker, Jim; Lu, Jian Ren

    2017-07-12

    Characterizing the influence of fragment crystallization (Fc) and antigen-binding fragment (Fab) on monoclonal antibody (mAb) adsorption at the air/water interface is an important step to understanding liquid mAb drug product stability during manufacture, shipping, and storage. Here, neutron reflection is used to study the air/water adsorption of a mAb and its Fc and Fab fragments. By varying the isotopic contrast, the adsorbed amount, thickness, orientation, and immersion of the adsorbed layers could be determined unambiguously. While Fc adsorption reached saturation within the hour, its surface adsorbed amount showed little variation with bulk concentration. In contrast, Fab adsorption was slower and the adsorbed amount was concentration dependent. The much higher Fc adsorption, as compared to Fab, was linked to its lower surface charge. Time and concentration dependence of mAb adsorption was dominated by Fab behavior, although both Fab and Fc behaviors contributed to the amount of mAb adsorbed. Changing the pH from 5.5 to 8.8 did not much perturb the adsorbed amount of Fc, Fab, or mAb. However, a small decrease in adsorption was observed for the Fc over pH 8-8.8 and vice versa for the Fab and mAb, consistent with a dominant Fab behavior. As bulk concentration increased from 5 to 50 ppm, the thicknesses of the Fc layers were almost constant at 40 Å, while Fab and mAb layers increased from 45 to 50 Å. These results imply that the adsorbed mAb, Fc, and Fab all retained their globular structures and were oriented with their short axial lengths perpendicular to the interface.

  3. Identification of Fc Gamma Receptor Glycoforms That Produce Differential Binding Kinetics for Rituximab.

    Science.gov (United States)

    Hayes, Jerrard M; Frostell, Asa; Karlsson, Robert; Müller, Steffen; Martín, Silvia Míllan; Pauers, Martin; Reuss, Franziska; Cosgrave, Eoin F; Anneren, Cecilia; Davey, Gavin P; Rudd, Pauline M

    2017-10-01

    Fc gamma receptors (FcγR) bind the Fc region of antibodies and therefore play a prominent role in antibody-dependent cell-based immune responses such as ADCC, CDC and ADCP. The immune effector cell activity is directly linked to a productive molecular engagement of FcγRs where both the protein and glycan moiety of antibody and receptor can affect the interaction and in the present study we focus on the role of the FcγR glycans in this interaction. We provide a complete description of the glycan composition of Chinese hamster ovary (CHO) expressed human Fcγ receptors RI (CD64), RIIa Arg131/His131 (CD32a), RIIb (CD32b) and RIIIa Phe158/Val158 (CD16a) and analyze the role of the glycans in the binding mechanism with IgG. The interactions of the monoclonal antibody rituximab with each FcγR were characterized and we discuss the CHO-FcγRIIIa Phe158/Val158 and CHO-FcγRI interactions and compare them to the equivalent interactions with human (HEK293) and murine (NS0) produced receptors. Our results reveal clear differences in the binding profiles of rituximab, which we attribute in each case to the differences in host cell-dependent FcγR glycosylation. The glycan profiles of CHO expressed FcγRI and FcγRIIIa Phe158/Val158 were compared with the glycan profiles of the receptors expressed in NS0 and HEK293 cells and we show that the glycan type and abundance differs significantly between the receptors and that these glycan differences lead to the observed differences in the respective FcγR binding patterns with rituximab. Oligomannose structures are prevalent on FcγRI from each source and likely contribute to the high affinity rituximab interaction through a stabilization effect. On FcγRI and FcγRIIIa large and sialylated glycans have a negative impact on rituximab binding, likely through destabilization of the interaction. In conclusion, the data show that the IgG1-FcγR binding kinetics differ depending on the glycosylation of the FcγR and further support a

  4. Efectos de la ingesta ad libitum de bebidas hidratantes sobre el peso corporal, la frecuencia cardíaca y el volumen plasmático durante una actividad física de alta intensidad y larga duración -Informe preliminar- Body weight, the heart rate, and the plasma volume during a high-intesity, long-duration run

    Directory of Open Access Journals (Sweden)

    Rubiela Flórez Manrique

    2004-02-01

    Full Text Available Objetivo: determinar la magnitud de la ingesta ad libitum de tres bebidas hidratantes de diferente osmolaridad y establecer sus efectos sobre el porcentaje de pérdida del peso corporal (PC, el aumento de la frecuencia cardíaca (FC y la reducción porcentual del volumen plasmático (VP en nueve deportistas con entrenamiento aeróbico, sometidos, bajo condiciones ambientales neutras, a una actividad física de alta intensidad 80% de la FC de reserva (FCR80 y larga duración 88 minutos. Metodología: el protocolo experimental se realizó en banda rodante, luego de nueve minutos de calentamiento, a una velocidad equivalente al 50% de la FCR y con una pendiente del 1%; siguieron 88 minutos de carrera, en tres intervalos, los dos iniciales de 29 minutos y el último de 30; la pendiente se mantuvo y la velocidad se incrementó al 80% de la FCR; finalmente, 90 minutos de recuperación, en tres intervalos de 30 minutos cada uno. No se hizo reposición hídrica durante el tratamiento deshidratado (DH; durante los tratamientos con hidratación se empleó un volumen similar de tres bebidas de diferente osmolaridad (H-I, H-II, H-III, el cual fue ingerido ad libitum. Resultados: durante la etapa de ejercicio la pérdida hídrica fue de 1.440 ml/h mientras que el volumen ingerido fue de 407 ml/h. Se observó, en cada uno de los tratamientos, una pérdida porcentual del PC (p<0,001; un incremento de la FC (p<0,05, y excepto con H-II y H-III una reducción porcentual del VP (p<0,05. No hubo diferencias intertratamientos en el porcentaje de la pérdida del PC, en el aumento de la FC ni en la reducción porcentual del VP. Conclusiones: la ingesta ad libitum fue menor que la cantidad recomendada internacionalmente por lo que, probablemente, no se pudieron establecer los efectos de la osmolaridad de las bebidas hidratantes sobre las variables estudiadas. Estos hallazgos nos obligan a revisar las prácticas de hidratación de nuestros deportistas ya que, al parecer

  5. 76 FR 43892 - Modifications of Certain Derivative Contracts

    Science.gov (United States)

    2011-07-22

    ... obligations under the derivative contract and the party to which the rights and obligations are transferred or... assigning its rights and obligations under the contract and the party to which the rights and obligations... Modifications of Certain Derivative Contracts AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Final...

  6. Evaluación costo-efectividad de lidocaína al 5 % y bupivacaína al 0,5 % en anestesia espinal

    Directory of Open Access Journals (Sweden)

    Eréndira González Orozco

    Full Text Available Se realizó un estudio económico prospectivo de costo-efectividad con datos primarios de efectividad obtenidos de un ensayo clínico aleatorizado, donde se comparan 2 anestésicos vía espinal: lidocaína al 5 % y bupivacaína al 0,5 %. La efectividad se evaluó como la probabilidad de aparición de síntomas neurológicos transitorios, reacción adversa propia de este grupo de medicamentos. Se formaron aleatoriamente 2 grupos de pacientes que requerían cirugías por debajo del ombligo con una duración no mayor de 120 min, con la aplicación de cada una de las opciones de anestesia estudiada a cada grupo, 109 pacientes en el grupo de lidocaína y 97 en el grupo de bupivacaína. Un especialista en Neurología evaluó a ciegas la condición neurológica posquirúrgica de cada paciente antes y 24 h después de la intervención. Se calcularon los costos de cada alternativa, que incluyeron los ocasionados por la toxicidad neurológica, y se determinaron las relaciones costo-efectividad y los costos incrementales. El grupo de bupivacaína resultó la alternativa con mejor relación costo-efectividad

  7. Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Bohdan W. Oppenheim; Rudolf Marloth

    2007-10-26

    Executive Summary The document contains Final Technical Report on the Industrial Assessment Center Program at Loyola Marymount University in Los Angeles, covering the contract period of 9/1/2002 to 11/30/2006, under the contract DE-FC36-02GO 12073. The Report describes six required program tasks, as follows: TASK 1 is a summary of the assessments performed over the life of the award: 77 assessments were performed, 595 AR were recommended, covering a very broad range of manufacturing plants. TASK 2 is a description of the efforts to promote and increase the adoption of assessment recommendations and employ innovative methods to assist in accomplishing these goals. The LMU IAC has been very successful in accomplishing the program goals, including implemented savings of $5,141,895 in energy, $10,045,411 in productivity and $30,719 in waste, for a total of $15,218,025. This represents 44% of the recommended savings of $34,896,392. TASK 3 is a description of the efforts promoting the IAC Program and enhancing recruitment efforts for new clients and expanded geographic coverage. LMU IAC has been very successful recruiting new clients covering Southern California. Every year, the intended number of clients was recruited. TASK 4 describes the educational opportunities, training, and other related activities for IAC students. A total of 38 students graduated from the program, including 2-3 graduate students every semester, and the remainder undergraduate students, mostly from the Mechanical Engineering Department. The students received formal weekly training in energy (75%) and productivity (25). All students underwent extensive safety training. All students praised the IAC experience very highly. TASK 5 describes the coordination and integration of the Center activities with other Center and IAC Program activities, and DOE programs. LMU IAC worked closely with MIT, and SDSU IAC and SFSU IAC, and enthusiastically supported the SEN activities. TASK 6 describes other tasks

  8. Desarrollo y optimización de una jalea de piroxicam 0,5 %

    Directory of Open Access Journals (Sweden)

    Oscar García Pulpeiro

    Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.

  9. Sweat conductivity and coulometric quantitative test in neonatal cystic fibrosis screening

    Directory of Open Access Journals (Sweden)

    Mouseline Torquato Domingos

    2015-11-01

    Full Text Available Objective: To compare the results obtained with the sweat test using the conductivity method and coulometric measurement of sweat chloride in newborns (NBs with suspected cystic fibrosis (CF in the neonatal screening program. Methods: The sweat test was performed simultaneously by both methods in children with and without CF. The cutoff values to confirm CF were >50 mmol/L in the conductivity and >60 mmol/L in the coulometric test. Results: There were 444 infants without CF (185 males, 234 females, and 24 unreported submitted to the sweat test through conductivity and coulometric measurement simultaneously, obtaining median results of 32 mmol/L and 12 mmol/L, respectively. For 90 infants with CF, the median values of conductivity and coulometric measurement were 108 mmol/L and 97 mmol/L, respectively. The false positive rate for conductivity was 16.7%, and was higher than 50 mmol/L in all patients with CF, which gives this method a sensitivity of 100% (95% CI: 93.8–97.8, specificity of 96.2% (95% CI: 93.8–97.8, positive predictive value of 83.3% (95% CI: 74.4–91.1, negative predictive value of 100% (95% CI: 90.5–109.4, and 9.8% accuracy. The correlation between the methods was r = 0.97 (p > 0.001. The best suggested cutoff value was 69.0 mmol/L, with a kappa coefficient = 0.89. Conclusion: The conductivity test showed excellent correlation with the quantitative coulometric test, high sensitivity and specificity, and can be used in the diagnosis of CF in children detected through newborn screening. Resumo: Objetivo: Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos: O teste do suor foi realizado simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60

  10. PRODUCCIÓN DE BIOMASA Y EXOPOLISACÁRIDOS DE Grifóla frondosa BAJO CULTIVO SUMERGIDO UTILIZANDO FUENTES DE CARBONO NO CONVENCIONALES

    Directory of Open Access Journals (Sweden)

    Paula Zapata

    2007-06-01

    Full Text Available Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3 con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC en la producción de biomasa y exopolisacári-dos (EPS, bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7 y medio (MB y MS. La máxima producción de biomasa micelial (21,10 ± 0,82 g/l y la máxima producción de EPS (6,53 ± 0,14 g/l se logró utilizando el medio MB suplementado con FC4. Además de lo anterior, se logró desarrollar un medio de cultivo que cumple con el objetivo de disminuir costos, de Col $18.455 a $656 por litro de medio, produciendo (14,14 ± 0,82 g/l de biomasa y (5,16 ± 0,14 g/l de EPS, utilizando el medio MS suplementando con FC4. Estos resultados abren nuevas alternativas y posibilidades en nuestro país para el desarrollo de productos a partir de esta especie con costos que estén al alcance de la población.Grifóla frondosa is a Basidiomycete fungus edible and medicinal, it produces polysaccharides such a glucans (β-1,6 and β-1,3 with anti-tumor and inmuno-stimulating activity. For this work, the aim was evaluate the incidence of different carbon sources (FC in biomass and exo-polymer (EPS production, under submerged culture conditions, by using a factorial statistical design with two factors: carbon source (FC(1-7 and medium (MB and MS. The maximal yield of mycelial biomass (21,10 ± 0,82 g/l and the maximal yield in EPS (6,53 ± 0,14 g/l was achieved by using the MB medium supplemented with FC4. Besides, it was possible to develop a medium that fulfills the objective of reducing costs from $18.455 to $656 Colombian pesos for each liter of medium used, which produces (14,14 ± 0,82 g/l of biomass and (5,16 ± 0,14 g/l of EPS, using the MS medium supplemented with FC4

  11. 27 CFR 19.97 - Taxpaid spirits or wines on bonded premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpaid spirits or wines... Miscellaneous Provisions Conveyance of Spirits Or Wines on Plant Premises § 19.97 Taxpaid spirits or wines on bonded premises. Spirits or wines on which the tax has been paid or determined may be conveyed within a...

  12. RESPUESTAS CARDIOVASCULARES AL ENTRENAMIENTO DE FUERZA BAJO OCLUSIÓN VASCULAR [Cardiovascular responses to strength training under occlusive training

    Directory of Open Access Journals (Sweden)

    Sergio Benito Hernández

    2013-11-01

    Full Text Available El entrenamiento de la fuerza bajo oclusión vascular se muestra como una alternativa al entrenamiento de alta intensidad. El presente estudio muestra las respuestas cardiovasculares a este tipo de entrenamiento. 10 sujetos fueron sometidos a dos protocolos de entrenamiento oclusivo diferenciados por el peso levantado, (30% del peso máximo, post30, y 70% del peso máximo, post70. Se registraron los valores de tensión arterial sistólica (TAS, diastólica (TAD y frecuencia cardiaca (FC. Los resultados evidencian disminución significativa en TAS y TAD en el grupo post30 en 7 y 13 mm Hg respectivamente en referencia a los valores basales (p<0.05, resultando un descenso muy significativo en el grupo post70, 14 y 20 mm Hg respectivamente (p<0.005. Los valores de la FC no se vieron alterados por ninguno de los protocolos experimentales (p>0.05. Los efectos de tamaño para todos los grupos resultaron triviales (d<0.25. En conclusión los resultados del presente estudios presentan una tendencia a la reducción de la tensión arterial significativa en TAS y TAD en los protocolos de entrenamiento oclusivo, resultando más notable cuando se aplica la mayor intensidad de entrenamiento. Resultan necesarios más estudios que examinen el comportamiento de los parámetros cardiovasculares tras el entrenamiento de fuerza bajo oclusión vascular.AbstractOcclusive strength training is shown like an alternative to intensive training. Present study shown cardiovascular responses to this training. 10 subjects were subjected to two occlusion training protocols, differentiated by the weight lifted (30 % of maximum weight lifted, post30, and 70 % of maximum weight lifted, post70. The values of arterial systolic tension (TAS, diastolic (TAD and heart rate (FC were recorded. The results showing a significant decline in TAS and TAD after post30 of 7 and 13 mm Hg respectively from basis values (p<0.05, resulting a very significant decline in post70 group, 14 and 20 mm Hg

  13. DEFINICIÓN DE PIT FINAL CAPACITADO BAJO INCERTIDUMBRE

    OpenAIRE

    PEIRANO OPAZO, FERNANDO ANDRÉS

    2011-01-01

    El objetivo principal de este trabajo de tesis es desarrollar una metodología y una herramienta que permitan definir un pit final incorporando las restricciones de capacidad y las condiciones de incertidumbre asociadas al recurso geológico. El resultado metodológico consiste en un algoritmo de cálculo que incorpora heurísticas de definición de pit final como es la enunciada por Lerchs y Grossman (1964), en conjunto con heurísticas de secuenciamiento de bloques como son enunciadas por Gersh...

  14. The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics

    International Nuclear Information System (INIS)

    Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu

    2004-01-01

    (Bi 3.5 Nd 0.5 ) (Ti 2.97 Nb 0.03 )O 12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.

    Science.gov (United States)

    Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J H M; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C Ellen; Vidarsson, Gestur

    2015-03-01

    RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with FcγRIII, with less Fc-fucosylation strengthening the interaction. Anti-D IgG1 Fc-glycosylation patterns in 93 plasma samples from 28 male and 28 female Dutch HIDs and RhIG were analyzed with mass spectrometry. The Fc-glycosylation profiles of HIDs were evaluated with regard to their immunization history. HID sera demonstrated clearly lowered anti-D Fc-fucosylation compared to normal IgG fucosylation (93%); this was more pronounced for female than for male HIDs (47% vs. 65%, p = 0.001). RhIG preparations from seven manufacturers varied greatly in the level of Fc-fucosylation (56%-91%). The level of fucosylation slightly increased upon repeated immunization, although it remained fairly constant over time. The RhIG from the different manufacturers all demonstrated increased Fc-galactosylation (64%-82%) compared to total IgG (38%-51%). RhIG preparations vary in Fc-fucosylation and all demonstrate increased galactosylation. Despite not knowing the exact working mechanism, immunoprophylaxis could perhaps be optimized by selection of donors whose anti-D have low amounts of Fc-fucose, to increase the clearance activity of anti-D preparations, as well as high amounts of galactosylation, for anti-inflammatory effects. Implementing a biologic assay in the standardization of RhIG preparations might be considered. © 2014 AABB.

  16. Desenvolvimento e avaliação de um teste ELISA indireto para o diagnóstico sorológico do mormo em equídeos

    Directory of Open Access Journals (Sweden)

    José Andreey A. Teles

    2012-09-01

    Full Text Available O mormo é uma enfermidade infecto-contagiosa de caráter agudo ou crônico que acomete principalmente os equídeos, causando enormes prejuízos na cadeia produtiva do cavalo. Para controlar a enfermidade o Ministério da Agricultura, Pecuária e Abastecimento (MAPA instituiu medidas sanitárias obrigatórias em todo território nacional que incluem o diagnóstico oficial pela fixação do complemento (FC, maleinização e sacrifício dos animais positivos. Os kits atuais utilizados no diagnóstico da doença são importados, dificultando e encarecendo sua aplicação na rotina. Objetivou-se com este estudo padronizar um teste de ELISA indireto utilizando o extrato protéico de Burkholderia mallei isolada a partir de equídeo portador no estado de Pernambuco. As amostras foram cultivadas em ágar sangue 10%, incubada por 48h a 37°C; posteriormente caracterizou-se fenotípica e genotipicamente uma das colônias isoladas, e em seguida a cultivou em BHI para enriquecimento; logo após, esta foi repicada para o meio Dor-set Henley o qual foi incubado a 37ºC sob 60rpm por oito semanas. Para padronização do teste utilizou-se o Conjugado Proteína G Peroxidase Sigma na diluição de 1:90.000, com soros diluídos em 1:100 e o antígeno em 1:400. Utilizou-se 60 soros como controle negativo testados frente à FC para determinação do ponto de corte o qual ficou em 0,042nm. Feitas as padronizações, foram testadas 300 amostras, onde 99% (297 foram concordantes com os resultados obtidos na FC. Ao final, o ensaio apresentou 100% de sensibilidade e 98,2% de especificidade com valores preditivo positivo e negativo de 97,7% e 100%, respectivamente. O teste de concordância kappa foi 0,98 e a repetibilidade intra e interplaca ficaram em 8,8 e 10,3%, respectivamente. Diante dos resultados obtidos durante os ensaios, conclui-se que o teste de ELISA indireto pode ser utilizado como uma ferramenta de diagnóstico eficiente. Entretanto, mais ensaios devem ser

  17. Detection of serpentine in exogenic carbonaceous chondrite material on Vesta from Dawn FC data

    Science.gov (United States)

    Nathues, Andreas; Hoffmann, Martin; Cloutis, Edward A.; Schäfer, Michael; Reddy, Vishnu; Christensen, Ulrich; Sierks, Holger; Thangjam, Guneshwar Singh; Le Corre, Lucille; Mengel, Kurt; Vincent, Jean-Baptist; Russell, Christopher T.; Prettyman, Tom; Schmedemann, Nico; Kneissl, Thomas; Raymond, Carol; Gutierrez-Marques, Pablo; Hall, Ian; Büttner, Irene

    2014-09-01

    The Dawn mission’s Framing Camera (FC) observed Asteroid (4) Vesta in 2011 and 2012 using seven color filters and one clear filter from different orbits. In the present paper we analyze recalibrated HAMO color cubes (spatial resolution ∼60 m/pixel) with a focus on dark material (DM). We present a definition of highly concentrated DM based on spectral parameters, subsequently map the DM across the Vestan surface, geologically classify DM, study its spectral properties on global and local scales, and finally, compare the FC in-flight color data with laboratory spectra. We have discovered an absorption band centered at 0.72 μm in localities of DM that show the lowest albedo values by using FC data as well as spectral information from Dawn’s imaging spectrometer VIR. Such localities are contained within impact-exposed outcrops on inner crater walls and ejecta material. Comparisons between spectral FC in-flight data, and laboratory spectra of meteorites and mineral mixtures in the wavelength range 0.4-1.0 μm, revealed that the absorption band can be attributed to the mineral serpentine, which is typically present in CM chondrites. Dark material in its purest form is rare on Vesta’s surface and is distributed globally in a non-uniform manner. Our findings confirm the hypothesis of an exogenic origin of the DM by the infall of carbonaceous chondritic material, likely of CM type. It further confirms the hypothesis that most of the DM was deposited by the Veneneia impact.

  18. Chelate-size effects on the structures, chemical behavior, properties, and catalytic activity of the new palladium(II)-allyl complexes [Pd(eta(3)-1-R-1-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), n=2 or 1, and R-1 = h or ph}

    NARCIS (Netherlands)

    Pérez, S.; López, C.; Bosque, R.; Solans, X.; Font-Bardía, M.; Roig, A.; Molins, E.; van Leeuwen, P.W.N.M.; van Strijdonck, G.P.F.; Freixa, Z.

    2008-01-01

    The synthesis, X-ray crystal structures, and the study of the solution behavior of the palladium(II) allyl complexes [Pd(eta(3)-1R(1)-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {with Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), R-1 = H, and n = 2 (4) or 1 (5) or R-1 = Ph and n = 2 (6) or 1 (7)} are described. The

  19. Site-selective conjugation of an anticoagulant aptamer to recombinant albumins and maintenance of neonatal Fc receptor binding

    DEFF Research Database (Denmark)

    Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia

    2017-01-01

    -linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer......-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment...... of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4...

  20. 32 CFR 842.97 - Referring a claim to the US Attorney or the Department of Justice.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Referring a claim to the US Attorney or the Department of Justice. 842.97 Section 842.97 National Defense Department of Defense (Continued) DEPARTMENT OF... United States (31 U.S.C. 3701, 3711-3719) § 842.97 Referring a claim to the US Attorney or the Department...

  1. Final Technical Report Grant No. DE-FG02-97ER45653 Lance E. De Long, Principal Investigator, University of Kentucky Period of Performance: 09/01/97 to 05/14/15

    Energy Technology Data Exchange (ETDEWEB)

    De Long, Lance Eric [Univ. of Kentucky, Lexington, KY (United States)

    2016-11-24

    Prior to 1997, the PI had studied the unusual upper critical magnetic field phase boundaries of several novel or exotic types of superconductors, including charge density wave materials such as NbSe2, organic superconductors such as κ-(ET)2Cu[N(CN)2]Br, high-temperature oxide superconductors such as (Ba,K)BiO3 and the cuprates, heavy fermion superconductors such as U6Fe, UBe13, URu2Si2 and UPt3, and re-entrant Kondo alloys such as (La,Ce)Al2 and ferromagnetic superconductors such as ErRh4B4. Most of these materials exhibited marked positive or negative curvature of HC2(T) which could not be explained by traditional pair-breaking models. It became clear that many of these materials had very short coherence lengths that made quantized vortices highly mobile (depinned) near the phase boundary, and the fundamental, equilibrium HC2(T) difficult to measure using finite field or current drives. These problems made the underlying physics obscure, and led to erroneous interpretations of experimental data in terms of models of exotic superconducting pairing mechanisms. Around 1995, these issues led the PI to take advantage of modern electron beam lithography techniques for patterning superconducting and ferromagnetic thin films on the nanoscale. Primarily due to strong magnetic shape anisotropy effects, EBL patterning has led to enhanced control of the spatial distribution and dynamics of topological defects such as domain walls and magnetic vortices, which can create serious energy dissipation and other limitations for modern devices. Moreover, finite size and interface effects also strongly alter phase transition temperatures and phase boundaries of superconducting and magnetic films, as well as introduce barriers to equilibration, enhanced fluctuations and alter magnetic relaxation. Geometrical frustration and spin ice

  2. Influencia de la relación velocidad de corte-avance en la calidad superficial de muestras taladradas de fibra de carbono

    Directory of Open Access Journals (Sweden)

    Álvarez, M.

    2005-12-01

    Full Text Available The industrial applications of Carbon Fiber (CF have increased in the last years. Particularly, in the aerospace industry, these materials are usually drilled because of the assembly requirements of the structural elements of airships. However, drilling of CF can be accompanied of troubles such as delaminations, lost of surface quality and quick wear of cutting tool. In this work, a study on the surface quality of CF drilled samples as a function of the cutting parameters has been achieved.

    En los últimos años, la fibra de carbono (FC encuentra, cada vez, más aplicaciones en los distintos sectores industriales. En el caso particular de la industria aeronáutica, este tipo de materiales se somete frecuentemente a operaciones de taladrado formando parte de estructuras híbridas PC/substrato metálico, debido a las necesidades de montaje en los elementos estructurales de una aeronave. Sin embargo, en el taladrado de FC se puede presentar una serie de problemas como las delaminaciones, la pérdida de calidad en el acabado superficial o el desgaste rápido y excesivo de la herramienta de corte. En este trabajo se lleva a cabo un primer estudio de la calidad de acabado superficial obtenida en muestras de FC taladradas en función de las condiciones de corte impuestas.

  3. Effect of pH, temperature, and salt on the stability of Escherichia coli- and Chinese hamster ovary cell-derived IgG1 Fc.

    Science.gov (United States)

    Li, Cynthia H; Narhi, Linda O; Wen, Jie; Dimitrova, Mariana; Wen, Zai-qing; Li, Jenny; Pollastrini, Joseph; Nguyen, Xichdao; Tsuruda, Trace; Jiang, Yijia

    2012-12-18

    The circulation half-life of a potential therapeutic can be increased by fusing the molecule of interest (an active peptide, the extracellular domain of a receptor, an enzyme, etc.) to the Fc fragment of a monoclonal antibody. For the fusion protein to be a successful therapeutic, it must be stable to process and long-term storage conditions, as well as to physiological conditions. The stability of the Fc used is critical for obtaining a successful therapeutic protein. The effects of pH, temperature, and salt on the stabilities of Escherichia coli- and Chinese hamster ovary cell (CHO)-derived IgG1 Fc high-order structure were probed using a variety of biophysical techniques. Fc molecules derived from both E. coli and CHO were compared. The IgG1 Fc molecules from both sources (glycosylated and aglycosylated) are folded at neutral pH and behave similarly upon heat- and low pH-induced unfolding. The unfolding of both IgG1 Fc molecules occurs via a multistep unfolding process, with the tertiary structure and C(H)2 domain unfolding first, followed by changes in the secondary structure and C(H)3 domain. The acid-induced unfolding of IgG1 Fc molecules is only partially reversible, with the formation of high-molecular weight species. The CHO-derived Fc protein (glycosylated) is more compact (smaller hydrodynamic radius) than the E. coli-derived protein (aglycosylated) at neutral pH. Unfolding is dependent on pH and salt concentration. The glycosylated C(H)2 domain melts at a temperature 4-5 °C higher than that of the aglycosylated domain, and the low-pH-induced unfolding of the glycosylated Fc molecule occurs at a pH ~0.5 pH unit lower than that of the aglycosylated protein. The difference observed between E. coli- and CHO-derived Fc molecules primarily involves the C(H)2 domain, where the glycosylation of the Fc resides.

  4. Increase of the contract amounts for LHC civil-engineering construction and civil-engineering consultancy contracts

    CERN Document Server

    2005-01-01

    This document concerns the increase of the contract amounts for LHC civil-engineering construction and civil-engineering consultancy, Package 2. The Finance Committee is invited to take note of the increase of the contract amounts with: - the joint venture DRAGADOS (ES) and SELI (IT) for civil-engineering construction, LHC Package 2, for an amount of 28 087 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee (CERN/FC/4516) of 132 200 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 160 287 000 Swiss francs, subject to revision. - the joint venture GIBB (GB), GEOCONSULT (AT) and SGI (CH) for the provision of civil-engineering consultancy services, LHC Package 2, for an amount of 900 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee of 13 800 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 14 700 000 Swiss francs, subject to revision

  5. First results from the US-PRC PMI collaboration on EAST

    Science.gov (United States)

    Maingi, R.; Lunsford, R.; Mansfield, D.; Diallo, A.; Hu, J.; Sun, Z.; Zuo, G.; Gong, X.; Tritz, K.; Canik, J.; Osborne, T.; EAST Team

    2017-10-01

    A US-PRC collaboration was formed to understand the plasma-material interface for improved long pulse discharge performance in EAST, with an emphasis on Li conditioning techniques. The US multi-institutional team consists of participants from PPPL, UI-UC, UT-K, ORNL, MIT, LANL, and JHU. In Dec. 2016, this team co-led experiments on the use of Li aerosol injection to mitigate ELMs, Li granule injection to pace ELMs, and a flowing liquid Li limiter to serve as a primary plasma-facing component. Li aerosol injection was shown to eliminate ELMs using the upper ITER-like W divertor, extending previous results of ELM suppression in the lower cabon divertor (J.S. Hu, PRL 2015). In addition Li granule injection was shown to trigger and even pace ELMs, although the paced ELM frequency was slower than the natural ELM frequency in this set of experiments; previously paced ELM frequency was comparable to natural ELMs frequency (D.K. Mansfield, NF 2013). Finally a second generation flowing liquid Li limiter was shown to be compatible with ELMy H-mode plasmas, pushed within 1 cm of the separatrix. The surface showed no damage to PMI and improved wetting as compared to the first generation limiter experiments (J.S. Hu, NF 2016 and G.Z. Zuo, NF 2017). US scientists supported in part by US DoE contracts DE-AC02-09CH11466, DE-FG02-09ER55012, DE-AC05-00OR22725, and DE-FC02-04ER54698, and ASIPP scientists by Contract No. 11625524, No. 11075185, No. 11021565, and No. 2013GB114004.

  6. Efecto del estiramiento estático de 15, 30 y 60 segundos sobre el rango de movimiento de la flexión de cadera con rodilla extendida

    Directory of Open Access Journals (Sweden)

    Claudia Lucía Ariza-García

    2014-06-01

    Full Text Available Objetivo: Evaluar el efecto de tres duraciones de estiramiento estático pasivo, 15, 30 y 60 segundos (s para aumentar el rango de movimiento de la flexión de cadera (ROM-FC. Metodología: Ensayo Clínico Controlado Aleatorizado. Nueve estudiantes mujeres (21,7 ± 4,3 años fueron asignadas aleatoriamente a tres grupos, 15 (G15, 30 (G30 y 60 (G60 s; n = 3 en cada grupo. El estiramiento de la musculatura isquitotibial se realizó en decúbito supino, máxima flexión de cadera, rodilla extendida y dorsiflexión de pie con ayuda de una banda elástica; dos veces consecutivas en ambos miembros inferiores, tres veces/semana, por tres semanas. El resultado principal fue el cambio del ROM-FC izquierda y derecha al finalizar la intervención. Se usó la prueba t de student y el análisis ANOVA. Resultados:  Las diferencias entre evaluaciones en G15 y G30 fueron estadísticamente significativas para el miembro inferior derecho. No se encontraron diferencias significativas en el grupo G60 del hemicuerpo derecho ni en grupo alguno del hemicuerpo izquierdo. Tampoco para el aumento de ROM-FC entre los tres grupos ni entre hemicuerpos. Conclusión: El estiramiento estático pasivo de 15 y 30 s de duración fue efectivo para aumentar el ROM-FC derecho. Se requieren futuros estudios con un tamaño de muestra adecuado para detectar diferencias en el aumento del ROM-FC según duración del estiramiento y hemicuerpos.

  7. Efecto de sustratos orgánicos en plantas de fresa (Fragaria sp. cv ‘Albion’ bajo condiciones de campo

    Directory of Open Access Journals (Sweden)

    José Samuel Medina-Bolívar

    2016-11-01

    Full Text Available El cultivo de fresa es una de las opciones productivas para los agricultores, principalmente de los departamentos de Cundinamarca, Antioquia y Boyacá. La tendencia creciente hacia una agricultura cada vez más abierta al comercio mundial determina que las actividades agrícolas nacionales deben ser cada día más productivas y competitivas, esto soportado en nuevas y mejores tecnologías de producción. Dentro de estas, se cuenta el uso de diferentes sustratos con el fin de solucionar problemas como acidez, alta erosión o problemas de tipo fitosanitario que impiden la siembra de forma directa en el suelo. Teniendo en cuenta lo anterior el objetivo de la investigación fue la evaluación de diferentes sustratos orgánicos en el crecimiento y desarrollo de plantas de fresa cv ‘Albion’, bajo condiciones de campo abierto. Para la evaluación se utilizó un diseño completamente al azar con tres tratamientos siendo S1: suelo 50% + fibra de coco 50% (S:FC, S2: suelo 50% + fibra de coco 25% + cascarilla de arroz 25% (S:FC:CA y S3: suelo 50% + cascarilla de arroz 50% (S:CA, cada uno conto con tres replicaciones. Las variables evaluadas fueron masa fresca y seca de raíz y parte aérea, área foliar, clorofilas totales, numero de frutos/planta y producción g/planta. El tratamiento (S1, mostró diferencias significativas según la prueba de Tukey (P≤0.05 en la mayoría de parámetros evaluados, esto lo convierte en una alternativa para la producción de fresa cv ‘Albión’ bajo las condiciones de estudio.

  8. Technical progress report, Contracts DE-AC02-81ER40014, 40015 and 40016

    International Nuclear Information System (INIS)

    1981-01-01

    This Progress Report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1980 through July 31, 1981, under contracts between the University of Colorado and the United States Department of Energy. The shorter report period of nine months is due to a change to an earlier submission date this year for our proposal for support to begin February 1, 1982. Cyclotron operation, research, and development have been supported under contract DE-AC02-81ER40014. The AVF cyclotron has continued to provide reliable and versatile beams of protons, deuterons, 3 He and 4 He. A wide variety of research results in direct reactions, nuclear structure, and compound reaction mechanisms can be noted in this Progress Report, correlated in many cases to current problems in intermediate energy physics. Theoretical work on nuclear reactions, carried out under contract DE-AC02-81ER40015, has been well matched to our experimental programs in low and intermediate energy physics. One important result has been the recasting of the DWBA in an eikonal expansion suited to high energy reactions. Our efforts in intermediate energy physics, under contract DE-AC02-81ER40016, have emphasized pion scattering studies at LAMPF and TRIUMF and proton induced charge exchange reactions at IUCF. Data for an important test of hadronic charge symmetry have been completed at two energies, using elastic pion-deuteron scattering

  9. Effect of a 0.5% chlorhexidine gel on dental plaque superinfecting microorganisms in mentally handicapped patients Efeito do gel de clorexidina a 0,5% em microrganismos superinfectantes da placa bacteriana de portadores de necessidades especiais

    Directory of Open Access Journals (Sweden)

    Cláudio Mendes Pannuti

    2003-09-01

    Full Text Available A randomized clinical trial was conducted to investigate the effect of a 0.5% chlorhexidine (CHX gel on dental plaque superinfecting microorganisms in mentally handicapped patients. Thirty inmates from the institution "Casas André Luiz" were assigned to either test group (CHX gel, n = 15 or control group (placebo gel, n = 15. The gel was administered over a period of 8 weeks. Supragingival plaque samples were collected at baseline, after gel use (8 weeks and 16 weeks after baseline. The presence of Gram-negative Enterobacteriaceae, Staphylococcus and yeasts was evaluated. No significant growth of any superinfecting microorganism was observed in the CHX group, when compared to the placebo group. The results indicated that the 0.5% chlorhexidine gel did not produce an undesirable shift in these bacterial populations.Foi conduzido um ensaio clínico aleatório com objetivo de investigar o efeito do gel de clorexidina (CHX a 0,5% sobre microorganismos superinfectantes da placa bacteriana de pacientes especiais. Trinta internos da instituição "Casas André Luiz" foram aleatoriamente divididos em grupo teste (gel de CHX, n = 15 e controle (gel placebo, n = 15. O gel foi utilizado por oito semanas. Amostras de placa supragengival foram coletadas no início do estudo, após o uso do gel (oito semanas e 16 semanas após o início do estudo. Foi avaliada a presença de bacilos entéricos Gram-negativos, Staphylococcus e leveduras. Não houve diferença entre os grupos quanto à presença desses microorganismos em qualquer momento do estudo. Os resultados indicam que o gel de CHX não provocou mudanças significativas na composição desses microorganismos.

  10. On the novel double perovskites A2Fe(Mn0.5W0.5)O6 (A= Ca, Sr, Ba). Structural evolution and magnetism from neutron diffraction data

    Science.gov (United States)

    García-Ramos, Crisanto A.; Larrégola, Sebastián; Retuerto, María; Fernández-Díaz, María Teresa; Krezhov, Kiril; Alonso, José Antonio

    2018-06-01

    New A2Fe(Mn0.5W0.5)O6 (A = Ca, Sr, Ba) double perovskite oxides have been prepared by ceramic techniques. X-ray diffraction (XRD) complemented with neutron powder diffraction (NPD) indicate a structural evolution from monoclinic (space group P21/n) for A = Ca to cubic (Fm-3m) for A = Sr and finally to hexagonal (P63/mmc) for A = Ba as the perovskite tolerance factor increases with the A2+ ionic size. The three oxides present different tilting schemes of the FeO6 and (Mn,W)O6 octahedra. NPD data also show evidence in all cases of a considerable anti-site disordering, involving the partial occupancy of Fe positions by Mn atoms, and vice-versa. Magnetic susceptibility data show magnetic transitions below 50 K characterized by a strong irreversibility between ZFC and FC susceptibility curves. The A = Ca perovskite shows a G-type magnetic structure, with weak ordered magnetic moments due to the mentioned antisite disordering. Interesting magnetostrictive effects are observed for the Sr perovskite below 10 K.

  11. Antigen-Specific IgG ameliorates allergic airway inflammation via Fcγ receptor IIB on dendritic cells

    Directory of Open Access Journals (Sweden)

    Karasuyama Hajime

    2011-04-01

    Full Text Available Abstract Background There have been few reports on the role of Fc receptors (FcRs and immunoglobulin G (IgG in asthma. The purpose of this study is to clarify the role of inhibitory FcRs and antigen presenting cells (APCs in pathogenesis of asthma and to evaluate antigen-transporting and presenting capacity by APCs in the tracheobronchial mucosa. Methods In FcγRIIB deficient (KO and C57BL/6 (WT mice, the effects of intratracheal instillation of antigen-specific IgG were analysed using the model with sensitization and airborne challenge with ovalbumin (OVA. Thoracic lymph nodes instilled with fluorescein-conjugated OVA were analysed by fluorescence microscopy. Moreover, we analysed the CD11c+ MHC class II+ cells which intaken fluorescein-conjugated OVA in thoracic lymph nodes by flow cytometry. Also, lung-derived CD11c+ APCs were analysed by flow cytometry. Effects of anti-OVA IgG1 on bone marrow dendritic cells (BMDCs in vitro were also analysed. Moreover, in FcγRIIB KO mice intravenously transplanted dendritic cells (DCs differentiated from BMDCs of WT mice, the effects of intratracheal instillation of anti-OVA IgG were evaluated by bronchoalveolar lavage (BAL. Results In WT mice, total cells and eosinophils in BAL fluid reduced after instillation with anti-OVA IgG1. Anti-OVA IgG1 suppressed airway inflammation in hyperresponsiveness and histology. In addition, the number of the fluorescein-conjugated OVA in CD11c+ MHC class II+ cells of thoracic lymph nodes with anti-OVA IgG1 instillation decreased compared with PBS. Also, MHC class II expression on lung-derived CD11c+ APCs with anti-OVA IgG1 instillation reduced. Moreover, in vitro, we showed that BMDCs with anti-OVA IgG1 significantly decreased the T cell proliferation. Finally, we demonstrated that the lacking effects of anti-OVA IgG1 on airway inflammation on FcγRIIB KO mice were restored with WT-derived BMDCs transplanted intravenously. Conclusion Antigen-specific IgG ameliorates

  12. Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression in U937 cells.

    Science.gov (United States)

    Chihara, Kazuyasu; Kato, Yuji; Yoshiki, Hatsumi; Takeuchi, Kenji; Fujieda, Shigeharu; Sada, Kiyonao

    2017-09-13

    The adaptor protein c-Abl SH3 domain binding protein-2 (3BP2) is tyrosine phosphorylated by Syk in response to cross-linking of antigen receptors, which in turn activates various immune responses. Recently, a study using the mouse model of cherubism, a dominant inherited disorder caused by mutations in the gene encoding 3BP2, showed that 3BP2 is involved in the regulation of phagocytosis mediated by Fc receptor for IgG (FcγR) in macrophages. However, the molecular mechanisms underlying 3BP2-mediated regulation of phagocytosis and the physiological relevance of 3BP2 tyrosine phosphorylation remains elusive. In this study, we established various gene knockout U937 cell lines using the CRISPR/Cas9 system and found that 3BP2 is rapidly tyrosine phosphorylated by Syk in response to cross-linking of FcγRI. Depletion of 3BP2 caused significant reduction in the Fc receptor γ chain (FcRγ)-mediated phagocytosis in addition to the FcγRI-mediated induction of chemokine mRNA for IL-8, CCL3L3 and CCL4L2. Syk-dependent tyrosine phosphorylation of 3BP2 was required for overcoming these defects. Finally, we found that the PH and SH2 domains play important roles on FcγRI-mediated tyrosine phosphorylation of 3BP2 in HL-60 cells. Taken together, these results indicate that Syk-dependent tyrosine phosphorylation of 3BP2 is required for optimal FcRγ-mediated phagocytosis and chemokine expression.

  13. Substituição Parcial do Farelo de Soja pela Farinha de Vísceras de Aves em Dietas Balanceadas com Base na Proteína e em Aminoácidos Totais ou Digestíveis para Frangos de Corte Partial Substitution of Soybean Meal by Poultry Offal Meal in Diets Balanced According to Protein and Total or Digestible Amino Acids for Broilers

    Directory of Open Access Journals (Sweden)

    C Bellaver

    2001-12-01

    Full Text Available A formulação com base no conceito de proteína ideal (PI é mais eficiente quando são usados ingredientes alternativos ao milho (M e ao farelo de soja (FS. Assim, o objetivo desse trabalho foi comparar formulações de dietas utilizando o conceito de PI, usando farinha de vísceras (FV em substituição ao FS, em dietas de frangos de corte. Os tratamentos foram os seguintes: T1 = dieta com 22 % e 20% de proteína bruta (PB nas fases inicial (FI e de crescimento (FC e 3200 kcal/kg de EM durante todo experimento; T2 = energia semelhante a dieta T1 e PI à base de M e FS (1,15% de lisina digestível na FI e 0,90% de lisina digestível na FC; T3=dieta semelhante a T2, com 20 % e 25 % de substituição do FS por FV nas FI e FC, respectivamente; T4=dieta semelhante a T3, com 40 e 50 % de substituição do FS por FV, nas FI e FC, respectivamente; T5=dieta semelhante a T4, porém com balanço por aminoácidos (AA totais (1,10 e 1,00 % de lisina total nas FI e FC, respectivamente. Os resultados permitiram concluir que a formulação com base na PI é melhor do que aquela que considera a PB ou AA totais. A inclusão de 20 % FV na FI e 25 % na FC de frangos de corte, em substituição ao FS, melhorou o desempenho até os 21 dias e não alterou o desempenho até os 42 dias em dietas formuladas dentro do conceito de proteína ideal.Ideal protein (IP concept in feed formulation is more suitable when alternative ingredients to corn (C and soybean meal (SBM are used. Thus, the objective of this paper was to compare diets using IP concept and poultry offal meal (POM in substitution to SBM in broiler diets. The treatments were: T1= diets with 22% and 20 % crude protein (CP in starting phase (SP and growing phase (GP, respectively and 3200 kcal ME/kg all over the experiment; T2= similar energy to T1 and IP diet based on C and SBM (1.15% digestible lysine in SP and 0.90 % in GP; T3= similar diet to T2, with 20% and 25% of substitution of SBM by POM in SP and GP

  14. Perfil de los usuarios activos y finales de clubes deportivos de Bogotá D. C.

    Directory of Open Access Journals (Sweden)

    Billy Crissien

    2010-08-01

    hacia los clubes en las diferentes disciplinas deportivas y analizar el caso particular de los hinchas de equipos profesionales. Para esto, se desarrolló una investigación descriptiva con encuestas a 336 usuarios activos y finales de clubes deportivos en la ciudad de Bogotá. Los resultados muestran un perfil diferencial para jugadores y espectadores a nivel de estilo de vida, hábitos saludables y patrón de interacción con los eventos deportivos. Los hinchas de los equipos profesionales de fútbol poseen un perfil similar al de los usuarios finales de los clubes de otras disciplinas, pero evidencian un nivel de involucramiento mucho más alto.

  15. 48 CFR 970.3102-05-4 - Bonding costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bonding costs. 970.3102-05... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05-4 Bonding costs. (d) The allowability of bonding costs shall be determined pursuant to 970.5228...

  16. Increased half-life and enhanced potency of Fc-modified human PCSK9 monoclonal antibodies in primates.

    Directory of Open Access Journals (Sweden)

    Yijun Shen

    Full Text Available Blocking proprotein convertase subtilisin kexin type 9 (PCSK9 binding to low-density lipoprotein receptor (LDLR can profoundly lower plasma LDL levels. Two anti-PCKS9 monoclonal antibodies (mAbs, alirocumab and evolocumab, were approved by the FDA in 2015. The recommended dose is 75 mg to 150 mg every two weeks for alirocumab and 140mg every two weeks or 420 mg once a month for evolocumab. This study attempted to improve the pharmacokinetic properties of F0016A, an IgG1 anti-PCKS9 mAb, to generate biologically superior molecules. We engineered several variants with two or three amino acid substitutions in the Fc fragment based on prior knowledge. The Fc-modified mAbs exhibited increased binding to FcRn, resulting in prolonged serum half-life and enhanced efficacy in vivo. These results demonstrate that Fc-modified anti-PCKS9 antibodies may enable less frequent or lower dosing of antibodies by improved recycling into the blood.

  17. Strategic role of the ubiquitin-dependent segregase p97 (VCP or Cdc48) in DNA replication.

    Science.gov (United States)

    Ramadan, Kristijan; Halder, Swagata; Wiseman, Katherine; Vaz, Bruno

    2017-02-01

    Genome amplification (DNA synthesis) is one of the most demanding cellular processes in all proliferative cells. The DNA replication machinery (also known as the replisome) orchestrates genome amplification during S-phase of the cell cycle. Genetic material is particularly vulnerable to various events that can challenge the replisome during its assembly, activation (firing), progression (elongation) and disassembly from chromatin (termination). Any disturbance of the replisome leads to stalling of the DNA replication fork and firing of dormant replication origins, a process known as DNA replication stress. DNA replication stress is considered to be one of the main causes of sporadic cancers and other pathologies related to tissue degeneration and ageing. The mechanisms of replisome assembly and elongation during DNA synthesis are well understood. However, once DNA synthesis is complete, the process of replisome disassembly, and its removal from chromatin, remains unclear. In recent years, a growing body of evidence has alluded to a central role in replisome regulation for the ubiquitin-dependent protein segregase p97, also known as valosin-containing protein (VCP) in metazoans and Cdc48 in lower eukaryotes. By orchestrating the spatiotemporal turnover of the replisome, p97 plays an essential role in DNA replication. In this review, we will summarise our current knowledge about how p97 controls the replisome from replication initiation, to elongation and finally termination. We will also further examine the more recent findings concerning the role of p97 and how mutations in p97 cofactors, also known as adaptors, cause DNA replication stress induced genomic instability that leads to cancer and accelerated ageing. To our knowledge, this is the first comprehensive review concerning the mechanisms involved in the regulation of DNA replication by p97.

  18. Hybrid IgG4/IgG4 Fc antibodies form upon 'Fab-arm' exchange as demonstrated by SDS-PAGE or size-exclusion chromatography

    NARCIS (Netherlands)

    Rispens, Theo; den Bleker, Tamara H.; Aalberse, Rob C.

    2010-01-01

    Human IgG4 antibodies are dynamic molecules that in vivo exchange half-molecules to become bispecific antibodies. Here we show that IgG4 antibodies and IgG4 Fc fragments similarly exchange resulting in hybrid antibodies (a single Fab + Fc) with a molecular weight of ca. 100 kDa. These antibodies can

  19. Case studies on the success or failure of futures contracts.

    Directory of Open Access Journals (Sweden)

    Hilary Till

    2015-06-01

    Full Text Available Why do some futures contracts succeed and others fail? Although the U.S. futures markets have evolved in a trial-and-error fashion, research suggests key elements have determined whether particular futures contracts succeeded or failed. This knowledge could be useful for new financial centers as they build successful futures markets. This paper shows that there are three elements that determine whether a futures contract succeeds or not: 1. There must be a commercial need for hedging; 2. A pool of speculators must be attracted to a market; and 3. Public policy should not be too adverse to futures trading

  20. Downmodulation of Vaccine-Induced Immunity and Protection against the Intracellular Bacterium Francisella tularensis by the Inhibitory Receptor FcγRIIB

    Directory of Open Access Journals (Sweden)

    Brian J. Franz

    2015-01-01

    Full Text Available Fc gamma receptor IIB (FcγRIIB is the only Fc gamma receptor (FcγR which negatively regulates the immune response, when engaged by antigen- (Ag- antibody (Ab complexes. Thus, the generation of Ag-specific IgG in response to infection or immunization has the potential to downmodulate immune protection against infection. Therefore, we sought to determine the impact of FcγRIIB on immune protection against Francisella tularensis (Ft, a Category A biothreat agent. We utilized inactivated Ft (iFt as an immunogen. Naïve and iFt-immunized FcγRIIB knockout (KO or wildtype (WT mice were challenged with Ft-live vaccine strain (LVS. While no significant difference in survival between naïve FcγRIIB KO versus WT mice was observed, iFt-immunized FcγRIIB KO mice were significantly better protected than iFt-immunized WT mice. Ft-specific IgA in serum and bronchial alveolar lavage, as well as IFN-γ, IL-10, and TNF-α production by splenocytes harvested from iFt-immunized FcγRIIB KO, were also significantly elevated. In addition, iFt-immunized FcγRIIB KO mice exhibited a reduction in proinflammatory cytokine levels in vivo at 5 days after challenge, which correlates with increased survival following Ft-LVS challenge in published studies. Thus, these studies demonstrate for the first time the ability of FcγRIIB to regulate vaccine-induced IgA production and downmodulate immunity and protection. The immune mechanisms behind the above observations and their potential impact on vaccine development are discussed.

  1. Dual role of Fcγ receptors in host defense and disease in Borrelia burgdorferi-infected mice

    Directory of Open Access Journals (Sweden)

    Alexia Anne Belperron

    2014-06-01

    Full Text Available Arthritis in mice infected with the Lyme disease spirochete, Borrelia burgdorferi, results from the influx of innate immune cells responding to the pathogen in the joint and is influenced in part by mouse genetics. Production of inflammatory cytokines by innate immune cells in vitro is largely mediated by Toll-like receptor (TLR interaction with Borrelia lipoproteins, yet surprisingly mice deficient in TLR2 or the TLR signaling molecule MyD88 still develop arthritis comparable to that seen in wild type mice after B. burgdorferi infection. These findings suggest that other, MyD88-independent inflammatory pathways can contribute to arthritis expression. Clearance of B. burgdorferi is dependent on the production of specific antibody and phagocytosis of the organism. As Fc receptors (FcγR are important for IgG-mediated clearance of immune complexes and opsonized particles by phagocytes, we examined the role that FcγR play in host defense and disease in B. burgdorferi-infected mice. B. burgdorferi-infected mice deficient in the Fc receptor common gamma chain (FcεRγ-/- mice harbored ~10 fold more spirochetes than similarly infected wild type mice, and this was associated with a transient increase in arthritis severity. While the elevated pathogen burdens seen in B. burgdorferi-infected MyD88-/- mice were not affected by concomitant deficiency in FcγR, arthritis was reduced in FcεRγ-/-MyD88-/- mice in comparison to wild type or single knockout mice. Gene expression analysis from infected joints demonstrated that absence of both MyD88 and FcγR lowers mRNA levels of proteins involved in inflammation, including Cxcl1 (KC, Xcr1 (Gpr5, IL-1beta, and C reactive protein. Taken together, our results demonstrate a role for FcγR-mediated immunity in limiting pathogen burden and arthritis in mice during the acute phase of B. burgdorferi infection, and further suggest that this pathway contributes to the arthritis that develops in B. burgdorferi

  2. 21 CFR 866.5530 - Immunoglobulin G (Fc fragment specific) immunological test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Immunoglobulin G (Fc fragment specific... Test Systems § 866.5530 Immunoglobulin G (Fc fragment specific) immunological test system. (a) Identification. An immunoglobulin G (Fc fragment specific) immunological test system is a device that consists of...

  3. Antibody-mediated immunity to the obligate intracellular bacterial pathogen Coxiella burnetii is Fc receptor- and complement-independent

    Directory of Open Access Journals (Sweden)

    Heinzen Robert A

    2009-05-01

    Full Text Available Abstract Background The obligate intracellular bacterial pathogen Coxiella burnetii causes the zoonosis Q fever. The intracellular niche of C. burnetii has led to the assumption that cell-mediated immunity is the most important immune component for protection against this pathogen. However, passive immunization with immune serum can protect naïve animals from challenge with virulent C. burnetii, indicating a role for antibody (Ab in protection. The mechanism of this Ab-mediated protection is unknown. Therefore, we conducted a study to determine whether Fc receptors (FcR or complement contribute to Ab-mediated immunity (AMI to C. burnetii. Results Virulent C. burnetii infects and replicates within human dendritic cells (DC without inducing their maturation or activation. We investigated the effects of Ab opsonized C. burnetii on human monocyte-derived and murine bone marrow-derived DC. Infection of DC with Ab-opsonized C. burnetii resulted in increased expression of maturation markers and inflammatory cytokine production. Bacteria that had been incubated with naïve serum had minimal effect on DC, similar to virulent C. burnetii alone. The effect of Ab opsonized C. burnetii on DC was FcR dependent as evidenced by a reduced response of DC from FcR knockout (FcR k/o compared to C57Bl/6 (B6 mice. To address the potential role of FcR in Ab-mediated protection in vivo, we compared the response of passively immunized FcR k/o mice to the B6 controls. Interestingly, we found that FcR are not essential for AMI to C. burnetii in vivo. We subsequently examined the role of complement in AMI by passively immunizing and challenging several different strains of complement-deficient mice and found that AMI to C. burnetii is also complement-independent. Conclusion Despite our data showing FcR-dependent stimulation of DC in vitro, Ab-mediated immunity to C. burnetii in vivo is FcR-independent. We also found that passive immunity to this pathogen is independent of

  4. 75 FR 2109 - Notice of Availability of Final Contracting Policy

    Science.gov (United States)

    2010-01-14

    ...-sector companies available to State and local government entities that have a need for the services... will continue to examine ways to improve its contracting processes, including minimizing the turnover frequency of contracting personnel and reducing the length of time required to award contracts and task...

  5. The production of KIR-Fc fusion proteins and their use in a multiplex HLA class I binding assay.

    Science.gov (United States)

    Hilton, Hugo G; Moesta, Achim K; Guethlein, Lisbeth A; Blokhuis, Jeroen; Parham, Peter; Norman, Paul J

    2015-10-01

    Soluble recombinant proteins that comprise the extracellular part of a surface expressed receptor attached to the Fc region of an IgG antibody have facilitated the determination of ligand specificity for an array of immune system receptors. Among such receptors is the family of killer cell immunoglobulin-like receptors (KIR) that recognize HLA class I ligands. These receptors, expressed on natural killer (NK) cells and T cells, play important roles in both immune defense and placental development in early pregnancy. Here we describe a method for the production of two domain KIR-Fc fusion proteins using baculovirus infected insect cells. This method is more scalable than traditional mammalian cell expression systems and produces efficiently folded proteins that carry posttranslational modifications found in native KIR. We also describe a multiplex binding assay using the Luminex platform that determines the avidity and specificity of two domain KIR-Fc for a panel of microbeads, each coated with one of 97 HLA class I allotypes. This assay is simple to perform, and represents a major improvement over the assays used previously, which were limited in the number of KIR and HLA class I combinations that could be assayed at any one time. The results obtained from this assay can be used to predict the response of NK cell and T cells when their KIR recognize HLA class I. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. NEW ROLES FOR FC RECEPTORS IN NEURODEGENERATION-THE IMPACT ON IMMUNOTHERAPY FOR ALZHEIMER’S DISEASE

    Directory of Open Access Journals (Sweden)

    James P. Fuller

    2014-08-01

    Full Text Available There are an estimated 18 million Alzheimer’s disease (AD sufferers worldwide and with no disease modifying treatment currently available, development of new therapies represents an enormous unmet clinical need. AD is characterised by episodic memory loss followed by severe cognitive decline and is associated with many neuropathological changes. AD is characterised by deposits of amyloid beta (Aβ, neurofibrillary tangles, and neuroinflammation. Active immunisation or passive immunisation against Aβ leads to the clearance of deposits in transgenic mice expressing human Aβ. This clearance is associated with reversal of associated cognitive deficits, but these results have failed to translate to humans, with both active and passive immunotherapy failing to improve memory loss. One explanation for these observations is that certain anti-Aβ antibodies mediate damage to the cerebral vasculature limiting the top dose and potentially reducing efficacy. Fc gamma receptors (Fcγ are a family of immunoglobulin like receptors which bind to the Fc portion of IgG, and mediate the response of effector cells to immune complexes. Data from both mouse and human studies suggest that cross-linking Fc receptors by therapeutic antibodies and the subsequent pro-inflammatory response mediates the vascular side effects seen following immunotherapy. Increasing evidence is emerging that Fc receptor expression on CNS resident cells, including microglia and neurons, is increased during aging and functionally involved in the pathogenesis of age-related neurodegenerative diseases. We propose that increased expression and ligation of Fc receptors in the CNS, either by endogenous IgG or therapeutic antibodies, has the potential to induce vascular damage and exacerbate neurodegeneration. To produce safe and effective immunotherapies for AD and other neurodegenerative diseases it will be vital to understand the role of Fc receptors in the healthy and diseased brain.

  7. Desempenho e características de carcaça de frangos de corte alimentados com dietas contendo farinha de resíduos do processamento de camarões (Litopeneaus vannamei - DOI: 10.4025/actascianimsci.v28i3.40 Utilization and effect of shrimp waste meal in the performance and characteristics of broiler (Litopeneaus Vannamei - DOI: 10.4025/actascianimsci.v28i3.40

    Directory of Open Access Journals (Sweden)

    Riviana Roberta de Souza Loureiro

    2006-01-01

    Full Text Available O objetivo do presente trabalho foi avaliar o desempenho zootécnico e as características de carcaça de frangos de corte, alimentados com dietas contendo farinha de resíduo do processamento de camarões (FC. Foram utilizados 240 pintos de um dia de idade, distribuídos em um delineamento experimental inteiramente casualizado, sendo 5 tratamentos (níveis de inclusão de FC: 0, 3, 6, 9 e 12% em rações a base de milho e farelo de soja com 4 repetições e 12 aves por unidade experimental. Os níveis de inclusão da FC proporcionaram efeito quadrático apenas para o ganho de peso, demonstrando que os melhores níveis de inclusão na dieta foram de 5,46% e 5,87%, nos períodos de 1 a 21 e 22 a 42 dias de idade, respectivamente, melhorando, inclusive, a pigmentação na carcaça das avesThis experiment was to evaluate the performance of broiler chickens feed with different levels of shrimp meal (SM in their diet. In this experiment 240 broiler chickens were distributed at a complete randomized design in five treatments and four replications of 12 broiler chickens per experimental unit. The levels of SM were 0, 3, 6, 9 e 12% added to zea mays and soybean-meal ration based. These rations were fed to 1-day-old broiler chicks for 6 weeks (3 weeks of starter rations and 3 weeks of finished ration. Only the weight gain presented significant difference with effects on shrimp meal levels in the ration. The shrimp waste meal (Litopenaeus vannamei resulted in a quadratic effect (P<0.05, where the best level included was 5.46 and 5.87% for 1-21 and 22-42 day-old, respectively. The increasing levels of SM inclusion improved the pigmentation of the birds’ food-pad

  8. APC targeting enhances immunogenicity of a novel multistage Fc-fusion tuberculosis vaccine in mice.

    Science.gov (United States)

    Soleimanpour, Saman; Farsiani, Hadi; Mosavat, Arman; Ghazvini, Kiarash; Eydgahi, Mohammad Reza Akbari; Sankian, Mojtaba; Sadeghian, Hamid; Meshkat, Zahra; Rezaee, Seyed Abdolrahim

    2015-12-01

    Numerous studies have demonstrated that targeting immunogens to FcγR on antigen-presenting cells (APCs) can selectively uptake and increase cellular immunity in vitro and in vivo. Therefore, the present study was conducted to evaluate immunogenicity of a novel multistage tuberculosis vaccine, a combination of an early and a dormant immunogenic protein, ESAT6 and HspX, fused to Fcγ2a fragment of mouse IgG2a to target all forms of tuberculosis. Codon-optimized genes consisting of ESAT6, a linker, and HspX fused either to mouse Fcγ2a (ESAT6:HspX:mFcγ2a) or 6× His-tag (ESAT6:HspX:His) were synthesized. The resulting proteins were then produced in Pichia pastoris. The fusion proteins were separately emulsified in dimethyldioctadecylammonium bromide(DDA)-trehalose-6,6-dibehenate(TDB) adjuvant, and their immunogenicity with and without bacille Calmette-Guérin (BCG) was assessed in C57BL/6 mice. Th1, Th2, Th17, and T-reg cytokine patterns were evaluated using the ELISA method. Both multistage vaccines induced very strong IL-12 and IFN-γ secretion from splenic cells; the Fc-tagged subunit vaccine induced a more effective Th1 immune response (IFN-γ, 910 pg/mL, and IL-12, 854 pg/mL) with a very low increase in IL-17 (∼0.1 pg/mL) and IL-4 (37 pg/mL) and a mild increase in TGF-β (543 pg/mL) compared to the BCG or ESAT6:HspX:His primed and boosted groups. The production of IFN-γ to ESAT6:HspX:Fcγ2a was very consistent and showed an increasing trend for IL-12 compared to the BCG or ESAT6:HspX:His primed and boosted groups. Fcγ2a used as a delivery vehicle supported the idea of selective uptake, inducing cross-presentation and forming a proper anti-tuberculosis response in context of Th1/Th2 and Th17/T-reg balances, which is important for protection and prevention of damage.

  9. Multiplicidade de vínculos de médicos no Estado do Ceará Multiplicidad de vínculos de médicos en el Estado de Ceará, Noreste de Brasil Multiple job contracts of physicians in Ceará, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Regina Heloisa Maciel

    2010-10-01

    con los cuales los profesionales mantenían vínculos, buscando estimar los trayectos realizados por los médicos para cumplir los contratos de trabajo y su carga horaria semanal. RESULTADOS: De los 7.008 médicos vinculados al Estado, 3,751 (53,5% poseían entre dos a cuatro vínculos, y 39 (0,6% de 11 a 20 vínculos. Un profesional poseía 20 vínculos. Más de la mitad (51,9% de los médicos poseían vínculos de trabajo que, al sumarse, totalizaban una jornada semanal por encima de 40 horas y 27,0% (1.894 mantenían vínculos en más de un municipio. CONCLUSIONES: Para aumentar las ganancias con su trabajo los médicos articulan varios empleos, ejerciendo la profesión en locales diferentes en un constante ir y venir, inclusive en variados municipios, contribuyendo a la precarización de la calidad de sus vidas y, consecuentemente, el sistema de salud.OBJECTIVE: To analyze the multiple job contracts of physicians in the Brazilian National Health System in the State of Ceará. METHODS: Documental research was performed about the work contracts of the physicians, based on data of health professional contracts in the municipalities of Ceará state, Northeastern Brazil, in 2008. Indices were created for the quantity of contracts of each physician, as well as the municipalities where each physician maintained work contracts. The distances between the municipalities where they worked was calculated in order to estimate the total weekly hours of work. RESULTS: Of the 7,008 physicians employed by the Ceará state, 3,751 (53.5% maintain between two and four job contracts and 39 (0.6% between 11 and 20 contracts. One professional maintained 20 contracts. More than half (51.9% of the physicians had work contracts that when summed totaled more than 40 weekly working hours and 27.0% (1,894 maintained job contracts with more than one municipality. CONCLUSIONS: In order to increase their work income, physicians undertake various jobs, practicing their profession in different

  10. FcγRIIb on myeloid cells rather than on B cells protects from collagen-induced arthritis.

    Science.gov (United States)

    Yilmaz-Elis, A Seda; Ramirez, Javier Martin; Asmawidjaja, Patrick; van der Kaa, Jos; Mus, Anne-Marie; Brem, Maarten D; Claassens, Jill W C; Breukel, Cor; Brouwers, Conny; Mangsbo, Sara M; Boross, Peter; Lubberts, Erik; Verbeek, J Sjef

    2014-06-15

    Extensive analysis of a variety of arthritis models in germline KO mice has revealed that all four receptors for the Fc part of IgG (FcγR) play a role in the disease process. However, their precise cell type-specific contribution is still unclear. In this study, we analyzed the specific role of the inhibiting FcγRIIb on B lymphocytes (using CD19Cre mice) and in the myeloid cell compartment (using C/EBPαCre mice) in the development of arthritis induced by immunization with either bovine or chicken collagen type II. Despite their comparable anti-mouse collagen autoantibody titers, full FcγRIIb knockout (KO), but not B cell-specific FcγRIIb KO, mice showed a significantly increased incidence and severity of disease compared with wild-type control mice when immunized with bovine collagen. When immunized with chicken collagen, disease incidence was significantly increased in pan-myeloid and full FcγRIIb KO mice, but not in B cell-specific KO mice, whereas disease severity was only significantly increased in full FcγRIIb KO mice compared with incidence and severity in wild-type control mice. We conclude that, although anti-mouse collagen autoantibodies are a prerequisite for the development of collagen-induced arthritis, their presence is insufficient for disease development. FcγRIIb on myeloid effector cells, as a modulator of the threshold for downstream Ab effector pathways, plays a dominant role in the susceptibility to collagen-induced arthritis, whereas FcγRIIb on B cells, as a regulator of Ab production, has a minor effect on disease susceptibility. Copyright © 2014 by The American Association of Immunologists, Inc.

  11. Fc receptor gamma subunit polymorphisms and systemic lupus erythematosus

    International Nuclear Information System (INIS)

    Al-Ansari, Aliya; Ollier, W.E.; Gonzalez-Gay, Miguel A.; Gul, Ahmet; Inanac, Murat; Ordi, Jose; Teh, Lee-Suan; Hajeer, Ali H.

    2004-01-01

    To investigate the possible association between Fc receptor gamma polymorphisms and systemic lupus erythematosus (SLE). We have investigated the full FcR gamma gene for polymorphisms using polymerase chain reaction (PCR)-single strand confirmational polymorphisms and DNA sequencing .The polymorphisms identified were genotype using PCR-restriction fragment length polymorphism. Systemic lupus erythematosus cases and controls were available from 3 ethnic groups: Turkish, Spanish and Caucasian. The study was conducted in the year 2001 at the Arthritis Research Campaign, Epidemiology Unit, Manchester University Medical School, Manchester, United Kingdom. Five single nucleotide polymorphisms were identified, 2 in the promoter, one in intron 4 and, 2 in the 3'UTR. Four of the 5 single nucleotide polymorphisms (SNPs) were relatively common and investigated in the 3 populations. Allele and genotype frequencies of all 4 investigated SNPs were not statistically different cases and controls. fc receptor gamma gene does not appear to contribute to SLE susceptibility. The identified polymorphisms may be useful in investigating other diseases where receptors containing the FcR gamma subunit contribute to the pathology. (author)

  12. Final Report on the Audit of Subcontract Prices on Firm-Fixed-Price Contracts Awarded to McDonnell Aircraft Company

    Science.gov (United States)

    1990-12-03

    This is our final report on the audit of Subcontract Prices on Firm-Fixed-Price Contracts Awarded to McDonnell Aircraft Company (MCAIR). The Contract Management Directorate made the audit from October 1989 through June 1990. The objective of the audit was to compare proposed and negotiated subcontract prices and determine reasons for significant variances. We also evaluated applicable internal control procedures. For a 6-month period ending December 1989, MCAIR issued 517 subcontracts valued at $679 million.

  13. Mouse splenic and bone marrow cell populations that express high-affinity Fc epsilon receptors and produce interleukin 4 are highly enriched in basophils.

    OpenAIRE

    Seder, R A; Paul, W E; Dvorak, A M; Sharkis, S J; Kagey-Sobotka, A; Niv, Y; Finkelman, F D; Barbieri, S A; Galli, S J; Plaut, M

    1991-01-01

    Splenic and bone marrow cells from normal mice, and from mice that have been polyclonally activated by injection of anti-IgD antibody, contain cells that produce interleukin 4 (IL-4) in response to crosslinkage of Fc epsilon receptors (Fc epsilon R) or Fc gamma R or to ionomycin. Isolated Fc epsilon R+ cells have recently been shown to contain all of the IL-4-producing capacity of the nonlymphoid compartment of spleen and bone marrow. Here, purified Fc epsilon R+ cells are shown to be enriche...

  14. 48 CFR 49.112-2 - Final payment.

    Science.gov (United States)

    2010-10-01

    ... voucher or invoice and forward the documents to the disbursing officer for payment. (b) Settlement by...) Construction contracts. In the case of construction contracts, before forwarding the final payment voucher, the... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Final payment. 49.112-2...

  15. Suplementação oral de L-carnitina associada ao treinamento físico e muscular respiratório na doença pulmonar obstrutiva crônica: estudo preliminar Oral supplementation of L-carnitine combined with exercise and respiratory training in patients with chronic obstructive pulmonary disease: preliminary study

    Directory of Open Access Journals (Sweden)

    Matheus Guedes Fernandes Silva

    2012-12-01

    Full Text Available Avaliar os efeitos da suplementação oral de L-carnitina associada ao treinamento físico e muscular respiratório na doença pulmonar obstrutiva crônica (DPOC. Participaram 14 voluntários com idade de 65±10,4 anos e diagnóstico clínico de DPOC moderado, classificados de acordo com a espirometria prévia. Os voluntários foram divididos em grupo treino esteira (GTE e grupo treino muscular respiratório (GTMR. Realizaram o teste de caminhada de seis minutos (TC6', teste de caminhada com carga progressiva (TCP, avaliação nutricional do índice de massa corpórea (IMC, dose diária recomendada de L-carnitina, pressões inspiratórias (PImáx e expiratórias máximas (PEmáx. Fizeram 30 min de caminhada em esteira, 3 vezes/semana por 10 semanas, e o GTMR realizou, ainda, 10 min de treinamento muscular inspiratório (Threshold® IMT e 10 min de treinamento muscular expiratório (Threshold® PEP à 50% da PImáx e PEmáx ajustados semanalmente. Após 10 semanas, foram reavaliados. No TC6' pré e pós-programa de treinamento físico, as variáveis alteradas foram: distância percorrida (DP, frequência cardíaca (FC final, pressão arterial sistólica (PAS final, pressão arterial diastólica (PAD final e Borg final no GTMR, no GTE as variáveis alteradas foram FC repouso, FC final, PAS final, Borg repouso e DP. Comparando os grupos no TC6, o GTE apresentou FC final, PAD final e Borg final maiores do que o GTMR na reavaliação; já no TCP, a FC final, PAS final, Borg final foram maiores no GTE, e DP foi maior no GTMR. Na avaliação respiratória, a PEmáx foi maior no GTMR na reavaliação. O treino aeróbio e suplementação de L-carnitina na DPOC otimizou a performance, a capacidade física e a tolerância ao esforço.To evaluate the effects of oral supplementation of L-carnitine associated with physical and respiratory muscles training in chronic obstructive pulmonary disease (COPD. Participated 14 COPD volunteers (65±10.4 years, divided

  16. Inhibition of B cell proliferation by antisense DNA to both alpha and beta forms of Fc epsilon R II.

    Science.gov (United States)

    Bhatti, L; Behle, K; Stevens, R H

    1992-10-01

    Epstein-Barr Virus (EBV) infection activates B lymphocyte proliferation through partially understood mechanisms, resulting in phenotypic changes, including the appearance of new antigens. One such antigen is Fc epsilon R II/CD-23 which may be relevant for B cell proliferation. We have used anti-sense oligonucleotides to study the importance of the two forms of this molecule for proliferation in the EBV-transformed, Fc epsilon R II +ve lymphoblastoid B cell line, RPMI 8866. Anti-sense oligodeoxynucleotides were generated to the two forms of Fc epsilon R II; Fc epsilon R IIa (alpha) and IIb (beta) which differ only in their intracytoplasmic domains. Addition of increasing concentrations of anti-sense oligonucleotides, ranging from 1 to 30 microM, significantly decreased cellular proliferation as measured by the incorporation of [3H]thymidine (inhibition range 8-88%). Optimum inhibition of cellular proliferation was apparent at 15 microM concentration of both anti-sense Fc epsilon R IIa and IIb (Fc epsilon R IIa, mean +/- SE = 75 +/- 7% inhibition, p less than 0.001; Fc epsilon R IIb, mean +/- SE = 71 +/- 7% inhibition, p less than 0.001). Anti-sense oligonucleotides complementary to the common part of Fc epsilon R II resulted in a similar inhibition of proliferation. Sense oligonucleotides did not induce significant inhibition. Preincubation of sense and anti-sense oligonucleotides resulted in an abrogation of proliferation inhibition. Moreover, none of these oligonucleotides had any effect on a Fc epsilon R II -ve cell line. Incubation with both anti-sense IIa and IIb resulted in additive, but not synergistic inhibition of proliferation. Addition of soluble Fc epsilon R II did not reverse inhibition of proliferation, suggesting that membrane-bound or intracellular rather than soluble Fc epsilon R II was important for the induced proliferation. Analysis of cell surface expression for Fc epsilon II indicated that while there was a pronounced effect on cell number

  17. A study of phase transformations processes in 0,5 to 4% mo uranium-molybdenum alloys; Etude des processus des transformations dans les alliages uranium-molybdene de teneur 0,5 a 4% en poids de molybdene

    Energy Technology Data Exchange (ETDEWEB)

    Lehmann, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1959-06-15

    Isothermal and continuous cooling transformations process have been established on uranium-molybdenum alloys containing 0,5 to 4 w% Mo. Transformations process of the {beta} and {gamma} solid solutions are described. These processes depend upon molybdenum concentration. Out of the {beta} solid solution phase appears an eutectoid decomposition of {beta} to ({alpha} + {gamma}) or the formation of a martensitic phase {alpha}''. The {gamma} solid solution shows a decomposition of {gamma} to ({alpha} + {gamma}) or ({alpha} + {gamma}'), or a formation of martensitic phases a' or a'{sub b}. The U-Mo equilibrium diagram is discussed, particularly in low concentrations zones. Limits between domains ({alpha} + {gamma}) and ({beta} + {gamma}), ({beta} + {gamma}) and {gamma}, ({beta} + {gamma}) and {beta}, have been determined. (author) [French] Les processus des transformations isothermes, et au cours de refroidissements continus ont ete etablis sur les alliages uranium-molybdene de 0,5 a 4 % en poids de Mo. Ceci a permis de mettre en evidence les processus des transformations de solutions solides {beta} et {gamma}, differents suivant la teneur en molybdene de l'alliage. Dans le premier cas il y a decomposition eutectoide de {beta} en ({alpha} + {gamma}) ou formations d'une phase martensitique {alpha}''. Dans le second cas il y a decomposition de {gamma} soit en ({alpha} + {gamma}) soit en ({alpha} + {gamma}') suivant la temperature, ou bien formation des phases martensitiques {alpha}' ou {alpha}'{sub b}. Le diagramme d'equilibre, uranium-molybdene est sujet a de nombreuses controverses, en particulier dans la zone des faibles concentrations. Les limites entre les domaines ({alpha} + {gamma}) et ({beta} + {gamma}), ({beta} + {gamma}) et {gamma}, ({beta} + {gamma}) et {beta}, ont ete determinees. (auteur)

  18. Endothelial Fcγ Receptor IIB Activation Blunts Insulin Delivery to Skeletal Muscle to Cause Insulin Resistance in Mice

    Science.gov (United States)

    Tanigaki, Keiji; Chambliss, Ken L.; Yuhanna, Ivan S.; Sacharidou, Anastasia; Ahmed, Mohamed; Atochin, Dmitriy N.; Huang, Paul L.

    2016-01-01

    Modest elevations in C-reactive protein (CRP) are associated with type 2 diabetes. We previously revealed in mice that increased CRP causes insulin resistance and mice globally deficient in the CRP receptor Fcγ receptor IIB (FcγRIIB) were protected from the disorder. FcγRIIB is expressed in numerous cell types including endothelium and B lymphocytes. Here we investigated how endothelial FcγRIIB influences glucose homeostasis, using mice with elevated CRP expressing or lacking endothelial FcγRIIB. Whereas increased CRP caused insulin resistance in mice expressing endothelial FcγRIIB, mice deficient in the endothelial receptor were protected. The insulin resistance with endothelial FcγRIIB activation was due to impaired skeletal muscle glucose uptake caused by attenuated insulin delivery, and it was associated with blunted endothelial nitric oxide synthase (eNOS) activation in skeletal muscle. In culture, CRP suppressed endothelial cell insulin transcytosis via FcγRIIB activation and eNOS antagonism. Furthermore, in knock-in mice harboring constitutively active eNOS, elevated CRP did not invoke insulin resistance. Collectively these findings reveal that by inhibiting eNOS, endothelial FcγRIIB activation by CRP blunts insulin delivery to skeletal muscle to cause insulin resistance. Thus, a series of mechanisms in endothelium that impairs insulin movement has been identified that may contribute to type 2 diabetes pathogenesis. PMID:27207525

  19. Hematopoietic properties of granulocyte colony-stimulating factor/immunoglobulin (G-CSF/IgG-Fc fusion proteins in normal and neutropenic rodents.

    Directory of Open Access Journals (Sweden)

    George N Cox

    Full Text Available Previously we showed that granulocyte colony-stimulating factor (G-CSF in vitro bioactivity is preserved when the protein is joined via a flexible 7 amino acid linker to an immunoglobulin-1 (IgG1-Fc domain and that the G-CSF/IgG1-Fc fusion protein possessed a longer circulating half-life and improved hematopoietic properties compared to G-CSF in normal rats. We have extended this analysis by comparing the relative hematopoietic potencies of G-CSF/IgG1-Fc to G-CSF in normal mice and to G-CSF and polyethylene glycol (PEG -modified G-CSF in neutropenic rats. Mice were treated for 5 days using different doses and dosing regimens of G-CSF/IgG1-Fc or G-CSF and circulating neutrophil levels in the animals measured on Day 6. G-CSF/IgG1-Fc stimulated greater increases in blood neutrophils than comparable doses of G-CSF when administered using daily, every other day or every third day dosing regimens. In rats made neutropenic with cyclophosphamide, G-CSF/IgG1-Fc accelerated recovery of blood neutrophils to normal levels (from Day 9 to Day 5 when administered as 5 daily injections or as a single injection on Day 1. By contrast, G-CSF accelerated neutrophil recovery when administered as 5 daily injections, but not when administered as a single injection. G-CSF/IgG1-Fc was as effective as PEG-G-CSF at accelerating neutrophil recovery following a single injection in neutropenic rats. G-CSF/IgG1-Fc and G-CSF/IgG4-Fc fusion proteins in which the 7 amino acid linker was deleted also were effective at accelerating neutrophil recovery following a single injection in neutropenic rats. These studies confirm the enhanced in vivo hematopoietic properties of G-CSF/IgG-Fc fusion proteins.

  20. Enhanced antibody-dependent cellular phagocytosis by chimeric monoclonal antibodies with tandemly repeated Fc domains.

    Science.gov (United States)

    Nagashima, Hiroaki; Ootsubo, Michiko; Fukazawa, Mizuki; Motoi, Sotaro; Konakahara, Shu; Masuho, Yasuhiko

    2011-04-01

    We previously reported that chimeric monoclonal antibodies (mAbs) with tandemly repeated Fc domains, which were developed by introducing tandem repeats of Fc domains downstream of 2 Fab domains, augmented binding avidities for all Fcγ receptors, resulting in enhanced antibody (Ab)-dependent cellular cytotoxicity. Here we investigated regarding Ab-dependent cellular phagocytosis (ADCP) mediated by these chimeric mAbs, which is considered one of the most important mechanisms that kills tumor cells, using two-color flow cytometric methods. ADCP mediated by T3-Ab, a chimeric mAb with 3 tandemly repeated Fc domains, was 5 times more potent than that by native anti-CD20 M-Ab (M-Ab hereafter). Furthermore, T3-Ab-mediated ADCP was resistant to competitive inhibition by intravenous Ig (IVIG), although M-Ab-mediated ADCP decreased in the presence of IVIG. An Fcγ receptor-blocking study demonstrated that T3-Ab mediated ADCP via both FcγRIA and FcγRIIA, whereas M-Ab mediated ADCP exclusively via FcγRIA. These results suggest that chimeric mAbs with tandemly repeated Fc domains enhance ADCP as well as ADCC, and that Fc multimerization may significantly enhance the efficacy of therapeutic Abs. Copyright © 2010 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  1. 46 CFR 159.010-15 - Contracting inspections and tests or transferrals to another laboratory or person.

    Science.gov (United States)

    2010-10-01

    ...— (1) A request in writing regarding the contract or transfer is submitted to the Commandant before the contract is executed or the transfer is completed; and (2) The Commandant notifies the laboratory in... SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF...

  2. Quality management and quality assurance contracts

    International Nuclear Information System (INIS)

    Teichler, M.

    1991-01-01

    Quality assurance contracts belong to the most important instruments of quality management systems. As a result of such contracts, quality control is to be done not only by the buyer, but is made a task to be fulfilled by the manufacturer. The author of the article shows that quality assurance contracts do change the contractual relationship between supplier and buyer, but have no effect on economic and practical conditions. This is so because quality assurance contracts apply only to warranty claims, which play a subordinate role in the legal relationship between producer and buyer, or producer and consumer, as compared to the claims for damages arising out of the contracts. (orig.) [de

  3. 17 CFR 8.05 - Enforcement staff.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Enforcement staff. 8.05... staff. (a) Each exchange shall establish an adequate enforcement staff which shall be authorized by the... staff shall consist of employees of the exchange and/or persons hired on a contract basis. It may not...

  4. Claims for Unabsorbed Overhead on Defense Contracts.

    Science.gov (United States)

    1985-09-01

    coat which, under the provisions of any pertinent law, regulation, or contract, cannot be included in prices, cost reimbureements , or settlements...ruled that the contractor was due some reimbursement . " - Allegheny appealed the contracting officer’s determination a second time questioning how much...amount of reimbursement . The final opinion also added the cost that was substantiated for replacement of operators and make-up pay. Therefore, the

  5. Evaluación económica de rituximab en combinación con fludarabina y ciclofosfamida en comparación con fludarabina y ciclofosfamida en el tratamiento de la leucemia linfática crónica Economic evaluation of rituximab added to fludarabine plus cyclophosphamide versus fludarabine plus cyclophosphamide for the treatment of chronic lymphocytic leukemia

    Directory of Open Access Journals (Sweden)

    Luis Felipe Casado

    2011-08-01

    Full Text Available Objetivos: Evaluar el coste-efectividad del esquema de rituximab, fludarabina y ciclofosfamida (R-FC en comparación con el de fludarabina y ciclofosfamida (FC en dos tipos de pacientes con leucemia linfática crónica (LLC: no tratados previamente o bien en recidiva/resistentes al tratamiento previo. Métodos: Dos modelos de Markov, utilizando los resultados publicados de superviviencia libre de progresión (SLP de pacientes con LLC tratados con R-FC o FC en primera o segunda línea, las tasas de progresión de la enfermedad y las tasas de mortalidad en España. A los estados de SLP y progresión se les asignaron utilidades obtenidas en un estudio sobre LLC. Los costes de los medicamentos y de los tratamientos de soporte, así como los años de vida ajustados por calidad (AVAC, se estimaron para un periodo de 10 años. Se efectuaron análisis de sensibilidad univariados y probabilísticos (Monte Carlo. Resultados: La adición de rituximab a la quimioterapia con FC aumentó los años de vida ganados (AVG y los AVAC tanto en primera como en segunda línea de tratamiento. La razón de coste-eficacia incremental fue de 20.703 € por AVG y de 19.343 € por AVAC con la primera línea de tratamiento, y de 23.183 € por AVG y 24.781 € por AVAC con la segunda línea de tratamiento. Conclusiones: En los pacientes con LLC no tratados previamente y en aquellos en recaída o resistentes al tratamiento previo, la adición de rituximab al esquema FC aumentó la esperanza de vida y los AVAC, y en ambos casos resultó ser un tratamiento coste-efectivo.Objectives: We evaluated the cost-effectiveness of rituximab added to the chemotherapy regimen of fludarabine plus cyclophosphamide (R-FC versus fludarabine plus cyclophosphamide (FC for the treatment of patients with previously untreated or relapsed/refractory chronic lymphocytic leukemia (CLL. Methods: Two Markov models were built, using published results on progression-free survival (PFS in patients

  6. Elementos de flexibilidade em contratos de terceirização logística: o caso de uma empresa de telecomunicações Flexibility elements in contracts of logistic outsourcing: the case of a telecommunications company

    Directory of Open Access Journals (Sweden)

    Renata Albergaria de Mello Bandeira

    2012-04-01

    Full Text Available O artigo analisa, através da técnica de estudo de caso, a terceirização logística em uma empresa de telecomunicações. Inicialmente, são discutidos os cuidados e a importância do contrato de terceirização, segundo abordagem da economia dos custos de transação. Analisam-se as possíveis causas das falhas na contratação, e sugerem-se providências para evitar repetições em implementações semelhantes. A experiência adquirida indica que um erro primordial, na opinião dos autores, refere-se à falta de definição da estratégia a ser seguida pela organização em relação ao modelo de contratação. Essa definição é uma etapa fundamental, já que o contrato deve estar alinhado à estratégia.This article examines, through the technique of case study, the process of logistics outsourcing in a Brazilian telecommunications company. Initially, the importance of contracts for outsourcing is analyzed according to the perspective of the transaction costs economics theory. The possible causes of imperfections in the contracting process are analyzed, and the steps to avoid the repetition of these mistakes in similar implementations are suggested. According to the authors' point of view, the acquired experience indicates that a primary error in outsourcing contracts refers to the lack of a strategy to be followed by the organization in relation to a contracting model. This definition is a fundamental step, since the contract must be aligned to the strategy.

  7. de Barranquilla (Colombia

    Directory of Open Access Journals (Sweden)

    Edgar Navarro Lechuga

    2005-01-01

    Full Text Available Objetivo: Determinar los factores asociados a consumo de cigarrillo en adultos del suroccidente de Barranquilla. Métodos: Estudio analítico (145 casos y 290 controles. Personas identificadas de la base de datos del estudio de «Enfermedades crónicas no transmisibles del suroccidente de Barranquilla». La tabulación se realizó en epiinfo 6.04, con salidas a Microsoft Word y Microsoft Excel. Resultados: 44.1% de los fumadores comenzaron a hacerlo por curiosidad. El promedio de edad de inicio fue de 17.1 años. El promedio de cigarrillos fumados por día fue de 6. Se encontró asociación entre fumar y ser hombre (OR 2.39; IC95%: 1.56 – 3.69, bajo nivel de escolaridad (OR 1.93; IC95%: 1.26 – 2.97, estar laborando (OR 2.17; IC95%: 1.41 – 3.35, tener miembros en la familia fumadores (OR: 2.7, IC95%: 1.4 – 5.3, influencia de los medios de comunicación (OR: 0.91; IC95%: 2.97 – 12.48, no pertenecer a una religión (OR: 1.62, IC95%: 1.06 – 2.49, consumir café con frecuencia (OR: 2.05, IC95%: 1.28 – 3.29, consumir alcohol (OR: 2.7, IC95%: 1.22 – 6.19 y tener disfuncionalidad familiar (OR: 2.3, IC95%: 1.17 – 4.5. Conclusiones: Los fumadores están expuestos a variables sociodemográficas, inherentes a su ser, y del medio ambiente. Es necesario intervenir sobre los factores de riesgo modificables para disminuir el consumo de cigarrillo.

  8. 48 CFR 970.3102-05 - Selected costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Selected costs. 970.3102... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05 Selected costs. ...

  9. La Asimilación de la Culpa al dolo Desde una Perspectiva Objetiva del Derecho de los Contratos: segunda parte

    Directory of Open Access Journals (Sweden)

    Rodrigo Barcia L

    2007-01-01

    Full Text Available Este artículo desarrolla las secciones segunda y tercera, que son la continuación de un trabajo que lleva el mismo nombre y ha sido publicado en el número anterior de esta revista. La sección segunda revisa la asimilación de la culpa grave al dolo, en la responsabilidad contractual, principalmente en los siguientes supuestos: a Los contratos que benefician exclusivamente al acreedor. En ellos se sostiene la asimilación opera incluso en materia de prueba. b Los contratos que benefician exclusivamente al deudor o a ambas partes. En ellos para que opere la asimilación debe probarse la culpa grave. c Los casos en que se incumpla una obligación, producto de un engaño provocado, se asimilan al incumplimiento doloso, produciéndose un supuesto de incumplimiento doloso por conducta generadora de culpa grave. En la tercera sección se plantean las conclusiones finales de este trabajo, que recurren a una concepción objetiva del Derecho de los contratos que rehuye el fuero interno de las partes contratantes (teoría clásica o subjetiva del contrato.This article develops the second and third sections which are in fact from the work that carries the same name and has been published in the previous number of this magazine. The second section reviews the assimilation of the serious fault to intention or gross negligence in the contractual responsibility mainly on the following proposals: a The contracts that exclusively benefits the creditor. In them it is sustained that the assimilation operates including in the matter of proof. b The contracts that exclusively benefits the debtor or both parties. In this case for the assimilation to operate the serious fault must be proved. c In cases where obligation are unfulfilled due to a provoked cheating the intentional incompletion is assimilated producing a possible case of fraud incompletion of gross negligence by generating conduct of serious fault. In the third section of this work final conclusions are

  10. ESTUDIO COMPARATIVO DE LA REMOCIÓN DE MATERIA ORGÁNICA EN HUMEDALES CONSTRUIDOS DE FLUJO HORIZONTAL SUBSUPERFICIAL USANDO TRES ESPECIES DE MACRÓFITAS ESTUDO COMPARATIVO DA REMOÇÃO DE MATÉRIA ORGÂNICA EM BANHADOS CONSTRUÍDOS DE FLUXO HORIZONTAL SUBSUPERFICIAL USANDO TRES ESPÉCIES DE MACRÓFITAS COMPARATIVE STUDY OF THE ORGANIC MATTER REMOVAL IN HORIZONTAL SUBSURFACE FLOW CONSTRUCTED WETLANDS USING THREE SPECIES OF MACROPHYTES

    Directory of Open Access Journals (Sweden)

    JORGE IGNACIO MONTOYA

    2010-12-01

    Full Text Available Los humedales construidos se presentan actualmente como una tecnología prometedora en reducir la contaminación por aguas residuales; este estudio investigó la remoción de materia orgánica con agua residual sintética, en términos de demanda química de oxígeno (DQO, demanda biológica de oxígeno (DBO5 y mediciones in situ de pH, oxígeno y temperatura cada 15 días, durante 3 meses, en seis sistemas de humedales construidos de flujo subsuperficial horizontal, a escala piloto, sembrados con tres diferentes macrófitas: Canna limbata, Heliconia psittacorum y Phragmites sp; las remociones medias de DQO fueron de 97,31 % y 95,94 % para Canna limbata; 94,49 % y 93,50 % para Heliconia psittacorum; 97,39 % y 97,13 % para Phragmites sp. En DBO5 fueron de 100 % y 99,36 % para Canna limbata; 99,09 % y 97,49 % para Heliconia psittacorum; 100 % y 99,45 % para Phragmites sp. Se concluye que existen diferencias significativas para la remoción de DQO entre las diferentes plantas (P Os banhados construídos são agora uma tecnologia promissora para reduzir a poluição por esgotos; este estudo investigou a remoção de matéria orgânica com esgoto sintético, em termos de demanda química de oxigênio (DQO, demanda biológica de oxigênio (DBO5 e medições in situ de pH, oxigênio e temperatura a cada 15 dias durante 3 meses, em seis sistemas de banhados construídos de fluxo sub-superficial horizontal, em escala piloto plantados com três diferentes macrófitas: Canna limbata, Heliconia psittacorum e Phragmites sp; as remoçães médias de DQO média foram 97,31 % e 95,94 % para Canna limbata, 94,49 % e 93,50 % para Heliconia psittacorum; 97,39 % e 97,13 % para Phragmites sp. Em DBO5 foram de 100 % e 99,36 % para Canna limbata, 99,09 % e 97,49 % para Heliconia psittacorum; 100 % e 99,45 % para Phragmites sp. Conclui-se que existem diferenças significativas para a remoção de DQO entre plantas diferentes (P Constructed wetlands appear at the

  11. A intersubjetividade no contexto da família de pessoas com fibrose cística

    Directory of Open Access Journals (Sweden)

    Geisa Santos Luz

    2012-04-01

    Full Text Available Trata-se de uma investigação qualitativa, com aproximação fenomenológica, que objetivou desvelar os processos intersubjetivos no contexto da família de pessoas com Fibrose Cística (FC. Desenvolveu-se entrevista com 14 famílias com portadores de FC, cadastrados na Associação Paranaense de Assistência à Mucoviscidose (AAMPR, residentes nas regiões Norte e Noroeste do estado do Paraná (PR, Brasil. Das suas falas foram apreendidas unidades de significado, agrupadas em três categorias: Família, portador de FC e o outro; Aspectos religiosos na vivência da FC na família; Portador de FC na vida escolar, afetiva e profissional. Os resultados evidenciaram que a experiência das famílias compartilhada com o outro foi crucial para o enfrentamento da doença. Conhecer os processos intersubjetivos que perpassam o âmago da família de pessoas acometidas pela FC possibilita um novo modo de atuar em Enfermagem.

  12. Avaliação da remoção de cromo (III por materiais compósitos porosos adsorventes de PE-g-MA, fibra de coco e quitosana, usando planejamento experimental

    Directory of Open Access Journals (Sweden)

    Dilma Alves Costa

    2017-04-01

    Full Text Available RESUMO Os processos de adsorção podem ser empregados no tratamento de efluentes líquidos contendo metais pesados visando a reduzir os danos ambientais. Porém, o alto custo dos materiais adsorventes justifica a aplicação de adsorventes alternativos, como a fibra de coco (FC e a quitosana (Q. Assim, este trabalho teve como objetivo desenvolver compósitos porosos adsorventes a partir da mistura de polietileno graftizado com anidrido maleico/FC/Q/NaCl, como agente porogênico (PE-g-MA/FC/Q/NaCl, e avaliar estatisticamente a capacidade de adsorção do cromo (III em solução, com auxílio do software Statistica 5.0®. Os resultados mostraram que a eficiência do processo sofreu influência das dimensões da FC, do teor de Q e do pH da solução contendo Cr (III. A capacidade máxima de remoção de Cr (III por unidade de massa do compósito foi de 42,28 mg.g-1.

  13. Bupivacaína levógira a 0,5% pura versus mistura enantiomérica de bupivacaína (S75-R25 a 0,5% em anestesia peridural para cirurgia de varizes Bupivacaína levógira a 0,5% pura versus mezcla enantiomerica bupivacaína (S75-R25 a 0,5% en anestesia peridural para cirugía de várices Plain 0.5% levogyrous bupivacaine versus 0.5% bupivacaine enantiomeric mixture (S75-R25 in epidural anesthesia for varicose vein surgery

    Directory of Open Access Journals (Sweden)

    José Delfino

    2001-12-01

    inferiores. La casuística, entretanto, no es aún suficiente para permitir conclusiones definitivas.BACKGROUND AND OBJECTIVES: The cardiotoxic effect of racemic bupivacaine (50:50 is still the major safety-related variable for regional blocks requiring higher concentrations and volumes. Recent animal studies suggested that the manipulation of racemic bupivacaine enantiomers could contribute for a better therapeutic efficacy by decreasing its potential toxicity. This study aimed at evaluating the efficacy of 0.5% bupivacaine enantiomeric mixture (S75-R25 as compared to plain S(-100% bupivacaine in lumbar epidural anesthesia for varicose vein surgery. METHODS: Participated in this randomized double-blind study 30 female patients aged 15 to 65 years, physical status ASA I or II scheduled for elective lower limb varicose vein surgery, who were allocated into two groups: S75-R25 Group - 20 ml (100 mg of 0.5% (S75-R25 bupivacaine; and Levogyrous Group - 20 ml (100 mg of 0.5% plain S(-100 bupivacaine without adjuvants. Characteristics of sensory and motor block as well as the incidence of side effects were investigated. RESULTS: Significant demographic differences and a longer surgical time were found in the S75-R25 Group. Faster spread and lower analgesic effects of the isomeric mixture were statistically significant. Motor block was significantly deeper in the S75-R25 Group. Side effects were negligible for both groups. CONCLUSIONS: Fewer side effects, good patients acceptance and the lack of post-operative transient neurological symptoms point towards the safety of both solutions in lumbar epidural anesthesia for elective varicose vein surgery. The sample, however, is still small for final conclusions.

  14. 40 CFR Table 25 to Subpart G of... - Effective Column Diameter (Fc)

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Effective Column Diameter (Fc) 25 Table..., Table 25 Table 25 to Subpart G of Part 63—Effective Column Diameter (Fc) Column type Fc (feet) 9-inch by 7-inch built-up columns 1.1 8-inch-diameter pipe columns 0.7 No construction details known 1.0 ...

  15. Comparação entre desempenhos de corrida time trial realizados em pista e esteira

    Directory of Open Access Journals (Sweden)

    Cecília Segabinazi Peserico

    2014-05-01

    Poucos estudos verificaram a influência do ambiente de teste (campo e laboratório sobre o ritmo de corrida e variáveis fisiológicas obtidas durante o desempenho em corrida de endurance. Portanto, o objetivo deste estudo foi comparar o comportamento da velocidade média (VM, ritmo de corrida, frequência cardíaca (FC e percepção subjetiva de esforço (PSE obtidas durante os desempenhos de corrida em provas time trial de uma hora realizados em pista de atletismo e em esteira. Dezoito homens corredores recreacionais (25,4 ± 3,3 anos realizaram duas performances de uma hora de corrida: uma em esteira e outra em pista de atletismo de 400 m. A PSE e a FC foram registradas a cada 10 minutos, e a VM a cada 15 minutos para a determinação do ritmo de corrida. As variáveis relacionadas aos desempenhos foram comparadas pelo teste t de Student para amostras pareadas. Os valores de VM, FC e PSE obtidos durante diferentes momentos das provas foram comparados pela Anova de dois fatores para medidas repetidas seguido do post hoc de Bonferroni. Para todas as análises, foi adotado nível de significância de P< 0,05. A VM da prova realizada em pista (12,2 ± 0,8 km·h-1 foi superior à prova em esteira (11,8 ± 0,8 km·h-1. Além disso, foram encontradas diferenças entre os dois desempenhos para os valores de frequência cardíaca média e máxima, e para o ritmo de corrida. A partir dessas diferenças, conclui-se que os desempenhos foram influenciados pelo ambiente onde as provas de uma hora foram realizadas.

  16. 48 CFR 32.605 - Final decisions.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS CONTRACT FINANCING Contract Debts 32.605 Final decisions. (a) The contracting officer shall issue a final decision as required by 33.211 if— (1) The contracting officer and the contractor are unable... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Final decisions. 32.605...

  17. Demonstration, testing, & evaluation of in situ heating of soil. Draft final report, Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-02-12

    This document is a draft final report (Volume 1) for US DOE contract entitled, {open_quotes}Demonstration Testing and Evaluation of In Situ Soil Heating,{close_quotes} Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report and Volume II contains appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120{degrees} to 130{degrees}C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow.

  18. 7 CFR 97.104 - Application or certificate abandoned.

    Science.gov (United States)

    2010-01-01

    ... 97.104 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY... abandoned certificates shall be published in the Official Journal, indicating that the variety has become...

  19. Mycoplasma infection of cell lines can simulate the expression of Fc receptors by binding of the carbohydrate moiety of antibodies.

    Science.gov (United States)

    Lemke, H; Krausse, R; Lorenzen, J; Havsteen, B

    1985-05-01

    During the production of Fc receptor (FcR)-bearing hybridomas it was observed with a particular monoclonal anti-sheep red blood cell antibody (anti-SRBC 1/5, IgG1) that the contamination with Mycoplasma arginini of in vitro cultured cell lines leads to an apparent FcR activity. This property did not correspond with the serological typing since other antibodies of the same isotype could not support FcR rosette formation. Another mycoplasma strain M. orale lacked this property. Analysis of the binding reaction revealed that M. arginini contains a lectin which binds the carbohydrate moiety of the anti-SRBC 1/5 antibody, i.e. anti-SRBC 1/5 synthesized under the influence of tunicamycin or deglycosylated by NaIO4 oxidation did not support rosette formation. These data suggest that binding of antibodies to certain mycoplasma strains may be a pathogenic factor during mycoplasma infections by masking the microorganisms with the host's own defense molecules. The experiments with M. arginini-infected cell lines gain immunological importance since we obtained identical results with staphylococcal protein A, as another bacteriological FcR, and cell lines expressing intrinsic membrane FcR. Although it is an open question whether the glycoconjugates are directly bound by the FcR or else by influencing the three-dimensional structure of the antibodies, it seems possible that FcR in general may be lectins.

  20. A strategy for bacterial production of a soluble functional human neonatal Fc receptor

    DEFF Research Database (Denmark)

    Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril

    2008-01-01

    The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus...

  1. Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte - DOI: 10.4025/actascianimsci.v29i2.217 Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations - DOI: 10.4025/actascianimsci.v29i2.217

    Directory of Open Access Journals (Sweden)

    Jorge Vitor Ludke

    2007-11-01

    Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up

  2. Evaluation of covering materials in individual shelters and its effects on physiological responses and performance of dairy calves Avaliação de materiais de cobertura em abrigos individuais sobre respostas fisiológicas e desempenho de bezerros leiteiros

    Directory of Open Access Journals (Sweden)

    Patrícia C. de F Fonseca

    2012-12-01

    Full Text Available In Tropical regions, the animal performance is often affected by climate conditions. This study aimed to evaluate covering materials in individual shelters, normally used to house dairy calves, and its influence on the calves physiology and performance. The design used was completely randomized, with a 2x3 factorial arrangement to compare the averages of 5% through the Tukey's test, i.e., both genders- and three types of covering in the shelters (Z - zinc; AC - asbestos cement; and WPAC - white-painted asbestos cement. Parameters evaluated included daily weight gain (DWG, dry matter intake (DMI, feed conversion (FC, rectal temperature (RT, and respiratory frequency (RF. Results showed significant differences (P 0.05 in the FC and the RT, and there were significant differences (P Nos trópicos, o desempenho animal é prejudicado pela ação do clima. Objetivou-se neste trabalho avaliar materiais de cobertura em abrigos individuais sobre a fisiologia e o desempenho de bezerros leiteiros. Utilizou-se o delineamento inteiramente casualizado, fatorial 2 X 3, para a comparação das médias ao nível de 5%, pelo teste de Tukey, ou seja, dois sexos e três tipos de coberturas (Z - zinco; CA - cimento-amianto e CAB - cimento-amianto pintado de branco. Foram medidos o ganho de peso diário (GPD, o consumo alimentar (CMS, a conversão alimentar (CA, a temperatura retal (TR e a frequência respiratória (FR. Os resultados mostraram que houve diferença significativa (P 0,05 para CA e TR e observou-se diferença significativa (P < 0,05 para FR nos tratamentos Z (56,9 mov.min-1, CAB (62,2 mov.min-1 e CA (70,25 mov.min-1. Conclui-se que os diferentes tipos de coberturas não influenciaram no desempenho e no consumo alimentar, mas interferiram na fisiologia de termorregulação dos animais.

  3. Contract types - turnkey

    International Nuclear Information System (INIS)

    Loeffler, G.

    1975-01-01

    Turnkey or the turnkey type of contract refers to a system of management according to which one organization accepts total responsibility for completing all parts and all phases of a project. In the case of a power project the turnkey contractor undertakes to design the plant, supply or procure and erect the equipment, build the station and put it into operation. (orig./FW) [de

  4. Cleavage of the interchain disulfide bonds in rituximab increases its affinity for FcγRIIIA.

    Science.gov (United States)

    Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Kobayashi, Eiji; Fukuchi, Kaori; Tsukimoto, Mitsutoshi; Kojima, Shuji; Kohroki, Junya; Akimoto, Kazunori; Masuho, Yasuhiko

    2013-07-05

    The Fc region of human IgG1 mediates effector function via binding to Fcγ receptors and complement activation. The H and L chains of IgG1 antibodies are joined by four interchain disulfide bonds. In this study, these bonds within the therapeutic IgG1 rituximab (RTX) were cleaved either by mild reduction followed by alkylation or by mild S-sulfonation; consequently, two modified RTXs - A-RTX (alkylated) and S-RTX (S-sulfonated) - were formed, and both were almost as potent as unmodified RTX when binding CD20 antigen. Unexpectedly, each modified RTX had a higher binding affinity for FcγRIIIA (CD16A) than did unmodified RTX. However, S-RTX and A-RTX were each less potent than RTX in an assay of antibody-dependent cellular cytotoxicity (ADCC). In this ADCC assay, each modified RTX showed decreased secretion of granzyme B, but no change in perforin secretion, from effector cells. These results provide significant information on the structures within IgG1 that are involved in binding FcγRIIIA, and they may be useful in the development of therapeutic antagonists for FcγRIIIA. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Efecto de la torta de Sacha Inchi (Plukenetia volubilis sobre el desempeño productivo de juveniles de tilapia roja (Oreochromis sp.

    Directory of Open Access Journals (Sweden)

    Ricardo Alejandro Miranda-Gelvez

    2015-07-01

    Full Text Available Background: The cultivation of Sacha Inchi (P. volubilis has been developed in the Peruvian Amazon and in Colombia is grown mainly in the Department of Putumayo. There are proposals nowadays for implementation of this crop in the Catatumbo region (Norte de Santander. Objective: This study assessed the effect of Sacha Inchi cake (SIC (Plukenetia volubilis inclusion as a source of protein in diets for juveniles of red tilapia (Oreochromis sp. Methodology: four experimental diets including SIC as a partial substitute of fishmeal were prepared in the following percentages: 0%, 5%, 10% and 20%. 144 juvenile tilapia with initial weight of 5.8 ± 0.9 g were used, being fed with eight daily rations during 55 days to assess: weight gain (WG, feed conversion (FC, specific growth rate (SGR, protein efficiency ratio (PER, hepatosomatic index (HI and survival rate (%S. Results: The results showed no significant differences (p> 0.05 in any of the diets for FC and %S. However, the parameters: WG, SGR, PER and HI had significantly higher values for inclusions of 0,5 and 10%, being statistically different (p <0.01 from the 20% inclusion level. Conclusion: It is concluded that P. volubilis can replace fish meal up to a 10% level of inclusion.

  6. ENFORCEMENT OF MORTGAGE CONTRACT

    Directory of Open Access Journals (Sweden)

    Alisa A. BELU

    2016-07-01

    Full Text Available A chattel mortgage contract is the expression of a real guarantee that gives the creditor precedence over other creditors, in addition to the general pledge upon the belongings of the debtor. It refers to the sale of mortgaged movable assets, exclusively or prioritized in favor of the mortgaging creditor, in case the debtor does not comply with his / her commitments, under the signed mortgage contract. Beginning from this purpose, shared by both sides (as the chattel mortgage contract is synallagmatic, in case the debtor is unable to fulfill his / her commitments, the sides reach a situation of enforcement of the signed chattel mortgage contract. Given the legal status of the chattel mortgage contract [Art. 2387-2477 Noul Cod Civil , Universul Juridic, Bucureşti, 2016, ISBN 978-606-673-792-0], the principle of binding force of the contract and the principle according to which signed legal conventions will entail legal effects, the Romanian law maker developed the proper legal framework for the enforcement of the chattel mortgage contract. [art. 622 si urm. Noul Cod de Procedură Civilă, ed. Hamangiu, Bucureşti, 2016, ISBN 978-606-27-0459-9].

  7. Supervisory control system based on PC applied to substations automatization of and to regional operation centers of distribution networks; Sistema de control supervisorio basado en PC aplicado en automatizacion de subestaciones y centros de operacion regional de redes de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Picasso B, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Astorga Q, Clemente [Luz y Fuerza del Centro (Mexico)

    2003-07-01

    In order to increase the services quality in the electrical energy, to improve the process of identification of energy losses, to increase the equipment efficiency, to count on more complete statistics of profiles of load consumptions, among other applications, the Compania de Luz y Fuerza del Centro (LyFC) carries out the modernization in automatization of substations and regional operation centers of distribution networks. The technological base to make these programs requires automating the operative schemes of the substation and distribution centers that supervise the events of the electrical process. In this article the main results of the development and integration of master stations based on PC, that were made in the Instituto de Investigaciones Electricas (IIE) and that have been integrated in the electrical company LyFC are presented. [Spanish] Con el proposito de incrementar la calidad de los servicios en la energia electrica, mejorar el proceso de identificacion de perdidas de energia, aumentar la eficiencia de los equipos, contar con estadisticas mas completas de perfiles de consumos de carga, entre otras aplicaciones, la Compania de Luz y Fuerza del Centro (LyFC) lleva a cabo la modernizacion en automatizacion de subestaciones y centros de operacion regional de redes electricas de distribucion. La base tecnologica para realizar estos programas, requiere de automatizar los esquemas operativos de la subestacion y centros de distribucion que supervisan los eventos del proceso electrico. En este articulo se presentan los principales resultados del desarrollo e integracion de estaciones maestras basadas en PC, que se realizaron en el Instituto de Investigaciones Electricas (IIE) y que se han integrado en la compania electrica LyFC.

  8. Effect of sintering condition on the microstructure and electrical properties of lead-free (Na0.5K0.5NbO3 - Bi0.5(Na0.83K0.170.5TiO3 ceramics

    Directory of Open Access Journals (Sweden)

    Wang Chun Huy

    2017-01-01

    Full Text Available In this work, the piezoelectric ceramic system of the (1-x(Na0.5K0.5NbO3 - xBi(Na0.83K0.17TiO3 with composition close to the morphotropic phase boundary is studied. (Na0.5K0.5NbO3 with 0∼5 mole% Bi(Na0.83K0.17TiO3 has been prepared following the conventional mixed oxide process. The effect of sintering time on the properties of 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics is discussed. For 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.46 and 155 p/CN, respectively, at the sintering of 1100 °C for 3 h. Dielectric and piezoelectric properties have maximum values at the sintering temperature of 1100 °C for 5 h. For 0.97(Na0.5K0.5NbO3 -0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.56 and 190, respectively, at the sintering of 1100 °C for 5 h. The effect of prolonging the sintering time to the 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 system is a helpful method on ceramic processing to improve densification and properties.

  9. Concepts of the First Law of thennodynamics and Energy as methods of analysis of the final use of energy Los conceptos de la primera ley de la termodinámica y de exergia como métodos de análisis del uso final de la energía

    Directory of Open Access Journals (Sweden)

    Hernández A. Luis Alfredo

    1993-12-01

    Full Text Available Analysis of final use of energy based upon thermodinamic first law and exergy actually are considered as two complementary and necessary methods for energetic yield diagnostic of tasks and specific processes for production activities and/or welfare in the economic sectors of the country. As an application result, it could conduce to energy savings of losses to the enviroment and a better energy agreement between source-technology-final use.En la actualidad el análisis del uso final de la energía con base en la primera ley de la termodinámica y de la exergía, se presentan como dos métodos complementarios y necesarios para el diagnóstico del rendimiento energético de tareas y procesos específicos realizados en actividades de produción y/o bienestar en los sectores de la economía de país. Como
    resultado de su aplicación se podría conducir a grandes ahorros de energía mediante reducción de pérdidas al ambiente y una mejor concordancia energética en la triada fuente-tecnología-uso final.

  10. Una aplicación de opciones reales a la valoración de contratos de leasing An application of real options to the assessment of leasing contracts

    Directory of Open Access Journals (Sweden)

    Mónica Andrea Arango Arango

    2009-07-01

    Full Text Available Este artículo es el resultado de una investigación que desarrolla un modelo para la determinación del canon de arrendamiento en un contrato de leasing sobre vehículos, incluyendo la valoración de la opción de compra implícita en éste. Para realizar esta valoración se utilizaron como base los modelos propuestos por Giaccotto et al. [1] y Gamba y Rigon [2] (en tres marcas de vehículos en Colombia para el período comprendido entre Enero de 2004 y Diciembre de 2007. Se identificó el proceso ARMA de las series de los retornos de los precios de los vehículos. Se realizaron pruebas para identificar posibles efectos ARCH en las series de los retornos de los precios de los vehículos analizados. La estimación del valor de la opción de compra del vehículo al finalizar el contrato de leasing se realiza mediante la implementación del modelo de black-scholes y de simulación Monte Carlo.This article is the result of a research that develops a model related to the determination of the rent on a leasing vehicle contract and the valuation of the call option that gives the lessee the right but not the obligation to buy the used car at the end of the contract at a specified price. We used models proposed by [1] and by [2] in three brands of vehicles in Colombia for the period between January of 2004 and December of 2007. The analysis of the time series of returns of the prices vehicles displayed an ARMA process. We also developed further tests to identify possible ARCH effects in the series of returns of prices of the vehicles analyzed. The estimation of the value of the option to purchase the vehicle at the end of the leasing contract is done by the implementation of the model of Black Scholes and Montecarlo Simulation.

  11. Live visualization of genomic loci with BiFC-TALE.

    Science.gov (United States)

    Hu, Huan; Zhang, Hongmin; Wang, Sheng; Ding, Miao; An, Hui; Hou, Yingping; Yang, Xiaojing; Wei, Wensheng; Sun, Yujie; Tang, Chao

    2017-01-11

    Tracking the dynamics of genomic loci is important for understanding the mechanisms of fundamental intracellular processes. However, fluorescent labeling and imaging of such loci in live cells have been challenging. One of the major reasons is the low signal-to-background ratio (SBR) of images mainly caused by the background fluorescence from diffuse full-length fluorescent proteins (FPs) in the living nucleus, hampering the application of live cell genomic labeling methods. Here, combining bimolecular fluorescence complementation (BiFC) and transcription activator-like effector (TALE) technologies, we developed a novel method for labeling genomic loci (BiFC-TALE), which largely reduces the background fluorescence level. Using BiFC-TALE, we demonstrated a significantly improved SBR by imaging telomeres and centromeres in living cells in comparison with the methods using full-length FP.

  12. Estudio de la carga interna en pádel amateur mediante la frecuencia cardíaca

    Directory of Open Access Journals (Sweden)

    Jesús Díaz García

    2017-03-01

    Full Text Available Los objetivos de este estudio fueron evaluar el nivel de condición física de 8 sujetos amateur de pádel, definir su perfil energético de esfuerzo en juego real mediante registro de frecuencia cardíaca (FC, y proponer un conjunto de variables justificadas de esta, que permita analizar el perfil de carga interna en pádel. Mediante prueba de esfuerzo incremental máxima en cinta de correr se obtuvieron parámetros ergoespirométricos, respiratorios y sus equivalentes cardíacos, introducidos en el sistema de registro de la FC Polar Team. Los sujetos disputaron 7 partidos de entrenamiento de 1 hora de duración y 72-96 horas de separación entre ellos, obteniéndose como variables: consumo máximo de oxígeno (VO2 máx y porcentaje (% de VO2 máx en el umbral anaeróbico; en prueba de esfuerzo, FC máx., media y mín., y zonas de trabajo metabólicas (rangos de FC. Los resultados presentan VO2 máx de 51,15 ± 5,73 ml · kg–1 · min–1, FC máx. durante el juego de 154,75 ± 7,25 ppm, FC med de 130,0 ± 10,4 ppm para tiempo de juego y 89,75 % del tiempo de juego en zona de trabajo aeróbica. Como conclusión, el esfuerzo al que son sometidos durante el juego a nivel cardiorrespiratorio los jugadores amateur de pádel se basa casi exclusivamente en metabolismos aeróbicos. Además, las variables máx., mín. y media de FC para tiempos de juego y descanso y el establecimiento de zonas de trabajo de FC pueden aportarnos información importante sobre lo que ocurre en el juego a nivel cardiorrespiratorio.

  13. PRODUCCIÓN DE BIOMASA Y EXOPOLISACÁRIDOS DE Grifóla frondosa BAJO CULTIVO SUMERGIDO UTILIZANDO FUENTES DE CARBONO NO CONVENCIONALES

    OpenAIRE

    Zapata, Paula; Rojas, Diego; Fernández, Carlos; Ramírez, David; Restrepo, Gloria; Orjuela, Viviana; Arroyave, Marcela; Gómez, Tatiana; Atehortüa, Lucía

    2007-01-01

    Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3) con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC) en la producción de biomasa y exopolisacári-dos (EPS), bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7)) y medio (MB y MS). La máxima produ...

  14. Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.

    NARCIS (Netherlands)

    Kapur, R.; Della Valle, L.; Verhagen, O.J.; Hipgrave Ederveen, A.; Ligthart, P.; de Haas, M.; Kumpel, B.; Wuhrer, M.; van der Schoot, C.E.; Vidarsson, G.

    2015-01-01

    Background RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions

  15. Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D

    NARCIS (Netherlands)

    Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J. H. M.; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C. Ellen; Vidarsson, Gestur

    2015-01-01

    RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with

  16. Contracting for nuclear fuels

    International Nuclear Information System (INIS)

    Schuessler, C.M.

    1981-10-01

    This paper deals with uranium sales contracts, i.e. with contractual arrangements in the first steps of the fuel cycle, which cover uranium production and conversion. The various types of contract are described and, where appropriate, their underlying business philosophy and their main terms and conditions. Finally, the specific common features of such contracts are reviewed. (NEA) [fr

  17. Whither Performance Contracting?

    Science.gov (United States)

    Green, Norman S.

    This report describes briefly performance contracts; discusses their shortcomings, pitfalls, and advantages; and gives some insight into the future development of this new concept. Two shortcomings of performance contracting include (1) teaching to the test and (2) board abdication of its responsibility for making final decisions about educational…

  18. Review of SR 97 performance assessment

    International Nuclear Information System (INIS)

    Glynn, P.D.

    2000-01-01

    This review has identified many technical problems in the SR 97 performance assessment. The general impression of this reviewer is that SKB has been disingenuous in its performance assessment effort. It has not cited important differences of opinion with its own views. Furthermore, there are many inconsistencies in the SR 97 report that all together leave the impression that there are many more uncertainties in the SR 97 performance assessment than SKB would perhaps care to admit. Additionally, despite SKB's statements to the contrary, many of the analyses conducted for the SR 97 performance assessment can be clearly shown not to have been based on 'conservative' assumptions. Finally, SKB has made little effort to consider possible coupling effects between their different scenarios in SR 97. This is a serious flaw in the SR 97 performance assessment. The comments in this review should not be taken to imply that the KBS-3 nuclear waste disposal method will not be able to meet the safety and radiation protection requirements which SKI and SSI have specified in recent years. Instead, my conclusion is simply that the SR 97 performance assessment of the KBS-3 method would have been more believable had it been based on a forthright and comprehensive discussion of facts, uncertainties and opinions, and on a more conservative choice of assumptions. As it stands, the SR 97 performance assessment is not very credible

  19. Galilean contractions of W-algebras

    Directory of Open Access Journals (Sweden)

    Jørgen Rasmussen

    2017-09-01

    Full Text Available Infinite-dimensional Galilean conformal algebras can be constructed by contracting pairs of symmetry algebras in conformal field theory, such as W-algebras. Known examples include contractions of pairs of the Virasoro algebra, its N=1 superconformal extension, or the W3 algebra. Here, we introduce a contraction prescription of the corresponding operator-product algebras, or equivalently, a prescription for contracting tensor products of vertex algebras. With this, we work out the Galilean conformal algebras arising from contractions of N=2 and N=4 superconformal algebras as well as of the W-algebras W(2,4, W(2,6, W4, and W5. The latter results provide evidence for the existence of a whole new class of W-algebras which we call Galilean W-algebras. We also apply the contraction prescription to affine Lie algebras and find that the ensuing Galilean affine algebras admit a Sugawara construction. The corresponding central charge is level-independent and given by twice the dimension of the underlying finite-dimensional Lie algebra. Finally, applications of our results to the characterisation of structure constants in W-algebras are proposed.

  20. Long-term contracts and take-or-pay clauses in natural gas markets

    International Nuclear Information System (INIS)

    Creti, A.; Villeneuve, B.

    2004-01-01

    Theoretical and empirical research on long-term contracts inspired by the American experience are surveyed, with emphasis on the analysis of the role of take-or-pay clauses and price indexation rules, and whether regulation distorts optimal contract duration. The underlying motivation is to analyze the economic fundamentals of the European Union provisions on long-term contracts in the natural gas industry, and to highlight the features that differentiate them from the American experience. The impacts of long term contracts in the opening to competition of the European Union natural gas sector, and the apparent confusion between contract duration and flexibility as applied to long-term contracts in the European Union, are also explored. 29 refs., 2 tabs

  1. NRG1-Fc improves metabolic health via dual hepatic and central action.

    Science.gov (United States)

    Zhang, Peng; Kuang, Henry; He, Yanlin; Idiga, Sharon O; Li, Siming; Chen, Zhimin; Yang, Zhao; Cai, Xing; Zhang, Kezhong; Potthoff, Matthew J; Xu, Yong; Lin, Jiandie D

    2018-03-08

    Neuregulins (NRGs) are emerging as an important family of signaling ligands that regulate glucose and lipid homeostasis. NRG1 lowers blood glucose levels in obese mice, whereas the brown fat-enriched secreted factor NRG4 protects mice from high-fat diet-induced insulin resistance and hepatic steatosis. However, the therapeutic potential of NRGs remains elusive, given the poor plasma half-life of the native ligands. Here, we engineered a fusion protein using human NRG1 and the Fc domain of human IgG1 (NRG1-Fc) that exhibited extended half-life in circulation and improved potency in receptor signaling. We evaluated its efficacy in improving metabolic parameters and dissected the mechanisms of action. NRG1-Fc treatment triggered potent AKT activation in the liver, lowered blood glucose, improved insulin sensitivity, and suppressed food intake in obese mice. NRG1-Fc acted as a potent secretagogue for the metabolic hormone FGF21; however, the latter was largely dispensable for its metabolic effects. NRG1-Fc directly targeted the hypothalamic POMC neurons to promote membrane depolarization and increase firing rate. Together, NRG1-Fc exhibits improved pharmacokinetic properties and exerts metabolic benefits through dual inhibition of hepatic gluconeogenesis and caloric intake.

  2. Demonstration, testing, ampersand evaluation of in situ heating of soil. Draft final report, Volume I

    International Nuclear Information System (INIS)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-01-01

    This document is a draft final report (Volume 1) for US DOE contract entitled, open-quotes Demonstration Testing and Evaluation of In Situ Soil Heating,close quotes Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report and Volume II contains appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120 degrees to 130 degrees C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow

  3. Managing the financial cost of exception to contracting standards

    DEFF Research Database (Denmark)

    Henschel, Rene Franz

    2008-01-01

    In managing financial cost of exception to contracting standards, the first step is to put up an intelligent contract standards exception monitoring system The next step is to maintain tailor-made, fair and transparent contracting standards The third step is to eliminate unnecessary information...... and repetitiveness in contracting standards The fourth step is to enable your organization and the customers or suppliers to handle the necessary exceptions themselves Finally you should consider the use of independent contracting standards and elimination of your own standards as a tool in managing the cost...

  4. Induction of functional Fc receptors in P388 leukemia cells. Requirement for multiple differentiation signals.

    Science.gov (United States)

    Cohen, D A; Stotelmyer, N L; Kaplan, A M

    1985-04-01

    The development of functional Fc receptors (FcR) during induced differentiation with the tumor promoter, phorbol myristate acetate (PMA), was studied in the murine tumor cell line, P388. PMA induced the appearance of FcR on the membranes of P388 cells as indicated by the binding of IgG-coated sheep red blood cells (IgG-SRBC). Concentrations of PMA as low as 1 ng/ml were sufficient to induce the expression of FcR as well as to inhibit cellular division and to induce adherence in the P388 tumor cell line; however, optimal FcR induction occurred at PMA concentrations of 10-100 ng/ml. Immunofluorescent analysis with heat-aggregated myeloma proteins indicated that PMA induced FcR which were capable of binding IgG2a and IgG2b immunoglobulins, but not IgG1. Adherence to a substratum was determined to be a second required signal for expression of FcR, since PMA induction of P388 tumor cells in teflon dishes failed to fully develop FcR and adherence of P388 cells to poly-L-lysine-coated culture dishes in the absence of PMA was insufficient for FcR expression. FcR which appeared after PMA induction were non-functional in the sense that membrane-bound IgG-SRBC were not ingested to any significant extent by the tumor cells. However, if FcR induction occurred in the presence conA-induced rat spleen cell culture supernatants, phagocytosis of membrane-bound erythrocytes occurred. These findings suggest that for the expression of FcR which are capable of particle internalization, at least three identifiable membrane-transmitted signals are required during differentiation.

  5. TTI-621 (SIRPαFc): A CD47-Blocking Innate Immune Checkpoint Inhibitor with Broad Antitumor Activity and Minimal Erythrocyte Binding.

    Science.gov (United States)

    Petrova, Penka S; Viller, Natasja Nielsen; Wong, Mark; Pang, Xinli; Lin, Gloria H Y; Dodge, Karen; Chai, Vien; Chen, Hui; Lee, Vivian; House, Violetta; Vigo, Noel T; Jin, Debbie; Mutukura, Tapfuma; Charbonneau, Marilyse; Truong, Tran; Viau, Stephane; Johnson, Lisa D; Linderoth, Emma; Sievers, Eric L; Maleki Vareki, Saman; Figueredo, Rene; Pampillo, Macarena; Koropatnick, James; Trudel, Suzanne; Mbong, Nathan; Jin, Liqing; Wang, Jean C Y; Uger, Robert A

    2017-02-15

    Purpose: The ubiquitously expressed transmembrane glycoprotein CD47 delivers an anti-phagocytic (do not eat) signal by binding signal-regulatory protein α (SIRPα) on macrophages. CD47 is overexpressed in cancer cells and its expression is associated with poor clinical outcomes. TTI-621 (SIRPαFc) is a fully human recombinant fusion protein that blocks the CD47-SIRPα axis by binding to human CD47 and enhancing phagocytosis of malignant cells. Blockade of this inhibitory axis using TTI-621 has emerged as a promising therapeutic strategy to promote tumor cell eradication. Experimental Design: The ability of TTI-621 to promote macrophage-mediated phagocytosis of human tumor cells was assessed using both confocal microscopy and flow cytometry. In vivo antitumor efficacy was evaluated in xenograft and syngeneic models and the role of the Fc region in antitumor activity was evaluated using SIRPαFc constructs with different Fc tails. Results: TTI-621 enhanced macrophage-mediated phagocytosis of both hematologic and solid tumor cells, while sparing normal cells. In vivo , TTI-621 effectively controlled the growth of aggressive AML and B lymphoma xenografts and was efficacious in a syngeneic B lymphoma model. The IgG1 Fc tail of TTI-621 plays a critical role in its antitumor activity, presumably by engaging activating Fcγ receptors on macrophages. Finally, TTI-621 exhibits minimal binding to human erythrocytes, thereby differentiating it from CD47 blocking antibodies. Conclusions: These data indicate that TTI-621 is active across a broad range of human tumors. These results further establish CD47 as a critical regulator of innate immune surveillance and form the basis for clinical development of TTI-621 in multiple oncology indications. Clin Cancer Res; 23(4); 1068-79. ©2016 AACR . ©2016 American Association for Cancer Research.

  6. Implementacion de un agregador de noticias basado en Twitter : memoria final

    OpenAIRE

    Pérez Martín, Salvador; Herranz Esnaola, Leire

    2015-01-01

    Introducción Este trabajo de final de master (TFM) consiste en el análisis, el diseño y la implementación de un agregador de noticias utilizando la API de Twitter. La mo­tivación de este TFM viene dada por una necesidad de algunos usuarios de redes sociales de encontrar un sitio web donde estén en todas las noticias de actualidad según los intereses personales de cada uno. El problema viene dado por la falta de sitios webs donde la actualización de las noticias se haga de una man...

  7. Crescimento de mudas de Eucalyptus camaldulensis em substratos à base de casca de arroz carbonizada

    Directory of Open Access Journals (Sweden)

    Dagma Kratz

    2016-06-01

    Full Text Available RESUMO Com base na importância do substrato na produção de mudas florestais, objetivou-se, com este trabalho, avaliar a viabilidade técnica de 13 substratos, preparados com misturas de substrato comercial à base de casca de pinus e vermiculita (SC, casca de arroz carbonizada com diferentes granulometrias [maior que 2 mm (CAC1, CAC com granulometria entre 1 - 2 mm (CAC2, CAC com granulometria entre 0,5 - 1 mm (CAC3, CAC com granulometria menor que 0,5 mm (CAC4], fibra de coco (FC e vermiculita média (VM, na produção de mudas de Eucalyptus camaldulensis, e a correlação de suas propriedades físicas e químicas com seu crescimento. Foram utilizados tubetes de 55 cm³. As mudas permaneceram 60 dias em estufa de vidro e 30 dias a pleno sol. Foram avaliadas a altura, diâmetro de colo, fitomassas secas aérea e radicial, facilidade de retirada do tubete, agregação das raízes ao substrato e relação entre altura e diâmetro de colo. Concluiu-se que o substrato formado por CAC pura, em diferentes granulometrias e em mistura com os outros componentes, é viável tecnicamente para a produção de mudas de Eucalyptus camaldulensis, embora aquele formado pela mistura de 50% de CAC e VM tenha resultado em maior crescimento das mudas. As propriedades dos substratos, densidade aparente, pH e capacidade de troca catiônica são importantes na produção de mudas, pois apresentaram correlações significativas com as variáveis biométricas.

  8. 24 CFR 242.52 - Construction contracts.

    Science.gov (United States)

    2010-04-01

    ...; a construction management contract with a guaranteed maximum price, the final costs of which are... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Construction contracts. 242.52... MORTGAGE INSURANCE FOR HOSPITALS Construction § 242.52 Construction contracts. (a) Awarding of contract. A...

  9. Medicare program; offset of Medicare payments to individuals to collect past-due obligations arising from breach of scholarship and loan contracts--HCFA. Final rule.

    Science.gov (United States)

    1992-05-04

    This final rule sets forth the procedures to be followed for collection of past-due amounts owed by individuals who breached contracts under certain scholarship and loan programs. The programs that would be affected are the National Health Service Corps Scholarship, the Physician Shortage Area Scholarship, and the Health Education Assistance Loan. These procedures would apply to those individuals who breached contracts under the scholarship and loan programs and who-- Accept Medicare assignment for services; Are employed by or affiliated with a provider, Health Maintenance Organization, or Competitive Medical Plan that receives Medicare payment for services; or Are members of a group practice that receives Medicare payment for services. This regulation implements section 1892 of the Social Security Act, as added by section 4052 of the Omnibus Budget Reconciliation Act of 1987.

  10. Decisiones al final de la vida en México

    Directory of Open Access Journals (Sweden)

    Edith González Moreno

    2015-01-01

    Full Text Available El presente ensayo aborda el tema de las decisiones al final de la vida en México (incluyendo el tema de la muerte medi - camente asistida. 2 Las reflexiones parten de algunos indicadores nacionales de mortalidad en nuestro país, donde el fenómeno de muerte en hospitales está apenas siendo igualado al número de muertes que venían ocurriendo fuera de ellos. Por lo anterior y a diferencia de otros países, el foco de atención en las cuestiones relacionadas con el final de la vida no deberá centrarse exclusivamente en el ámbito hospitalario. También se presentan algunos argumentos internacionales, elementos de la legislación vigente, así como la influencia de los paternalismos médico y jurídico en México.

  11. 46 CFR 24.05-5 - Specific application noted in text.

    Science.gov (United States)

    2010-10-01

    ..., and in many cases limits the application of the text to vessels contracted for before or after a... 46 Shipping 1 2010-10-01 2010-10-01 false Specific application noted in text. 24.05-5 Section 24... Application § 24.05-5 Specific application noted in text. (a) At the beginning of the various parts, subparts...

  12. Biodisponibilidad de lisina para el pollo en crecimiento de cuatro harinas de subproductos avícolas

    Directory of Open Access Journals (Sweden)

    Arturo Cortes Cuevas

    2011-01-01

    Full Text Available Para conocer la biodisponibilidad de lisina para el pollo de cuatro lotes de harinas de subproductos avícolas (HSA mexicanas, se realizaron dos experimentos. En el Exp 1, se emplearon 168 pollitos de 1 a 21 días de edad y en el Exp 2, 210 pollitos de 7 a 21 días, en ambos experimentos las aves se distribuyeron completamente al azar en siete tratamientos con tres repeticiones cada uno. Los tratamientos fueron, 1 dieta basal sorgo-soya-ajonjolí (deficiente en lisina, 2 dieta basal + 0.05% de L-lisina, 3 dieta basal+0.10% de L-lisina, 4 dieta basal+0.05% de lisina a partir de HSA A o B, 5 dieta basal+0.10% de lisina a partir de HSA A o B, 6 dieta basal+0.05% de lisina a partir de HSA C o D y 7 dieta basal+0.10% de lisina a partir de HSA C o D. Los resultados del crecimiento se explicaron por la ecuación de regresión lineal múltiple de, Y=265.074+0.04288X1+0.0417X2+0.04085X3 , en donde X1 fue L-lisina, X2 la HSA A y X3 la HSA C (Exp 1 y del Exp 2 por Y=129.131+ 0.06764X1+0.06437X2+0.06614X3, en donde X1 fue L-lisina, X2 la HSA B y X3 la HSA D. Al comparar las pendientes de las HSA, con la de L-lisina considerada como 100 %, se obtuvieron biodisponibilidades de la HSA A de 97.2 %, C de 95.2 %, B de 95.2 % y D de 97.8 %. En base a los resultados obtenidos, se puede concluir que la calidad proteica de los cuatro lotes de harinas evaluadas, resultaron similares y de buena calidad.

  13. Comparação entre nifedipina por via sublingual e clonidina por via venosa no controle de hipertensão arterial peri-operatória em cirurgias de catarata

    Directory of Open Access Journals (Sweden)

    Stocche Renato Mestriner

    2002-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Estudo recente mostra que a clonidina por via venosa apresenta-se eficaz e segura no tratamento de crises hipertensivas durante cirurgia de catarata. Este estudo visa comparar o uso de nifedipina, droga amplamente utilizada por via sublingual, e clonidina por via venosa no controle da hipertensão arterial em cirurgias de catarata. MÉTODO: Setenta e cinco pacientes submetidos à facectomia foram distribuídos de forma aleatória e encoberta em: Grupo A, que recebeu nifedipina e Grupos C2 e C3, que receberam, respectivamente, 2 e 3 µg.kg-1 de clonidina por via venosa. Todos os pacientes apresentavam hipertensão arterial (PAS > 170 mmHg ou PAD > 110 mmHg. As PAS, PAD e freqüência cardíaca (FC foram medidas e comparadas nos momentos: 0 (antes do tratamento e de 2 em 2 minutos até o final do procedimento. Os eventos adversos foram anotados. RESULTADOS: Após o tratamento ocorreram diminuições da PAS e PAD nos 3 grupos (p <0,001. Houve controle da pressão arterial (<160 mmHg em 32%, 64% e 72% dos pacientes nos grupos A, C2 e C3, respectivamente (p < 0,05. No grupo C3 ocorreu maior incidência de efeitos colaterais que nos grupos C2 e A (p < 0,05. CONCLUSÕES:A clonidina por via venosa é mais eficaz que a nifedipina, por via sublingual, no controle de crises hipertensivas no peri-operatório de cirurgias de catarata. Contudo, a dose de 3 µg.kg-1 pode estar relacionada a efeitos colaterais, devendo-se iniciar o tratamento com 2 µg.kg-1.

  14. Fc-fusion technology and recombinant FVIII and FIX in the management of the hemophilias.

    Science.gov (United States)

    Mancuso, Maria Elisa; Mannucci, Pier Mannuccio

    2014-01-01

    Prophylaxis with regular infusions of factor VIII (FVIII)- or factor IX (FIX)- containing products is the mainstay of modern hemophilia care. However, this therapeutic regimen is inconvenient, requiring repeated intravenous injections from childhood. Approaches meant to prolong the half-life of FVIII and FIX in plasma have been developed in order to improve the feasibility and acceptability of replacement therapy, extending protection from bleeding, reducing infusion frequency and hence the need for venous access devices in young children. Several strategies have been implemented to enhance the pharmacokinetics of clotting factors, including conjugation with polyethylene glycol and the production by genetic engineering of fusion proteins containing the coagulation factors linked to a long-lived plasma protein such as albumin or the Fc fragment of immunoglobulin (Ig)G. The latter technology is one of the most promising, since the prolongation of FVIII and FIX half-life is obtained by exploiting the physiological binding of the Fc domain to the neonatal Fc receptor. Fc fusion monomers have been obtained with both recombinant FVIII (rFVIIIFc) and FIX (rFIXFc), and data from preclinical and clinical studies showed improved pharmacokinetics for both factors, which are produced in human embryonic kidney (HEK) 293 cells, thus ensuring full human post-translational modifications. In Phase I/IIa studies, rFVIIIFc and rFIXFc showed 1.5-1.7 fold and 3.0-4.0 fold longer elimination half-life, respectively. Similar data have been obtained in the Phase III clinical studies with rFVIIIFc and rFIX-Fc published recently. Both drugs were satisfactorily safe, particularly with respect to immunogenicity, and no serious adverse event was observed.

  15. IgG receptor FcγRIIB plays a key role in obesity-induced hypertension.

    Science.gov (United States)

    Sundgren, Nathan C; Vongpatanasin, Wanpen; Boggan, Brigid-Meghan D; Tanigaki, Keiji; Yuhanna, Ivan S; Chambliss, Ken L; Mineo, Chieko; Shaul, Philip W

    2015-02-01

    There is a well-recognized association between obesity, inflammation, and hypertension. Why obesity causes hypertension is poorly understood. We previously demonstrated using a C-reactive protein (CRP) transgenic mouse that CRP induces hypertension that is related to NO deficiency. Our prior work in cultured endothelial cells identified the Fcγ receptor IIB (FcγRIIB) as the receptor for CRP whereby it antagonizes endothelial NO synthase. Recognizing known associations between CRP and obesity and hypertension in humans, in the present study we tested the hypothesis that FcγRIIB plays a role in obesity-induced hypertension in mice. Using radiotelemetry, we first demonstrated that the hypertension observed in transgenic mouse-CRP is mediated by the receptor, indicating that FcγRIIB is capable of modifying blood pressure. We then discovered in a model of diet-induced obesity yielding equal adiposity in all study groups that whereas FcγRIIB(+/+) mice developed obesity-induced hypertension, FcγRIIB(-/-) mice were fully protected. Levels of CRP, the related pentraxin serum amyloid P component which is the CRP-equivalent in mice, and total IgG were unaltered by diet-induced obesity; FcγRIIB expression in endothelium was also unchanged. However, whereas IgG isolated from chow-fed mice had no effect, IgG from high-fat diet-fed mice inhibited endothelial NO synthase in cultured endothelial cells, and this was an FcγRIIB-dependent process. Thus, we have identified a novel role for FcγRIIB in the pathogenesis of obesity-induced hypertension, independent of processes regulating adiposity, and it may entail an IgG-induced attenuation of endothelial NO synthase function. Approaches targeting FcγRIIB may potentially offer new means to treat hypertension in obese individuals. © 2014 American Heart Association, Inc.

  16. IgG Receptor FcγRIIB Plays a Key Role in Obesity-Induced Hypertension

    Science.gov (United States)

    Sundgren, Nathan C.; Vongpatanasin, Wanpen; Boggan, Brigid-Meghan D.; Tanigaki, Keiji; Yuhanna, Ivan S.; Chambliss, Ken L.; Mineo, Chieko; Shaul, Philip W.

    2015-01-01

    There is a well-recognized association between obesity, inflammation, and hypertension. Why obesity causes hypertension is poorly understood. We previously demonstrated using a C-reactive protein (CRP) transgenic mouse that CRP induces hypertension that is related to NO deficiency. Our prior work in cultured endothelial cells identified the Fcγ receptor IIB (FcγRIIB) as the receptor for CRP whereby it antagonizes endothelial NO synthase. Recognizing known associations between CRP and obesity and hypertension in humans, in the present study we tested the hypothesis that FcγRIIB plays a role in obesity-induced hypertension in mice. Using radiotelemetry, we first demonstrated that the hypertension observed in transgenic mouse-CRP is mediated by the receptor, indicating that FcγRIIB is capable of modifying blood pressure. We then discovered in a model of diet-induced obesity yielding equal adiposity in all study groups that whereas FcγRIIB+/+ mice developed obesity-induced hypertension, FcγRIIB−/− mice were fully protected. Levels of CRP, the related pentraxin serum amyloid P component which is the CRP-equivalent in mice, and total IgG were unaltered by diet-induced obesity; FcγRIIB expression in endothelium was also unchanged. However, whereas IgG isolated from chow-fed mice had no effect, IgG from high-fat diet–fed mice inhibited endothelial NO synthase in cultured endothelial cells, and this was an FcγRIIB-dependent process. Thus, we have identified a novel role for FcγRIIB in the pathogenesis of obesity-induced hypertension, independent of processes regulating adiposity, and it may entail an IgG-induced attenuation of endothelial NO synthase function. Approaches targeting FcγRIIB may potentially offer new means to treat hypertension in obese individuals. PMID:25368023

  17. (Some) Cellular Mechanisms Influencing the Transcription of Human Endogenous Retrovirus, HERV-Fc1

    DEFF Research Database (Denmark)

    Laska, Magdalena Janina; Nissen, Kari Konstantin; Nexø, Bjørn Andersen

    2013-01-01

    DNA methylation and histone acetylation are epigenetic modifications that act as regulators of gene expression. DNA methylation is considered an important mechanism for silencing of retroelements in the mammalian genome. However, the methylation of human endogenous retroviruses (HERVs) is not well...... investigated. The aim of this study was to investigate the transcriptional potential of HERV-Fc1 proviral 5'LTR in more detail, and examined the specific influence of CpG methylation on this LTR in number of cell lines. Specifically, the role of demethylating chemicals e.g. 5-aza-2' deoxycytidine...... and Trichostatin-A, in inducing or reactivating expression of HERV-Fc1 specific sequences and the mechanisms were investigated. In our present study, 5-aza-dC is shown to be a powerful inducer of HERV-Fc1, and at the same time it strongly inhibits methylation of DNA. Treatment with this demethylating agent 5-aza...

  18. Sistemas de Distribución de Clave Cuántica Basados en Codificación en Frecuencia

    OpenAIRE

    Ruiz Alba Gaya, Antonio

    2012-01-01

    Esta tesis se centra en el estudio de la aplicabilidad que dos disciplinas, la fotónica de microondas (MWP) y las comunicaciones cuánticas, pueden aportar en el desarrollo de nuevos sistemas de distribución de clave cuántica (QKD). El objetivo principal es el análisis y la validación experimental de sistemas QKD en la técnica de codificación en frecuencia (FC-QKD), por medio de distintas configuraciones de moduladores. Los sistemas FC-QKD permiten la incorporación de técnicas de multiplexació...

  19. Nova proposta de teste incremental de remada na avaliação aeróbia de surfistas

    Directory of Open Access Journals (Sweden)

    Felipe Bercht CANOZZI

    2015-09-01

    Full Text Available ResumoOs objetivos desse estudo foram: 1 verificar as respostas do lactato sanguíneo e da frequência cardíaca (FC durante um protocolo de campo específico de remada no surfe; 2 correlacionar os índices de capacidade e potência aeróbia determinados nesse protocolo específico com o tempo de prática da modalidade e variáveis antropométricas. Participaram deste estudo nove sujeitos (24 ± 4,5 anos; 72,2 ± 6,7 kg; 178,4 ± 4,8 cm que foram submetidos a um teste progressivo intermitente de remada sobre a sua própria prancha de surfe, do tipo vai e vêm, com velocidades iniciais entre 1-1,1 m/s e incrementos de 0,05 m/s a cada 3 min até a exaustão voluntária. Uma resposta linear e exponencial foram observadas para a FC e o lactato sanguíneo, respectivamente, durante o protocolo incremental. Este comportamento foi semelhante ao demonstrado durante protocolos incrementais com objetivo de avaliar a capacidade e a potência aeróbia realizados em outras modalidades cíclicas. Além disso, foram encontradas correlações significantes entre o pico de velocidade (PV e a velocidade correspondente ao início do acúmulo de lactato no sangue (vOBLA (r = 0,87, p = 0,005 e do PV com tempo de prática de surfe (r = 0,70, p = 0,03. No entanto, não foram encontradas correlações significativas entre PV e vOBLA com nenhuma das variáveis antropométricas mensuradas. Assim, podemos concluir que o protocolo incremental específico de remada no surfe utilizado no presente estudo poderia ser uma ferramenta útil na determinação de índices relacionados à capacidade (vOBLA e potência (PV aeróbia de surfistas.

  20. Enhancement of antibody-dependent cell-mediated cytotoxicity by endowing IgG with FcαRI (CD89) binding.

    Science.gov (United States)

    Borrok, M Jack; Luheshi, Nadia M; Beyaz, Nurten; Davies, Gareth C; Legg, James W; Wu, Herren; Dall'Acqua, William F; Tsui, Ping

    2015-01-01

    Fc effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and antibody-dependent cell-mediated phagocytosis (ADCP) are crucial to the efficacy of many antibody therapeutics. In addition to IgG, antibodies of the IgA isotype can also promote cell killing through engagement of myeloid lineage cells via interactions between the IgA-Fc and FcαRI (CD89). Herein, we describe a unique, tandem IgG1/IgA2 antibody format in the context of a trastuzumab variable domain that exhibits enhanced ADCC and ADCP capabilities. The IgG1/IgA2 tandem Fc format retains IgG1 FcγR binding as well as FcRn-mediated serum persistence, yet is augmented with myeloid cell-mediated effector functions via FcαRI/IgA Fc interactions. In this work, we demonstrate anti-human epidermal growth factor receptor-2 antibodies with the unique tandem IgG1/IgA2 Fc can better recruit and engage cytotoxic polymorphonuclear (PMN) cells than either the parental IgG1 or IgA2. Pharmacokinetics of IgG1/IgA2 in BALB/c mice are similar to the parental IgG, and far surpass the poor serum persistence of IgA2. The IgG1/IgA2 format is expressed at similar levels and with similar thermal stability to IgG1, and can be purified via standard protein A chromatography. The tandem IgG1/IgA2 format could potentially augment IgG-based immunotherapeutics with enhanced PMN-mediated cytotoxicity while avoiding many of the problems associated with developing IgAs.

  1. Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...

    African Journals Online (AJOL)

    Journal de la Recherche Scientifique de l'Universite de Lome. ... V.J. Mama, J Oloukoi, F.C. Biaou, R Tete, 231-247 ... Etat des lieux et profil de l'imagerie par resonance magnetique dans l'exploration du cancer de la prostate au Togo · EMAIL ...

  2. Site-selective conjugation of an anticoagulant aptamer to recombinant albumins and maintenance of neonatal Fc receptor binding

    Science.gov (United States)

    Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia; Kuhlmann, Matthias; Cameron, Jason; Sørensen, Esben S.; Wengel, Jesper; Howard, Kenneth A.

    2017-05-01

    Aptamers are an attractive molecular medicine that offers high target specificity. Nucleic acid-based aptamers, however, are prone to nuclease degradation and rapid renal excretion that require blood circulatory half-life extension enabling technologies. The long circulatory half-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate linker, were successfully prepared and purified by high performance liquid chromatography as confirmed by gel electrophoresis band-shift analysis and matrix-assisted laser desorption/ionization time of flight. Minimal reduction (∼25%) in activity of WT-linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer interferometry. Binding could be rescued by aptamer conjugation to recombinant albumin engineered for higher FcRn affinity (HB) that exhibited an 8-fold affinity compared to WT alone. This work describes a novel albumin-based aptamer delivery system whose hFcRn binding can be increased using a HB engineered albumin.

  3. La génesis de un final

    Directory of Open Access Journals (Sweden)

    Dardo Scavino

    2011-07-01

    Full Text Available Como este coloquio no sólo está consagrado a la obra de Juan José Saer sino también a la génesis de sus textos, quisiera iniciar mi ponencia planteando algunas preguntas : ¿cuándo comienza un texto ? ¿en la primera línea que leemos, eso que solemos llamar el incipit, o en la primera que el autor escribió ? Y si en el texto hay, corregidas o no, citas de otros, ¿podemos decir que este texto empezó a escribirse antes del nacimiento de su autor ? Estos interrogantes pueden desplazarse incluso a la cuestión del final. En efecto, ¿cuándo termina un texto ? ¿en la última línea que leemos, eso que solemos llamar el excipit, o en la última que escribió el autor ? ¿O acaba, más allá de la muerte de éste, cuando alguien lo cita por última vez ? En fin, ¿cuál es la génesis de un texto y cual su juicio final ? ¿Cuándo se inician las correcciones y cuándo se terminan ?Puisque ce colloque n’est pas seulement consacré à l’œuvre de Juan José Saer, mais aussi à la genèse de ses textes, je voudrais commencer ma communication par quelques questions : quand peut-on dire qu’un texte commence ? dans la première ligne que l’on lit, dans ce que nous appelons habituellement incipit, ou dans la première ligne écrite par l’auteur ? S’il y a, dans le texte, des citations d’autres auteurs (quelles soient corrigées ou non, peut-on dire que ce texte a commencé à s’écrire avant même la naissance de son auteur ? Ces questions peuvent également se poser en relation avec la fin. En effet, quand peut-on dire qu’un texte finit ? Dans la dernière ligne que nous lisons, dans ce que nous appelons habituellement excipit, ou dans le dernier mot écrit par l’auteur ? Ou bien doit-on dire que le texte s’achève au-delà de la mort de l’auteur, quand il est cité pour la dernière fois ? Enfin, quelle est la genèse d’un texte, et quel est son dernier jugement ? Quel est le début des corrections, et

  4. Evaluation of FcεRl-binding serum IgE in patients with ocular allergic diseases

    Directory of Open Access Journals (Sweden)

    Satoru Matsumoto

    1999-01-01

    Full Text Available We evaluated high-affinity receptor for IgE (FcεRI- binding serum IgE in patients with atopic keratoconjunctivitis (AKC; n=31 and with seasonal allergic conjunctivitis (SAC; n=13 by enzyme-linked immunosorbent assay (ELISA using a recombinant soluble form of the human FcεRIα ectodomain (soluble α. The quantities of FcεRI-binding IgE are compared with those of total IgE measured by a conventional sandwich ELISA. Both of the quantities of FcεRI-binding and total IgE in AKC were significantly larger than those in SAC (P<0.001. In contrast, the proportion of FcεRI- binding IgE (FcεRI-binding IgE/total IgE; % in SAC was significantly larger than that in AKC (P <0.001, although significant reverse correlation was observed between the proportion of FcεRI-binding IgE and total IgE in both AKC and SAC. Significantly, a higher proportion of FcεRI-binding IgE in SAC than that in AKC may reflect the differences in pathologic states of AKC and SAC that are caused by a disparity in immune responses in these diseases.

  5. Elite hit ball performance profile: technical and tactical, and heart rate aspects, and effects of competition on jump and strength performance. [Perfiles de rendimiento en hit ball de elite: aspectos técnicos, tácticos y frecuencia cardíaca, y los efectos de la competición en la capacidad de salto y rendimiento de fuerza].

    Directory of Open Access Journals (Sweden)

    Corrado Lupo

    2018-04-01

    Full Text Available Abstract This study aimed to define a performance profile of elite hit ball matches. Eighty-six male Italian Serie A hit ball players (29.3±5.0 yrs participated in the study. A technical and tactical analysis (18 indicators was performed on eleven matches; heart rate (HR was monitored during matches on 25 players; countermovement jump (CMJ and maximal grip strength (GS were measured on all participants before and after match. Differences (P<0.05 between winning (W and losing (L teams for technical and tactical analysis (Chi-square, and between match phases for HR, CMJ, and GS (ANOVA for repeated measurements were tested. Hit ball teams meanly performed 297±10 rallies per match (W: 41±6 goals; L: 23±3 goals, P=0.042. No differences between quarters emerged for HR (171-190 bpm for 57±21 % of match duration. Opposite trends emerged for CMJ (after: 36.2±6.3 cm; before: 33.1±4.8 cm; P=0.001 and GS (after: 433±102 N; before: 463±98 N; P=0.018 performances. Findings show that hit ball is performed at high HR intensity, and that CMJ improves and GS declines after matches. This could be determined by a neuromuscular activation of lower limbs and repeated harm concussions due to shots. Resumen El estudio tenía como objetivo definir los perfiles de rendimiento en partidos de hit ball de elite. Un total de 81 jugadores italianos de la Serie A (29.3±5.0 años tomaron parte en el estudio. El análisis técnico y táctico (18 indicadores se realizó durante once partidos; la variable frecuencia cardíaca (FC fue monitorizada durante los partidos en 25 jugadores; el test de salto en contramovimiento (SCM y el test de fuerza máxima de prensión (FMP se midieron antes y después de cada partido. Las diferencias (P<0.05 entre equipos ganadores (G y perdedores (P en los aspectos técnicos y tácticos se realizó mediante el test de Chi-cuadrado, y para las diferencias entre las fases del partido en las variables FC, SCM y FMP se empleó el ANOVA de

  6. Fcγ receptor expression on splenic macrophages in adult immune thrombocytopenia

    NARCIS (Netherlands)

    Audia, S; Santegoets, K; Laarhoven, A G; Vidarsson, G; Facy, O; Ortega-Deballon, P; Samson, M; Janikashvili, N; Saas, P; Bonnotte, B; Radstake, T R

    2017-01-01

    Splenic macrophages play a key role in immune thrombocytopenia (ITP) pathogenesis by clearing opsonized platelets. Fcγ receptors (FcγR) participate in this phenomenon, but their expression on splenic macrophages and their modulation by treatment have scarcely been studied in human ITP. We aimed to

  7. Human IgG lacking effector functions demonstrate lower FcRn-binding and reduced transplacental transport.

    Science.gov (United States)

    Stapleton, Nigel M; Armstrong-Fisher, Sylvia S; Andersen, Jan Terje; van der Schoot, C Ellen; Porter, Charlene; Page, Kenneth R; Falconer, Donald; de Haas, Masja; Williamson, Lorna M; Clark, Michael R; Vidarsson, Gestur; Armour, Kathryn L

    2018-03-01

    We have previously generated human IgG1 antibodies that were engineered for reduced binding to the classical Fcγ receptors (FcγRI-III) and C1q, thereby eliminating their destructive effector functions (constant region G1Δnab). In their potential use as blocking agents, favorable binding to the neonatal Fc receptor (FcRn) is important to preserve the long half-life typical of IgG. An ability to cross the placenta, which is also mediated, at least in part, by FcRn is desirable in some indications, such as feto-maternal alloimmune disorders. Here, we show that G1Δnab mutants retain pH-dependent binding to human FcRn but that the amino acid alterations reduce the affinity of the IgG1:FcRn interaction by 2.0-fold and 1.6-fold for the two antibodies investigated. The transport of the modified G1Δnab mutants across monolayers of human cell lines expressing FcRn was approximately 75% of the wild-type, except that no difference was observed with human umbilical vein endothelial cells. G1Δnab mutation also reduced transport in an ex vivo placenta model. In conclusion, we demonstrate that, although the G1Δnab mutations are away from the FcRn-binding site, they have long-distance effects, modulating FcRn binding and transcellular transport. Our findings have implications for the design of therapeutic human IgG with tailored effector functions. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

  8. Screening of cardiomyocyte fluorescence during cell contraction by multi-dimensional TCSPC

    Science.gov (United States)

    Chorvat, D., Jr.; Abdulla, S.; Elzwiei, F.; Mateasik, A.; Chorvatova, A.

    2008-02-01

    Autofluorescence is one of the most versatile non-invasive tools for mapping the metabolic state of living tissues, such as the heart. We present a new approach to the investigation of changes in endogenous fluorescence during cardiomyocyte contraction - by spectrally-resolved, time correlated, single photon counting (TCSPC). Cell contraction is stimulated by external platinum electrodes, incorporated in a home-made bath and triggered by a pulse generator at a frequency of 0.5 Hz (to stabilize sarcoplasmic reticulum loading), or 5 Hz (the rat heart rate). Cell illumination by the laser is synchronized with cell contraction, using TTL logic pulses operated by a stimulator and delayed to study mitochondrial metabolism at maximum contraction (10-110 ms) and/or at steady state (1000-1100 ms at 0.5 Hz). To test the setup, we recorded calcium transients in cells loaded with the Fluo-3 fluorescent probe (excited by 475 nm pulsed picosecond diode laser). We then evaluated recordings of flavin AF (excited by 438 nm pulsed laser) at room and physiological temperatures. Application of the presented approach will shed new insight into metabolic changes in living, contracting myocytes and, therefore, regulation of excitation-contraction coupling and/or ionic homeostasis and, thus, heart excitability.

  9. Liability to disgorge profits upon breach of contract or a delict

    NARCIS (Netherlands)

    Schrage, E.J.H.

    2013-01-01

    Remedies regarding contract and tort are, generally speaking, concerned with the incidence of liability for loss or damage suffered, whereas the claim in unjust enrichment is said to require that the enrichment has occurred at the expense of the creditor. Consequently claims for breach of contract

  10. Improvement of self-care behaviors after a nursing educational intervention with patients with heart failure Mejoramiento en los comportamientos de autocuidado después de una intervención educativa de enfermería con pacientes con falla cardíaca Melhoramento nos comportamentos de autocuidado depois de uma intervenção educativa de enfermagem com pacientes com falha cardíaca

    Directory of Open Access Journals (Sweden)

    Edith Arredondo Holguín

    2012-07-01

    puntaje máximo posible de obtener en la escala es de 84, los pacientes tuvieron una mediana en los puntajes inicial y final de 40 y 53 (p Objetivo. Avaliar o melhoramento nos comportamentos de autocuidado depois de uma intervenção educativa de enfermagem em pacientes com Falha Cardíaca (FC. Metodologia. Participaram 29 pacientes de 30 e mais anos que assistiram em 2010 ao programa de saúde cardiovascular de uma instituição hospitalar de Medellín (Colômbia que assinaram o consentimento informado e receberam durante 9 meses uma intervenção educativa de enfermagem consistente em encontros educativos grupais, sessões de tele-enfermagem, visitas domiciliárias e cartilha de apoio. Aplicou-se a Escala de autocuidado de Artinian validada no meio, composta por 28 itens distribuídos em quatro dimensões (solicitação de ajuda, adaptação à doença e aderência aos tratamentos farmacológicos e não farmacol��gicos. Para a avaliação das mudanças nestes comportamentos se aplicou ao início e terminação do estudo. Resultados. Tendo em conta que a pontuação máximo possível de obter na escala é de 84, os pacientes tiveram uma média nas pontuações iniciais e finais de 40 e 53 (p < 0.05. As dimensões em que mais mudanças positivas se observaram foram os de solicitação de ajuda, adaptação à doença e aderência ao tratamento farmacológico; quanto à aderência ao tratamento não farmacológico há dois comportamentos que não tiveram mudanças favoráveis (redução no consumo de sal e medir a quantidade de urina eliminada. Conclusão. A intervenção educativa de enfermagem realizada em nosso estudo teve um efeito benéfico na maioria dos comportamentos de autocuidado avaliados nas pessoas com FC.

  11. ANÁLISIS DE LA SECUENCIA DE PARTICIPACIÓN SEGMENTARIA EN EL MOVIMIENTO FINAL DEL LANZAMIENTO DE PESO EN GIRO

    Directory of Open Access Journals (Sweden)

    M. Gutiérrez-Dávila

    2010-09-01

    Full Text Available

     

     

    RESUMEN

    El objetivo general de este estudio es realizar un análisis descriptivo del patrón general de la participación segmentaria durante la fase de aceleración final del lanzamiento de peso en giro. Para ello, se han analizado a seis lanzadores de peso finalistas en el Campeonato del Mundo de Atletismo de Pista Cubierta, celebrado en Valencia, 2008. Se han utilizado técnicas fotogramétricas tridimensionales (3D a partir de la filmación del gesto con dos cámaras de video sincronizadas temporalmente a 100 Hz. Considerando que el tiempo empleado durante el movimiento final de aceleración del peso es diferente para cada lanzador, los registros se han normalizado en función del tiempo utilizando los algoritmos de splines de quinto grado e interpolándose posteriormente sus valores con respecto al porcentaje del tiempo total.  Los resultados ponen de manifiesto que la cadena cinética utilizada durante el movimiento final de aceleración del peso tiene dos modelos diferenciados: Hasta el 60% del tiempo total se produce un modelo de empuje o de participación simultánea de las articulaciones del tobillo, la rodilla y la cadera en extensión y, a continuación, el modelo de participación es secuencial, especialmente  mediante la contribución de la extensión del codo y muñeca. El movimiento de rotación a través del eje vertical se mantiene hasta el despegue del peso.
    Palabras Clave:cadena cinética, biomecánica, fotogrametría 3D.

     

    ABSTRACT

    The general objective of this study is to carry out a descriptive analysis of the general pattern of the segmental participation during the phase of final

  12. An Fc engineering approach that modulates antibody-dependent cytokine release without altering cell-killing functions.

    Science.gov (United States)

    Kinder, Michelle; Greenplate, Allison R; Strohl, William R; Jordan, Robert E; Brezski, Randall J

    2015-01-01

    Cytotoxic therapeutic monoclonal antibodies (mAbs) often mediate target cell-killing by eliciting immune effector functions via Fc region interactions with cellular and humoral components of the immune system. Key functions include antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC). However, there has been increased appreciation that along with cell-killing functions, the induction of antibody-dependent cytokine release (ADCR) can also influence disease microenvironments and therapeutic outcomes. Historically, most Fc engineering approaches have been aimed toward modulating ADCC, ADCP, or CDC. In the present study, we describe an Fc engineering approach that, while not resulting in impaired ADCC or ADCP, profoundly affects ADCR. As such, when peripheral blood mononuclear cells are used as effector cells against mAb-opsonized tumor cells, the described mAb variants elicit a similar profile and quantity of cytokines as IgG1. In contrast, although the variants elicit similar levels of tumor cell-killing as IgG1 with macrophage effector cells, the variants do not elicit macrophage-mediated ADCR against mAb-opsonized tumor cells. This study demonstrates that Fc engineering approaches can be employed to uncouple macrophage-mediated phagocytic and subsequent cell-killing functions from cytokine release.

  13. 34 CFR 97.408 - Requirements for permission by parents or guardians and for assent by children.

    Science.gov (United States)

    2010-07-01

    ... permission is not a reasonable requirement to protect the subjects (for example, neglected or abused children... for assent by children. 97.408 Section 97.408 Education Office of the Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Additional ED Protections for Children Who Are Subjects in Research...

  14. ¿Pueden las autoevaluaciones del alumnado ser la nota final de una asignatura?: el caso de biogerontología Is it possible to assume the autoevaluation of the students as the final mark of a subject?: the case of biogerontology

    Directory of Open Access Journals (Sweden)

    Dámaso Crespo

    2003-03-01

    Full Text Available Presentamos un estudio de la correlación entre las calificaciones objetivas (CO en una prueba tipo test de los estudiantes en la asignatura optativa Biogerontología con las autoevaluaciones subjetivas (AS que los alumnos se asignaron tras la realización de la prueba y la que consideraron se merecían con relación al esfuerzo (AE realizado para preparar dicha materia. El estadístico utilizado ha sido el coeficiente de correlación (rxy. Los resultados obtenidos muestran una alta correlación rxy = 0,77 cuando se comparan AS-AE. Sin embargo, rxy es muy bajo para los pares de valores CO-AS(0,05 y CO-AE (-0,07. Existen diferencias significativas (pThis study correlates the marks obtained in the test of the optative subject Biogerontology (CO, and those self-attributed by a group of students upon level of study (AS and dedication (AE to the subject. Statistical analysis used the correlation coefficient (rxy. The results showed a low correlation when CO-AS (0.05 and CO-AE (-0.07 marks were compared (p<0.05. A high value (0.77 was obtained when both subjective marks were compared (AS-AE. Our results well suggest that subjective marks should not be used as the final marks in this subject.

  15. Final Report - Advanced MEA's for Enhanced Operating Conditions, Amenable to High Volume Manufacture

    Energy Technology Data Exchange (ETDEWEB)

    Debe, Mark K.

    2007-09-30

    This report summarizes the work completed under a 3M/DOE contract directed at advancing the key fuel cell (FC) components most critical for overcoming the polymer electrolyte membrane fuel cell (PEMFC) performance, durability & cost barriers. This contract focused on the development of advanced ion exchange membranes & electrocatalysts for PEMFCs that will enable operation under ever more demanding automotive operating conditions & the use high volume compatible processes for their manufacture. Higher performing & more durable electrocatalysts must be developed for PEMFCs to meet the power density & lifetime hours required for FC vehicles. At the same time the amount of expensive Pt catalyst must be reduced to lower the MEA costs. While these two properties are met, the catalyst must be made resistant to multiple degradation mechanisms to reach necessary operating lifetimes. In this report, we present the work focused on the development of a completely new approach to PEMFC electrocatalyts, called nanostructured thin film (NSTF) catalysts. The carbon black supports are eliminated with this new approach which eliminates the carbon corrosion issue. The thin film nature of the catalyst significantly improves its robustness against dissolution & grain growth, preserving the surface area. Also, the activity of the NSTF for oxygen reduction is improved by over 500% compared to dispersed Pt catalyts. Finally, the process for fabricating the NSTF catalysts is consistent with high volume roll-good manufacturing & extremely flexible towards the introduction of new catalyst compositions & structures. This report documents the work done to develop new multi-element NSTF catalysts with properties that exceed pure Pt, that are optimized for use with the membranes discussed below, & advance the state-of-the-art towards meeting the DOE 2010 targets for PEMFC electrocatalysts. The work completed advances the understanding of the NSTF catalyst technology, identifies new NSTF

  16. High Affinity IgE-Fc Receptor alpha and gamma Subunit Interactions

    International Nuclear Information System (INIS)

    Rashid, A.; Housden, J. E. M.; Sabban, S.; Helm, B.

    2014-01-01

    Objective: To explore the relationships between the subunits (alpha, beta and gamma) of the high affinity IgE receptor (Fc and RI) and its ability to mediate transmembrane signaling. Study Design: Experimental study. Place and Duration of Study: Department of Molecular Biology and Biotechnology, University of Sheffield, UK, from 2008 to 2009. Methodology: The approach employed was to create a chimera (human alpha-gamma-gamma) using the extracellular (EC) domain of the human high affinity IgE receptor. The alpha subunit (huFc and RIalpha) of IgE receptor was spliced onto the rodent gamma TM and cytoplasmic domain (CD). This was transfected into the Rat Basophilic Leukemia cell line in order to assess the possibility of selectively activating cells transfected with this single pass construct for antigen induced mediator release. Results: The RBLs cell lines transfected with the huFc and RIalpha/gamma/gamma cDNA constructs were assessed for the cell surface expression of the huFc and RIalpha subunit and the response to the antigenic stimulus by looking for degranulation and intracellular Ca2+ mobilisation. The results obtained showed the absence of huFc and RIalpha subunit expression on the surface of transfected cells as seen by flowcytometric studies, beta-hexosaminidase assays and intracellular calcium mobilisation studies. Conclusion: In the present study the grounds for non-expression of huFc and RIalpha/gamma/gamma cDNA remains elusive but may be due to the fact that the human-rodent chimeric receptors are assembled differently than the endogenous rodent receptors as seen in study in which COS 7 cells were transfected with human/rat chimeric complexes. (author)

  17. Down-regulation of FcεRI-mediated CD63 basophil response during short-term VIT determined venom-nonspecific desensitization.

    Directory of Open Access Journals (Sweden)

    Nina Čelesnik Smodiš

    Full Text Available BACKGROUND: We recently showed a desensitization of FcεRI-mediated basophil response after short-term VIT. Our aim was to evaluate the allergen specificity of this desensitization. METHODS: In 11 Hymenoptera-venom double positive subjects, basophil threshold sensitivity (CD-sens to anti-FcεRI, honeybee, and Vespula venom was assessed at the beginning and just before the first maintenance dose (MD of single ultra-rush VIT. In some patients we also monitored CD-sens to rApi m 1 and/or rVes v 5 or other co-sensitizations (i.e., grass pollen. In additional 7 patients, basophils were stripped and sensitized with house dust mite (HDM IgEs at the same time points. RESULTS: We demonstrated a marked reduction of CD-sens to anti-FcεRI and VIT-specific venom before the first MD in all 18 subjects included. Furthermore, in 10 out of 11 double positive subjects, a significant and comparable decrease before the first MD was also evident for non-VIT venom; this nonspecific decrease was further supported by the opposite recombinant species-specific major allergen. In one subject with additional grass pollen allergy, a decrease of CD-sens to grass allergen was also demonstrated. Similarly, in 7 cases of patients with passively HDM-sensitized basophils, a significant reduction of CD-sens was also evident to de novo sensitized HDM allergen. CONCLUSIONS: Short-term VIT induced basophil desensitization to VIT-specific as well as to VIT-nonspecific venom. As opposed to long-term VIT, which induces venom-specific changes, the effect of short-term VIT seems to be venom-nonspecific.

  18. Continuation of Crosscutting Technology Development at Cast

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Roe-Hoan

    2012-03-31

    This Final Technical Report describes progress made on the sub-projects awarded in the Cooperative Agreement DE-FC26-05NT42457: Continuation of Crosscutting Technology Development at Center for Advanced Separation Technologies (CAST). The final reports for each sub-project are attached in the appendix. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: a) Solid-solid separation b) Solid-liquid separation c) Chemical/Biological Extraction d) Modeling and Control, and e) Environmental Control.

  19. Relação entre variáveis da composição corporal e densidade mineral óssea em mulheres idosas Relación entre las variables de la composición corporal y la densidade mineral ósea en mujeres añosas Relationship between variables of body composition and mineral bone density in elder women

    Directory of Open Access Journals (Sweden)

    Luciane Moreira Chaves

    2005-12-01

    entre 66,41 ± 4,82 años. No se identificó ningún uso de hormonas ni cualquier otra medicina que pudieran afectar el metabolismo del hueso, así como las mujeres no tenían hábito de fumar ni de ingerir alcohólico. La composición corporal y DMO de la región femoral (CF y de la columna lumbar (CL fueron moderados a través de DXA, un DPX-IQ lunar. Las relaciones entre MCT, MM y MG y DMO de CF y de CL fueron hechas separadamente, a través del análisis de regresión lineal. El análisis de regresión múltiple fue usado para determinar la contribución de MCT, MM y MG en DMO de CF y de CL. RESULTADOS: MCT mostró una correlación con DMO de CF fuertemente y de CL (r = 0,54, p = 0,01 y r = 0,37, p = 0,01 respectivamente, que la MG (r = 0,30, p = 0,01 y r = 0,19, p = 0,06 respectivamente y MM (r = 0,44, p = 0,01 y r = 0,26, p = 0,05 respectivamente. CONCLUSIÓN: MCT y MM fueron los componentes corpórales que mantuvieron la relación significante con DMO de CF y de CL. MG mostró una correlación débil con DMO de CF y de CL, no siendo estatisticamente significante en este último rango. Así, MCT y una saludable MM, son entre las variables de la composición corporal, uno de los determinantes significativos de la DMO en las mujeres más viejas.There are controversies in the literature as to the importance of the total body mass (TBM, lean mass (LM, and fat mass (FM as determinant factors to the mineral bone density (MBD in elder women. PURPOSE: To determine the relationship of the MBD to the TBM, LM and FM in elder women. METHODS: It was studied ninety-seven 60-70 years old women (mean 66.41 ± 4.82 years. None of the participants was using hormones or any other medication that could affect the bone metabolism, as well as they were not smokers or alcohol consumers. The body composition and the MBD of the femoral cervix (FC and lumbar spine (LS were measured through DXA, a lunar DPX-IQ. The relationship between TBM, LM, and FM as well as the FC and LS' MBD were

  20. Platelet receptor polymorphisms do not influence Staphylococcus aureus–platelet interactions or infective endocarditis

    Science.gov (United States)

    Daga, Shruti; Shepherd, James G.; Callaghan, J. Garreth S.; Hung, Rachel K.Y.; Dawson, Dana K.; Padfield, Gareth J.; Hey, Shi Y.; Cartwright, Robyn A.; Newby, David E.; Fitzgerald, J. Ross

    2011-01-01

    Cardiac vegetations result from bacterium–platelet adherence, activation and aggregation, and are associated with increased morbidity and mortality in infective endocarditis. The GPIIb/IIIa and FcγRIIa platelet receptors play a central role in platelet adhesion, activation and aggregation induced by endocarditis pathogens such as Staphylococcus aureus, but the influence of known polymorphisms of these receptors on the pathogenesis of infective endocarditis is unknown. We determined the GPIIIa platelet antigen PlA1/A2 and FcγRIIa H131R genotype of healthy volunteers (n = 160) and patients with infective endocarditis (n = 40), and investigated the influence of these polymorphisms on clinical outcome in infective endocarditis and S. aureus–platelet interactions in vitro. Platelet receptor genotype did not correlate with development of infective endocarditis, vegetation characteristics on echocardiogram or the composite clinical end-point of embolism, heart failure, need for surgery or mortality (P > 0.05 for all), even though patients with the GPIIIa PlA1/A1 genotype had increased in vivo platelet activation (P = 0.001). Furthermore, neither GPIIIa PlA1/A2 nor FcγRIIa H131R genotype influenced S. aureus-induced platelet adhesion, activation or aggregation in vitro (P > 0.05). Taken together, our data suggest that the GPIIIa and FcγRIIa platelet receptor polymorphisms do not influence S. aureus–platelet interactions in vitro or the clinical course of infective endocarditis. PMID:21044892

  1. Biomecânica da córnea após laser de femtossegundo na cirurgia de catarata

    Directory of Open Access Journals (Sweden)

    Bruno Freitas Valbon

    2015-10-01

    , respectivamente. O teste de Mann-Whitney foi realizado para avaliar as diferenças dos parâmetros biomecânicos da córnea derivados do Corvis ST entre os dois grupos (LFS; FC após a cirurgia de catarata (D1. Foi considerado como estatisticamente significante p ≤ 0,05%. Resultados: A média de idade dos pacientes do grupo do LFS foi de 67,6 anos (± 9,9 e do grupo do FC foi de 68,4 anos (± 11,8.A média do PNS entre todos os pacientes (análise objetiva do cristalino foi de 0,62 (± 0,67. No grupo do LFS, 9 dos 11 parâmetros foram estatisticamente significativos entre o Pré e D1; e no grupo do FC, 7 dos 11 parâmetros estudados foram estatisticamente significativos entre o Pré e D1. De todos os parâmetros biomecânicos derivados do Corvis ST estudados, somente o tempo de concavidade máxima da córnea (HC-time; p ≤ 0.0387 foi diferente entre os dois grupos (laser de femtossegundo x faco convencional em D1. Conclusão: O laser de femtossegundo para cirurgia de catarata e a técnica de facoemulsificação convencional induziram alterações nas propriedades biomecânicas da córnea pelo Corvis ST no D1. Apenas 1 dos 11 parâmetros biomecânicos estudados foi diferente estatisticamente entre os grupos do LFS e FC.

  2. 19 CFR 12.100 - Importations in good faith; common or contract carriage.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importations in good faith; common or contract... Importations in good faith; common or contract carriage. (a) Exportation in lieu of seizure. Upon a claim that the importer acted in good faith without knowledge of applicable laws and regulations, Customs...

  3. Development of Nano-crystalline Doped-Ceramic Enabled Fiber Sensors for High Temperature In-Situ Monitoring of Fossil Fuel Gases

    Energy Technology Data Exchange (ETDEWEB)

    Xiao, Hai [Missouri Univ. of Science and Technology, Rolla, MO (United States); Dong, Junhang [Univ. of Cincinnati, OH (United States); Lin, Jerry [Arizona State Univ., Tempe, AZ (United States); Romero, Van [New Mexico Institute of Mining and Technology, Socorro, NM (United States)

    2012-03-01

    This is a final technical report for the first project year from July 1, 2005 to Jan 31, 2012 for DoE/NETL funded project DE-FC26-05NT42439: Development of Nanocrystalline Doped-Ceramic Enabled Fiber Sensors for High Temperature In-Situ Monitoring of Fossil Fuel Gases. This report summarizes the technical progresses and achievements towards the development of novel nanocrystalline doped ceramic material-enabled optical fiber sensors for in situ and real time monitoring the gas composition of flue or hot gas streams involved in fossil-fuel based power generation and hydrogen production.

  4. Efecto de la adición de las hojas frescas de orégano (origanum vulgare en el rendimiento productivo de pollos de engorde.

    Directory of Open Access Journals (Sweden)

    Yesid González

    2011-10-01

    Full Text Available En Colombia, desde 1984, se permite el empleo de antibióticos promotoresde crecimiento (APC, como mecanismo para mejorar el rendimiento productivode la avicultura, pero el uso de APC a niveles subterapéuticos favorece la aparición de factores de resistencia a estos medicamentos, causando un problema de salud pública, por el surgimiento de bacterias resistentes. De ahí, que el uso de extractos vegetales es una alternativa fitogénetica al uso de los APC. Entre varios, el de orégano ha sido comúnmente usado en la alimentación animal por sus efectos antioxidantes y bacteriostáticos permitiendo el mejoramiento del rendimiento productivo de pollos de engorde. El objetivo de este trabajo es evaluar el efecto de la adición de hojas frescas de orégano (O. vulgare en la ganancia de peso, eficiencia y conversión alimenticia en pollos de la línea Cobb. Para esto se realizó un estudio con un modelo experimental aleatorio con una duración de 32 días; 8 de los cuales fueron de adaptación a las hojas de dicha planta. Se emplearon tres tratamientos, cada uno con 30 pollos de la línea Cobb con registros independientes y alimentados con un concentrado comercial. El T3 denominado control, sin inclusión de hojas de orégano; en los tratamientos T1 y T2 se adicionó a la dieta comercialel 1 y 5% de hojas frescas de orégano respectivamente. Se observó que no hay diferencias estadísticamente significativas (p≥0.05 para la ganancia de peso, pero sí para la eficiencia y conversión alimenticia (p≤ 0.05 con respecto al tratamiento control (T3.

  5. Incorporation of FcRn-mediated disposition model to describe the population pharmacokinetics of therapeutic monoclonal IgG antibody in clinical patients.

    Science.gov (United States)

    Ng, Chee M

    2016-03-01

    The two-compartment linear model used to describe the population pharmacokinetics (PK) of many therapeutic monoclonal antibodies (TMAbs) offered little biological insight to antibody disposition in humans. The purpose of this study is to develop a semi-mechanistic FcRn-mediated IgG disposition model to describe the population PK of TMAbs in clinical patients. A standard two-compartment linear PK model from a previously published population PK model of pertuzumab was used to simulate intensive PK data of 100 subjects for model development. Two different semi-mechanistic FcRn-mediated IgG disposition models were developed and First Order Conditional Estimation (FOCE) with the interaction method in NONMEM was used to obtain the final model estimates. The performances of these models were then compared with the two-compartment linear PK model used to simulate the data for model development. A semi-mechanistic FcRn-mediated IgG disposition model consisting of a peripheral tissue compartment and FcRn-containing endosomes in the central compartment best describes the simulated pertuzumab population PK data. This developed semi-mechanistic population PK model had the same number of model parameters, produced very similar concentration-time profiles but provided additional biological insight to the FcRn-mediated IgG disposition in human subjects compared with the standard linear two-compartment linear PK model. This first reported semi-mechanistic model may serve as an important model framework for developing future population PK models of TMAbs in clinical patients. Copyright © 2015 John Wiley & Sons, Ltd.

  6. VULNERACIONES DE LA DIGNIDAD HUMANA AL FINAL DE LA VIDA

    OpenAIRE

    ROBERTO GERMÁN ZURRIARÁIN

    2017-01-01

    La muerte es constitutiva a la naturaleza humana y por ello tiene que acontecer de forma natural. Pero hay dos realidades que, principalmente, la falsifican: la eutanasia y la obstinación terapéutica. Dos opciones erróneas que no aceptan la realidad humana de la muerte (la primera adelantándola y la otra retrasándola). Desde el punto de vista filosófico y ético ambas son rechazadas, porque atentan contra la dignidad humana al final de la vida. Aparte de estas, en este artículo también se rech...

  7. FcγRIIIa expression on monocytes in rheumatoid arthritis: role in immune-complex stimulated TNF production and non-response to methotrexate therapy.

    Directory of Open Access Journals (Sweden)

    Dawn L Cooper

    Full Text Available OBJECTIVE: The expression of FcγRIIIa/CD16 may render monocytes targets for activation by IgG-containing immune complexes (IC. We investigated whether FcγRIIIa/CD16 was upregulated in rheumatoid arthritis (RA, associated with TNF production in response to IC-stimulation, and if this predicted response to methotrexate therapy. METHODS: FcγRIIIa/CD16 expression on CD14(low and CD14++ monocytes was measured by flow cytometry in healthy controls and RA patients (early and long-standing disease. Intracellular TNF-staining was carried out after in vitro LPS or heat-aggregated immunoglobulin (HAG activation. FcγRIIIa/CD16 expression pre- and post-steroid/methotrexate treatment was examined. RESULTS: Increased FcγRIIIa/CD16 expression on CD14++ monocytes in long-standing RA patients compared to controls was demonstrated (p = 0.002 with intermediate levels in early-RA patients. HAG-induced TNF-production in RA patients was correlated with the percentage of CD14++ monocytes expressing FcγRIIIa/CD16 (p<0.001. The percentage of CD14++ monocytes expressing FcγRIIIa/CD16 at baseline in early DMARD-naïve RA patients was negatively correlated with DAS28-ESR improvement 14-weeks post-methotrexate therapy (p = 0.003 and was significantly increased in EULAR non-responders compared to moderate (p = 0.01 or good responders (p = 0.003. FcγRIIIa/CD16 expression was not correlated with age, presence of systemic inflammation or autoantibody titers. CONCLUSION: Increased FcγRIIIa/CD16 expression on CD14++ monocytes in RA may result in a cell that has increased responsiveness to IC-stimulation. This monocyte subset may contribute to non-response to methotrexate therapy.

  8. FcγRIIIa Expression on Monocytes in Rheumatoid Arthritis: Role in Immune-Complex Stimulated TNF Production and Non-Response to Methotrexate Therapy

    Science.gov (United States)

    Cooper, Dawn L.; Martin, Stephen G.; Robinson, James I.; Mackie, Sarah L.; Charles, Christopher J.; Nam, Jackie; Consortium, YEAR; Isaacs, John D.; Emery, Paul; Morgan, Ann W.

    2012-01-01

    Objective The expression of FcγRIIIa/CD16 may render monocytes targets for activation by IgG-containing immune complexes (IC). We investigated whether FcγRIIIa/CD16 was upregulated in rheumatoid arthritis (RA), associated with TNF production in response to IC-stimulation, and if this predicted response to methotrexate therapy. Methods FcγRIIIa/CD16 expression on CD14low and CD14++ monocytes was measured by flow cytometry in healthy controls and RA patients (early and long-standing disease). Intracellular TNF-staining was carried out after in vitro LPS or heat-aggregated immunoglobulin (HAG) activation. FcγRIIIa/CD16 expression pre- and post-steroid/methotrexate treatment was examined. Results Increased FcγRIIIa/CD16 expression on CD14++ monocytes in long-standing RA patients compared to controls was demonstrated (p = 0.002) with intermediate levels in early-RA patients. HAG-induced TNF-production in RA patients was correlated with the percentage of CD14++ monocytes expressing FcγRIIIa/CD16 (p<0.001). The percentage of CD14++ monocytes expressing FcγRIIIa/CD16 at baseline in early DMARD-naïve RA patients was negatively correlated with DAS28-ESR improvement 14-weeks post-methotrexate therapy (p = 0.003) and was significantly increased in EULAR non-responders compared to moderate (p = 0.01) or good responders (p = 0.003). FcγRIIIa/CD16 expression was not correlated with age, presence of systemic inflammation or autoantibody titers. Conclusion Increased FcγRIIIa/CD16 expression on CD14++ monocytes in RA may result in a cell that has increased responsiveness to IC-stimulation. This monocyte subset may contribute to non-response to methotrexate therapy. PMID:22235253

  9. Surveillance for Intracellular Antibody by Cytosolic Fc Receptor TRIM21

    Directory of Open Access Journals (Sweden)

    William A. McEwan

    2016-11-01

    Full Text Available TRIM21 has emerged as an atypical Fc receptor that is broadly conserved and widely expressed in the cytoplasm of mammalian cells. Viruses that traffic surface-bound antibodies into the cell during infection recruit TRIM21 via a high affinity interaction between Fc and TRIM21 PRYSPRY domain. Following binding of intracellular antibody, TRIM21 acts as both antiviral effector and sensor for innate immune signalling. These activities serve to reduce viral replication by orders of magnitude in vitro and contribute to host survival during in vivo infection. Neutralization occurs rapidly after detection and requires the activity of the ubiquitin-proteasome system. The microbial targets of this arm of intracellular immunity are still being identified: TRIM21 activity has been reported following infection by several non-enveloped viruses and intracellular bacteria. These findings extend the sphere of influence of antibodies to the intracellular domain and have broad implications for immunity. TRIM21 has been implicated in the chronic auto-immune condition systemic lupus erythematosus and is itself an auto-antigen in Sjögren’s syndrome. This review summarises our current understanding of TRIM21’s role as a cytosolic Fc receptor and briefly discusses pathological circumstances where intracellular antibodies have been described, or are hypothesized to occur, and may benefit from further investigations of the role of TRIM21.

  10. Fcγ receptor-mediated inflammation inhibits axon regeneration.

    Directory of Open Access Journals (Sweden)

    Gang Zhang

    Full Text Available Anti-glycan/ganglioside antibodies are the most common immune effectors found in patients with Guillain-Barré Syndrome, which is a peripheral autoimmune neuropathy. We previously reported that disease-relevant anti-glycan autoantibodies inhibited axon regeneration, which echo the clinical association of these antibodies and poor recovery in Guillain-Barré Syndrome. However, the specific molecular and cellular elements involved in this antibody-mediated inhibition of axon regeneration are not previously defined. This study examined the role of Fcγ receptors and macrophages in the antibody-mediated inhibition of axon regeneration. A well characterized antibody passive transfer sciatic nerve crush and transplant models were used to study the anti-ganglioside antibody-mediated inhibition of axon regeneration in wild type and various mutant and transgenic mice with altered expression of specific Fcγ receptors and macrophage/microglia populations. Outcome measures included behavior, electrophysiology, morphometry, immunocytochemistry, quantitative real-time PCR, and western blotting. We demonstrate that the presence of autoantibodies, directed against neuronal/axonal cell surface gangliosides, in the injured mammalian peripheral nerves switch the proregenerative inflammatory environment to growth inhibitory milieu by engaging specific activating Fcγ receptors on recruited monocyte-derived macrophages to cause severe inhibition of axon regeneration. Our data demonstrate that the antibody orchestrated Fcγ receptor-mediated switch in inflammation is one mechanism underlying inhibition of axon regeneration. These findings have clinical implications for nerve repair and recovery in antibody-mediated immune neuropathies. Our results add to the complexity of axon regeneration in injured peripheral and central nervous systems as adverse effects of B cells and autoantibodies on neural injury and repair are increasingly recognized.

  11. LHC Civil Engineering Construction Contracts Cost Monitoring and Budget Forecasting

    CERN Document Server

    Skelton, K

    2000-01-01

    The Civil Engineering project for the LHC is estimated at 350 MCHF, of which about 316 MCHF is for the construction contracts. These contracts are based on a system of remeasurement whereby the consultant estimates the quantities required for the construction of each structure and the contractor commits himself to the unit price, which define the initial tender price. There are many factors that affect the final price for these contracts, from increases or decreases in quantities of the estimated amounts in the original bill of quantities to variations to the contract. This paper will look at how these factors change costs at the individual level of a structure to the overall costs of the contract. It will look at how the Civil Engineering Group monitors these changes to calculate cash flows and final costs and how this information is used as a basis for budget forecasts.

  12. A soluble form of the high affinity IgE receptor, Fc-epsilon-RI, circulates in human serum.

    Directory of Open Access Journals (Sweden)

    Eleonora Dehlink

    Full Text Available Soluble IgE receptors are potential in vivo modulators of IgE-mediated immune responses and are thus important for our basic understanding of allergic responses. We here characterize a novel soluble version of the IgE-binding alpha-chain of Fc-epsilon-RI (sFcεRI, the high affinity receptor for IgE. sFcεRI immunoprecipitates as a protein of ∼40 kDa and contains an intact IgE-binding site. In human serum, sFcεRI is found as a soluble free IgE receptor as well as a complex with IgE. Using a newly established ELISA, we show that serum sFcεRI levels correlate with serum IgE in patients with elevated IgE. We also show that serum of individuals with normal IgE levels can be found to contain high levels of sFcεRI. After IgE-antigen-mediated crosslinking of surface FcεRI, we detect sFcεRI in the exosome-depleted, soluble fraction of cell culture supernatants. We further show that sFcεRI can block binding of IgE to FcεRI expressed at the cell surface. In summary, we here describe the alpha-chain of FcεRI as a circulating soluble IgE receptor isoform in human serum.

  13. Fcγ1 fragment of IgG1 as a powerful affinity tag in recombinant Fc-fusion proteins: immunological, biochemical and therapeutic properties.

    Science.gov (United States)

    Soleimanpour, Saman; Hassannia, Tahereh; Motiee, Mahdieh; Amini, Abbas Ali; Rezaee, S A R

    2017-05-01

    Affinity tags are vital tools for the production of high-throughput recombinant proteins. Several affinity tags, such as the hexahistidine tag, maltose-binding protein, streptavidin-binding peptide tag, calmodulin-binding peptide, c-Myc tag, glutathione S-transferase and FLAG tag, have been introduced for recombinant protein production. The fragment crystallizable (Fc) domain of the IgG1 antibody is one of the useful affinity tags that can facilitate detection, purification and localization of proteins and can improve the immunogenicity, modulatory effects, physicochemical and pharmaceutical properties of proteins. Fcγ recombinant forms a group of recombinant proteins called Fc-fusion proteins (FFPs). FFPs are widely used in drug discovery, drug delivery, vaccine design and experimental research on receptor-ligand interactions. These fusion proteins have become successful alternatives to monoclonal antibodies for drug developments. In this review, the physicochemical, biochemical, immunological, pharmaceutical and therapeutic properties of recombinant FFPs were discussed as a new generation of bioengineering strategies.

  14. Non-turnkey contract

    International Nuclear Information System (INIS)

    Shimoyama, Shunji

    1975-01-01

    A turnkey contract is recommended to such a country which is in the initial stage of nuclear power development with respect to a few plants being constructed earlier. The prime contractor may not necessarily be a reactor supplier. In some cases an architect engineering company may be a contractor. If this arrangement is not possible and the contract had to be a non-turnkey type, there might be some advantage to such a developing country capable of undertaking some major portions of the project works. Even if she might face with troubles and difficulties during construction of the first nuclear power station, she might have chance of aquiring technical kowledge and experience which would later enable her to make the plant of her own manufacture. In such a case it is advisable to limit the number of main contracts as small as possible and to utilize an organization to assist the owner in project management or to assume this function in his behalf. (orig./FW) [de

  15. Activation-induced proteolysis of cytoplasmic domain of zeta in T cell receptors and Fc receptors.

    Science.gov (United States)

    Taupin, J L; Anderson, P

    1994-12-01

    The CD3-T cell receptor (TCR) complex on T cells and the Fc gamma receptor type III (Fc gamma RIII)-zeta-gamma complex on natural killer cells are functionally analogous activation receptors that associate with a family of disulfide-linked dimers composed of the related subunits zeta and gamma. Immunochemical analysis of receptor complexes separated on two-dimensional diagonal gels allowed the identification of a previously uncharacterized zeta-p14 heterodimer. zeta-p14 is a component of both CD3-TCR and Fc gamma RIII-zeta-gamma. Peptide mapping analysis shows that p14 is structurally related to zeta, suggesting that it is either: (i) derived from zeta proteolytically or (ii) the product of an alternatively spliced mRNA. The observation that COS cells transformed with a cDNA encoding zeta express zeta-p14 supports the former possibility. The expression of CD3-TCR complexes including zeta-p14 increases following activation with phorbol 12-myristate 13-acetate or concanavalin A, suggesting that proteolysis of zeta may contribute to receptor modulation or desensitization.

  16. Contribution of PIP-5 kinase Iα to raft-based FcγRIIA signaling

    International Nuclear Information System (INIS)

    Szymanska, Ewelina; Korzeniowski, Marek; Raynal, Patrick; Sobota, Andrzej; Kwiatkowska, Katarzyna

    2009-01-01

    Receptor FcγIIA (FcγRIIA) associates with plasma membrane rafts upon activation to trigger signaling cascades leading to actin polymerization. We examined whether compartmentalization of PI(4,5)P 2 and PI(4,5)P 2 -synthesizing PIP5-kinase Iα to rafts contributes to FcγRIIA signaling. A fraction of PIP5-kinase Iα was detected in raft-originating detergent-resistant membranes (DRM) isolated from U937 monocytes and other cells. The DRM of U937 monocytes contained also a major fraction of PI(4,5)P 2 . PIP5-kinase Iα bound PI(4,5)P 2 , and depletion of the lipid displaced PIP5-kinase Iα from the DRM. Activation of FcγRIIA in BHK transfectants led to recruitment of the kinase to the plasma membrane and enrichment of DRM in PI(4,5)P 2 . Immunofluorescence studies revealed that in resting cells the kinase was associated with the plasma membrane, cytoplasmic vesicles and the nucleus. After FcγRIIA activation, PIP5-kinase Iα and PI(4,5)P 2 co-localized transiently with the activated receptor at distinct cellular locations. Immunoelectron microscopy studies revealed that PIP5-kinase Iα and PI(4,5)P 2 were present at the edges of electron-dense assemblies containing activated FcγRIIA in their core. The data suggest that activation of FcγRIIA leads to membrane rafts coalescing into signaling platforms containing PIP5-kinase Iα and PI(4,5)P 2

  17. Gestión educativa y ética profesional de los docentes de la Red 03, UGEL 05 de San Juan de Lurigancho, 2015

    OpenAIRE

    Soto Curo, Lisbeth Maritza

    2016-01-01

    El presente trabajo de investigación tiene como objetivo general determinar de qué manera hay una relación entre gestión educativa y ética profesional de los docentes de la Red 03, UGEL 05 de San Juan de Lurigancho, 2015 la muestra consideró una parte de la población, en los cuales se ha utilizado la variable: gestión educativa y ética profesional. El tipo de investigación fue básica, enfoque cuantitativo, método hipotético deductivo, diseño no experimental corte transeccional ...

  18. Crop coefficient and water consumption of eggplant in no-tillage system and conventional soil preparation Coeficiente de cultura e consumo hídrico da berinjela em sistema de plantio direto e de preparo convencional do solo

    Directory of Open Access Journals (Sweden)

    Daniel F. de Carvalho

    2012-08-01

    Full Text Available Under organic management in Seropédica-RJ, Brazil, using a weighing lysimeter, the crop coefficients (kc, the maximum evapotranspiration and the productivity of eggplant cultivation under two cropping systems (no tillage with straw plus soil with conventional preparation were determined. A whole randomized layout with two treatments (no tillage and conventional and five replicates during 134 days of cultivation were adopted. There were no significant differences in the eggplant cultivation in the two cropping systems, with a maximum commercial productivity obtained from 47.42 Mg ha-1 for the no-tillage system, and 47.91 Mg ha-1 for the conventional tillage. The accumulated ETc was 285.15 and 323.44 mm for the no-tillage and conventional, respectively. The crop coefficients value for the phases: 1 - transplanting, flowering, 2 - flowering-fruiting, 3 - fruit- first harvesting, 4- first harvesting of the final crop cycle was 0.83, 0.77, 0.90 and 0.97 in no-tillage system for the respective phases and for the conventional one 0.81, 1.14, 1.17 and 1.05 for the same steps described above.Sob manejo orgânico, foram determinados em Seropédica-RJ, utilizando lisímetro de pesagem, os coeficientes de cultura (kc, a evapotranspiração máxima e a produtividade da cultura da berinjela, em dois sistemas de cultivo (plantio direto com adição de palha e em solo com o preparo convencional. Foi adotado o delineamento inteiramente casualizado, com dois tratamentos (plantio direto e convencional e com cinco repetições, durante 134 dias de cultivo. Não houve diferenças significativas na produtividade da cultura da berinjela nos dois sistemas de cultivo, sendo a produtividade comercial máxima obtida de 47,42 Mg ha-1, para o sistema de plantio direto, e de 47,91 Mg ha-1, para o sistema de plantio convencional. A ETc acumulada foi de 285,15 e 323,44 mm, para o sistema de plantio direto e plantio convencional, respectivamente. Os valores de coeficiente de

  19. Analisis y estudio del contenido de humedad final de la madera

    Directory of Open Access Journals (Sweden)

    Eduardo Gómez Ihmaidan

    2006-07-01

    Full Text Available La finalidad de este trabajo es proporcionar e interactuar con la  información referente al  proceso de secado industrial de Pino Radiata, tomando como variable el contenido de humedad final de la madera, en términos generales esta información será útil para negociar y tomar decisiones frente a  clientes que demandan por productos con ciertas especificaciones técnicas, cuantificando además los costos en que se incurre por estar fuera de los parámetros solicitados. La primera parte de este trabajo consistió en la recolección de datos del contenido de humedad final de los principales productos de Aserraderos Arauco S.A., los que fueron tomados manualmente por personal de la empresa con equipos xilohigrómetros de marca Wagner L612 y medidores automatizados en línea Brookhuis.  Con estos datos, el histograma fue la herramienta gráfica que permitió el ajuste de curvas de las distribuciones de probabilidad de cada producto utilizando el software @Risk  4.5, con esta información se procedió a buscar las funciones de probabilidad acumulada respectivas, y además aproximaciones matemáticas que permitieran el cálculo de éstas para conocer la probabilidad de estar entre un mínimo y un máximo de contenido de humedad. Para evaluar la variabilidad y tendencia central del contenido de humedad se procedió a calcular mediante los índices de la capacidad de procesos Cp y Cpk en qué medida el proceso de secado es capaz de cumplir con las especificaciones solicitadas por el cliente, debido a que los datos no presentaban un comportamiento normal fue necesario investigar y encontrar el cálculo de estos índices de capacidad para este caso. Otro aspecto importante considerado en este trabajo fue la incorporación de la función de Costo de Calidad del Dr. Taguchi en la cuál se evalúa monetáriamente todos los costos en que se incurre cuando el producto no satisface las especificaciones del cliente, ya sea productos demasiado h

  20. Hydrogen absorption in Mg1.95Ti0.05Ni0.95Cu0.05 alloy prepared with mechanical alloying and thermal treatment; Absorcion de hidrogeno en la aleacion Mg1.95Ti0.05Ni0.95Cu0.05 preparada por aleado mecanico y tratamiento termico

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Juan Bonifacio; Urena Nunez, Fernando [Instituto Nacional de Investigaciones Nucleares, Ocoyoacac, Estado de Mexico (Mexico)]. E-mail: juan.bonifacio@inin.gob.mx

    2009-09-15

    This work presents hydrogen absorption in quaternary alloy Mg1.95Ti0.05Ni0.95Cu0.05 obtained by the mechanical alloying method, followed by thermal treatment in ultra-high pure argon atmosphere. The composition of the phases, microstructure and morphology of ground powders and with thermal treatment were characterized by DRX, SEM/EDS and TEM. After 20 hours of mechanical grinding and recooked at 300 degrees Celsius/1h in argon atmosphere, the quaternary alloy has a Mg{sub 2}Ni crystalline hexagonal structure with a crystallite size under 10 nm. The absorption measurements were performed under a pressure of 0.2 to 1.2 MPa at a temperature of 200 degrees Celsius in a micro-reactor. The quantification of absorption-desorption of hydrogen in the intermetallic was conducted in a TGA-DSC simultaneous calorimeter. Metallic hydride-dehydride powder was characterized with SEM and XRD. [Spanish] En este trabajo se presenta la absorcion de hidrogeno en la aleacion cuaternaria Mg1.95Ti0.05Ni0.95Cu0.05 obtenida por el metodo de aleado mecanico, seguida de tratamiento termico en atmosfera de argon de ultra alta pureza. La composicion de las fases, microestructura y morfologia de los polvos molidos y con tratamiento termico fue caracterizada por DRX, SEM/EDS y TEM. Despues de 20 h de molienda mecanica con recocido a 300 grados Celsios/1h en atmosfera de argon, la aleacion cuaternaria tiene una estructura cristalina hexagonal Mg{sub 2}Ni con tamano de cristalito menor a 10 nm. Las mediciones de absorcion fueron realizadas bajo una presion de 0.2 a 1.2 MPa a una temperatura de 200 grados Celsios en un micro-reactor. La cuantificacion de absorcion-desorcion de hidrogeno en el intermetalico se realizo en un calorimetro simultaneo TGA-DSC. Se determino que la cantidad maxima absorbida de hidrogeno en la aleacion cuaternaria fue de 3.24% en peso cuando la presion fue de 0.8 MPa a dicha temperatura. Polvos metalicos hidrurados-deshidrurados se caracterizaron por SEM y XRD.

  1. Role of polymorphic Fc receptor Fc gammaRIIa in cytokine release and adverse effects of murine IgG1 anti-CD3/T cell receptor antibody (WT31).

    Science.gov (United States)

    Tax, W J; Tamboer, W P; Jacobs, C W; Frenken, L A; Koene, R A

    1997-01-15

    Anti-CD3 monoclonal antibody (mAb) OKT3 is immunosuppressive, but causes severe adverse effects during the first administration ("first-dose reaction"). These adverse effects are presumably caused by cytokine release that results from T-cell activation. In vitro, T-cell activation by anti-CD3 mAb requires interaction with monocyte Fc receptors. The Fc receptor for murine IgG1, Fc gammaRIIa, is polymorphic. In some individuals, murine IgG1 anti-CD3 mAb causes T-cell proliferation and cytokine release in vitro (high responders [HR]), whereas in individuals with the low-responder (LR) phenotype it does not. We have now investigated the role of this Fc gammaRIIa polymorphism in the release of cytokines in vivo and the occurrence of adverse effects after the administration of WT31, a murine IgG1 anti-CD3/T cell receptor mAb. WT31 caused an increase of plasma tumor necrosis factor-alpha in all four HR patients and none of the five LR patients. In all HR patients except one, plasma gamma-interferon and interleukin 6 also increased, and a first-dose response was observed, whereas no cytokine release or adverse effects occurred in any of the LR patients. WT31 caused lymphopenia in all HR and none of the LR patients. FACS analysis demonstrated that in HR patients, after the initial disappearance of CD3+ cells from peripheral blood, modulation of CD3 occurred, whereas in LR patients a high degree of coating of the lymphocytes was observed. Surprisingly, WT31 also induced a marked granulocytopenia, as well as a decrease of thrombocytes, in three of the four HR patients (and in none of the LR patients). These data provide direct clinical evidence that Fc receptor interaction determines the release of cytokines and the occurrence of adverse effects after administration of anti-CD3/T cell receptor mAb. Furthermore, these data suggest that tumor necrosis factor-alpha by itself is not sufficient to induce the first-dose reaction.

  2. Preparation and Characterization of FC Films Coated on PET Substrates by RF Magnetron Sputtering

    Directory of Open Access Journals (Sweden)

    Huang Mei-lin

    2018-01-01

    Full Text Available Fluorocarbon (FC films were prepared on polyethylene terephthalate (PET plates and PET fabrics respectively by a radiofrequency (RF magnetron sputtering technique using polytetrafluoroethylene (PTFE as a target. Scanning electron microscope and X-ray photoelectron spectroscopy were used to investigate the morphology, structure and composition of the obtained FC films. The hydrophobicity and uvioresistant properties of the FC film coated fabric were studied. The results show that the FC films were successfully deposited on the PET substrates by a RF magnetron sputtering. The deposited films are made up of four components -CF3, -CF2-, CF- and -C-. The proportions of the four components and surface morphologies of the deposited films vary with the sputtering conditions. Compared with the original fabric samples, the hydrophobicity of the FC film coated fabrics is quite good and improved significantly.

  3. EL PAPEL DE LA NEGOCIACIÓN COLECTIVA EN LA REGULACIÓN DE LA CONTRATACIÓN TEMPORAL EN ESPAÑA Y SU EFICACIA

    Directory of Open Access Journals (Sweden)

    Rodrigo Ignacio Palomo Vélez

    2008-01-01

    Full Text Available El presente trabajo analiza el papel de la negociación colectiva en la regulación de la contratación temporal en España, luego de las reformas laborales que desde la década de los noventa han venido refiriéndose a esta materia. El enfoque está centrado, de esta forma, en dar cuenta de la función que ha tenido y tiene la negociación colectiva en la regulación de los principales supuestos legales de contratación temporal de trabajadores; a saber, el contrato para obra o servicio determinados, el contrato eventual por circunstancias de la producción y el contrato de trabajadores interinos, por ser estos los de mayor presencia en el sistema español de relaciones laborales y por constituir el objeto preferente de las diversas remisiones que el legislador laboral ha hecho a la negociación colectiva. Por tanto, no se trata en este trabajo el supuesto de contratación temporal coyuntural que aún subsiste en el ordenamiento español (contrato de fomento de empleo para trabajadores con discapacidad ni otros supuestos específicos de contratación temporal (contratos formativos, contratos de relevo, contratos temporales por empresas de trabajo temporal, contratos temporales en las administraciones públicas, entre otros. Se estudian también los mecanismos de control de la contratación temporal en la negociación colectiva, y en este caso las referencias se plantean, salvo prevención en contrario, sin distinguir entre las distintas modalidades contractuales. Por último, se presenta un contrapunto con el modelo normativo chileno.This work analyzes the role of collective bargaining in the temporary contracting regulation in Spain, after the labour reforms that, since the nineties, have been referring to this matter. Thus, the approach is focused into give account of the function that the collective bargaining has been and has, in the main legal suppositions of the temporary contracting workers' regulation; namely, the determined work or

  4. Investigating the Interaction between the Neonatal Fc Receptor and Monoclonal Antibody Variants by Hydrogen/Deuterium Exchange Mass Spectrometry

    DEFF Research Database (Denmark)

    Jensen, Pernille Foged; Larraillet, Vincent; Schlothauer, Tilman

    2015-01-01

    The recycling of immunoglobulins by the neonatal Fc receptor (FcRn) is of crucial importance in the maintenance of antibody levels in plasma and is responsible for the long half-lives of endogenous and recombinant monoclonal antibodies. From a therapeutic point of view there is great interest...... in understanding and modulating the IgG-FcRn interaction to optimize antibody pharmacokinetics and ultimately improve efficacy and safety. Here we studied the interaction between a full-length human IgG1 and human FcRn via hydrogen/deuterium exchange mass spectrometry and targeted electron transfer dissociation...... to map sites perturbed by binding on both partners of the IgG-FcRn complex. Several regions in the antibody Fc region and the FcRn were protected from exchange upon complex formation, in good agreement with previous crystallographic studies of FcRn in complex with the Fc fragment. Interestingly, we found...

  5. Antibody glycosylation and its impact on the pharmacokinetics and pharmacodynamics of monoclonal antibodies and Fc-fusion proteins.

    Science.gov (United States)

    Liu, Liming

    2015-06-01

    Understanding the impact of glycosylation and keeping a close control on glycosylation of product candidates are required for both novel and biosimilar monoclonal antibodies (mAbs) and Fc-fusion protein development to ensure proper safety and efficacy profiles. Most therapeutic mAbs are of IgG class and contain a glycosylation site in the Fc region at amino acid position 297 and, in some cases, in the Fab region. For Fc-fusion proteins, glycosylation also frequently occurs in the fusion partners. Depending on the expression host, glycosylation patterns in mAb or Fc-fusions can be significantly different, thus significantly impacting the pharmacokinetics (PK) and pharmacodynamics (PD) of mAbs. Glycans that have a major impact on PK and PD of mAb or Fc-fusion proteins include mannose, sialic acids, fucose (Fuc), and galactose (Gal). Mannosylated glycans can impact the PK of the molecule, leading to reduced exposure and potentially lower efficacy. The level of sialic acid, N-acetylneuraminic acid (NANA), can also have a significant impact on the PK of Fc-fusion molecules. Core Fuc in the glycan structure reduces IgG antibody binding to IgG Fc receptor IIIa relative to IgG lacking Fuc, resulting in decreased antibody-dependent cell-mediated cytotoxicity (ADCC) activities. Glycoengineered Chinese hamster ovary (CHO) expression systems can produce afucosylated mAbs that have increased ADCC activities. Terminal Gal in a mAb is important in the complement-dependent cytotoxicity (CDC) in that lower levels of Gal reduce CDC activity. Glycans can also have impacts on the safety of mAb. mAbs produced in murine myeloma cells such as NS0 and SP2/0 contain glycans such as Galα1-3Galβ1-4N-acetylglucosamine-R and N-glycolylneuraminic acid (NGNA) that are not naturally present in humans and can be immunogenic when used as therapeutics. © 2015 Wiley Periodicals, Inc. and the American Pharmacists Association.

  6. Imaging and measuring the biophysical properties of Fc gamma receptors on single macrophages using atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mi [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Lianqing, E-mail: lqliu@sia.cn [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xi, Ning [Department of Mechanical and Biomedical Engineering, City University of Hong Kong, Hong Kong (China); Wang, Yuechao [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xiao, Xiubin [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China); Zhang, Weijing, E-mail: zhangwj3072@163.com [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China)

    2013-09-06

    Highlights: •Nanoscale cellular ultra-structures of macrophages were observed. •The binding affinities of FcγRs were measured directly on macrophages. •The nanoscale distributions of FcγRs were mapped on macrophages. -- Abstract: Fc gamma receptors (FcγR), widely expressed on effector cells (e.g., NK cells, macrophages), play an important role in clinical cancer immunotherapy. The binding of FcγRs to the Fc portions of antibodies that are attached to the target cells can activate the antibody-dependent cell-mediated cytotoxicity (ADCC) killing mechanism which leads to the lysis of target cells. In this work, we used atomic force microscopy (AFM) to observe the cellular ultra-structures and measure the biophysical properties (affinity and distribution) of FcγRs on single macrophages in aqueous environments. AFM imaging was used to obtain the topographies of macrophages, revealing the nanoscale cellular fine structures. For molecular interaction recognition, antibody molecules were attached onto AFM tips via a heterobifunctional polyethylene glycol (PEG) crosslinker. With AFM single-molecule force spectroscopy, the binding affinities of FcγRs were quantitatively measured on single macrophages. Adhesion force mapping method was used to localize the FcγRs, revealing the nanoscale distribution of FcγRs on local areas of macrophages. The experimental results can improve our understanding of FcγRs on macrophages; the established approach will facilitate further research on physiological activities involved in antibody-based immunotherapy.

  7. Análisis de la respuesta cardiaca de árbitros de fútbol en competición: estudio de caso.

    Directory of Open Access Journals (Sweden)

    Daniel Castillo Alvira

    2015-05-01

    Full Text Available Los objetivos de este estudio fueron, por un lado, examinar la respuesta cardiaca de un árbitro de fútbol tanto durante un test de campo incremental como durante dos partidos en un torneo nacional de categoría cadete, y por otro lado, determinar las zonas de intensidad del árbitro durante los partidos atendiendo a su FCmax individual. Un árbitro de fútbol de categoría nacional fue equipado con un pulsómetro (Polar Electro Oy, Kempele, Finlandia y su FC fue monitorizada durante la realización del Yo-Yo de recuperación intermitente nivel 1 (YYIR1 y durante dos partidos de un Torneo de Fútbol de categoría cadete. Las zonas de intensidad se establecieron atendiendo a la clasificación de Edwards (1993. La FCmax obtenida en el YYIR1 y en los partidos fue de 178 ppm y 161 ppm, respectivamente. Durante los partidos la FCmed registrada fue de 127 ± 1,03 ppm que corresponde a un 71,3% de la FCmax obtenida en el YYIR1. La distribución de la frecuencia cardiaca atendiendo a las zonas establecidas es la siguiente: 10 ± 1,95% (zona 1, 32 ± 1,65% (zona 2, 38 ± 5,14% (zona 3, 19 ± 4,31% (zona 4 y 1 ± 0,53% (zona 5. Los resultados obtenidos nos muestran que la FC más alta alcanzada en partidos de categoría cadete es inferior a la alcanzada en el YYIR1. Además, se observa que la carga interna, medida mediante FC obtenida en partidos, es inferior a la reportada en otros estudios con árbitros en partidos de categoría sénior.

  8. Unusual ZFC and FC magnetic behavior in thin Co multi-layered structure

    Energy Technology Data Exchange (ETDEWEB)

    Ben-Dor, Oren; Yochelis, Shira [Department of Applied Physics, Center of Nanoscience and Nanotechnology, Hebrew University, Jerusalem 91904 (Israel); Felner, Israel [Racah Institute of Physics, Hebrew University, Jerusalem 91904 (Israel); Paltiel, Yossi [Department of Applied Physics, Center of Nanoscience and Nanotechnology, Hebrew University, Jerusalem 91904 (Israel)

    2017-04-15

    The observation of unusual magnetic phenomena in a Ni -based magnetic memory device ( O. Ben-Dor et al., 2013) encouraged us to conduct a systematic research on Co based multi-layered structure which contains a α-helix L polyalanine (AHPA-L) organic compound. The constant Co thickness is 7 nm and AHPA-L was also replaced by non-chiral 1-Decanethiol organic molecules. Both organic compounds were chemisorbed on gold by a thiol group. The dc magnetic field (H) was applied parallel and perpendicular to the surface layers. The perpendicular direction is the easy magnetization axis and along this orientation only, the zero-field-cooled (ZFC) plots exhibit a pronounced peak around 55–58 K. This peak is suppressed in the second ZFC and field-cooled (FC) runs performed shortly after the virgin ZFC one. Thus, around the peak position ZFC>FC a phenomenon seldom observed. This peak reappears after measuring the same material six months later. This behavior appears in layers with the non-chiral 1-Decanethiol and it is very similar to that obtained in sulfur doped amorphous carbon. The peak origin and the peculiar ZFC>FC case are qualitatively explained. - Highlights: • FC curve crosses ZFC curve in a 7 nm Co and thiol-based organic molecules multi-layered structure. • The ZFC>FC phenomena occurs for H perpendicular along the easy axis. • This phenomenon disappears in the second FC-ZFC run performed shortly after. • The unusual behavior reappears after six months.

  9. Controlling DIII-D QH-Mode Particle and Electron Thermal Transport with ECH

    Science.gov (United States)

    Ernst, D. R.; Burrell, K. H.; Rhodes, T. L.; Guttenfelder, W.; McKee, G. R.; Grierson, B. A.; Holland, C.; Dimits, A.; Petty, C. C.; Schmitz, L.; Wang, G.; Zeng, L.; Doyle, E. J.; Austin, M. E.

    2014-10-01

    Quiescent H-mode core particle transport and density peaking are locally controlled by modulated electron cyclotron heating (ECH) at ρ ~ 0 . 2 . Gyrokinetic simulations show density gradient driven trapped electron modes (TEMs) are only unstable in the inner core, where the density profile flattens in response to ECH. Thus α-heating could reduce density peaking, providing burn control. Density fluctuations from Doppler backscattering intensify at TEM wavenumbers kθρs ~ 0 . 8 during ECH, while new quasi-coherent modes are observed with adjacent toroidal mode numbers consistent with TEMs. Separately, ECH at two-deposition locations (r / a ~ ρ = 0 . 5 & 0.7) varied the electron temperature gradient. A jump in ``heat pulse'' diffusivity during the scan indicates a critical gradient was crossed. Work supported by the US DOE under DE-FC02-08ER54966, DE-FC02-04ER54698, DE-FG02-08ER54984, DE-AC02-09CH11466, DE-FG02-89ER53296, DE-FC02-11ER55104, DE-AC52-07NA27344 & DE-FG03-97ER54415.

  10. Psychosocial aspects of work and musculoskeletal disorders in nursing workers Aspectos psicosociales del trabajo y disturbio músculo-esquelético en trabajadores de enfermería Aspectos psicossociais do trabalho e distúrbio musculoesquelético em trabalhadores de enfermagem

    Directory of Open Access Journals (Sweden)

    Tânia Solange Bosi de Souza Magnago

    2010-06-01

    Full Text Available This study aimed to evaluate the association between psychological demands and control on work and the occurrence of musculoskeletal disorders among nursing workers. This cross-sectional study involved 491 nursing workers from a University hospital in Rio Grande do Sul. Brazilian versions of the Nordic Musculoskeletal Questionnaire and the Job Content Questionnaire were used. Among the participants, 96.3% reported some pain in any given part of the body last year, 73.1% in the last seven days and 65.8% reported difficulty in their daily routine. The chances of shoulder pain (OR=1.97; CI95%=1.07-3.64, in the thoracic spine (OR=1.83; CI95%=1.02-3.35 and in the ankles (OR=2.05; CI95%=1.05-4.02 were higher in the high work demand quadrant when compared to the low demand quadrant, after adjustments for potentially confusing factors Intervention measures in the organizational structure are needed, redefining demand levels and control at work.Este estudio tuvo evaluar la asociación entre demandas psicológicas y el control sobre el trabajo y la ocurrencia de disturbio músculo-esqueléticos en trabajadores de enfermería. Se trata de un estudio transversal, envolviendo 491 trabajadores de enfermería de un hospital universitario en Rio Grande del Sur, en Brasil. Se utilizaron las versiones brasileñas del Nordic Musculoskeletal Questionnaire e del Job Content Questionnaire. De los participantes, 96,3% refirieron dolor en alguna región del cuerpo en el último año, 73,1 % en los últimos siete días y 65,8% relataron dificultades en las actividades diarias. Las probabilidades de dolor fueron: en los hombros (OR=1,97; IC95%=1,07-3,64, en la columna torácica (OR=1,83; IC95%=1,02-3,35 y en los tobillos (OR=2,05; IC95%=1,05-4,02; fueron mayores en el cuadrante de trabajo con alta exigencia si comparado al de baja exigencia, después del ajuste por potenciales factores de confusión. Es necesario adoptar medidas de intervención en la estructura

  11. Importance of the development of a data base on final uses of energy in the domestic sector; Importancia del desarrollo de una base de datos de usos finales de energia en el sector domestico

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez Ramos, Itha [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2001-07-01

    The saving and rational use of the energy is integral part of our life. This concept is seen already reflected in economic, technological, social and environmental factors in our country. The options of energy saving are seen like an alternative of investment as much for the user as for the electrical companies; nevertheless, to determine the saving potential in a sector it is necessary to understand how and for what purpose is the energy used. The domestic sector in our country consumes more than 20% of the demanded electrical energy and exist several factors that can cause that this percentage is increased. In spite of this, there is a great potential of energy saving in this sector, nevertheless specialized studies are required on the final uses of energy. But to be able to make these studies it is necessary to have a great amount of data on energy, climatologic, economic and financial, and social type. If these were found in a single data base, they could be used to plan, implement, evaluate and improve energy saving programs. This article focuses towards the importance of the knowledge of the real final uses of electrical energy in the domestic sector and presents as a result the conformation of a data base of household-electric final uses of electrical energy as well as the development of a tool that takes advantage of this data base to evaluate measures of change of equipment for a more efficient one. [Spanish] El ahorro y uso racional de la de energia es parte integral de nuestra vida. Este concepto se ve ya reflejado en factores economicos, tecnologicos, sociales y ambientales en nuestro pais. Las opciones de ahorro de energia son vistas como una alternativa de inversion tanto para el usuario como para las empresas electricas; sin embargo, para determinar el potencial de ahorro en un sector es necesario entender como y para que se emplea la energia. El sector domestico en nuestro pais consume mas del 20% de la energia electrica demandada y existen varios

  12. Maternal immunization with ovalbumin prevents neonatal allergy development and up-regulates inhibitory receptor FcγRIIB expression on B cells

    Directory of Open Access Journals (Sweden)

    Duarte Alberto JS

    2010-03-01

    Full Text Available Abstract Background Preconception allergen immunization prevents neonatal allergen sensitization in mice by a complex interaction between regulatory cells/factors and antibodies. The present study assessed the influence of maternal immunization with ovalbumin (OVA on the immune response of 3 day-old and 3 week-old offspring immunized or non-immunized with OVA and evaluated the effect of IgG treatment during fetal development or neonatal period. Results Maternal immunization with OVA showed increased levels of FcγRIIb expression in splenic B cells of neonates, which were maintained for up to 3 weeks and not affected by additional postnatal OVA immunization. Maternal immunization also exerted a down-modulatory effect on both IL-4 and IFN-γ-secreting T cells and IL-4 and IL-12- secreting B cells. Furthermore, immunized neonates from immunized mothers showed a marked inhibition of antigen-specifc IgE Ab production and lowered Th2/Th1 cytokine levels, whereas displaying enhanced FcγRIIb expression on B cells. These offspring also showed reduced antigen-specific proliferative response and lowered B cell responsiveness. Moreover, in vitro evaluation revealed an impairment of B cell activation upon engagement of B cell antigen receptor by IgG from OVA-immunized mice. Finally, in vivo IgG transference during pregnancy or breastfeeding revealed that maternal Ab transference was able to increase regulatory cytokines, such as IL-10, in the prenatal stage; yet only the postnatal treatment prevented neonatal sensitization. None of the IgG treatments induced immunological changes in the offspring, as it was observed for those from OVA-immunized mothers. Conclusion Maternal immunization upregulates the inhibitory FcγRIIb expression on offspring B cells, avoiding skewed Th2 response and development of allergy. These findings contribute to the advancement of prophylactic strategies to prevent allergic diseases in early life.

  13. Microbiological quality of drinking water of urban and rural communities, Brazil Qualidade microbiológica de água potável de comunidades urbanas e rurais, Paraná

    Directory of Open Access Journals (Sweden)

    Giovani Nogueira

    2003-04-01

    Full Text Available OBJECTIVE: To evaluate the microbiological quality of treated and untreated water samples came from urban and rural communities and to examine the relationship between coliforms occurrence and average water temperature, and a comparison of the rainfall levels. METHODS: A sample of 3,073 untreated and treated (chlorinated water from taps (1,594, reservoir used to store treated water (1,033, spring water (96 and private well (350 collected for routine testing between 1996 and 1999 was analyzed by the multiple dilution tube methods used to detect the most probable number of total and fecal coliforms. These samples were obtained in the region of Maringá, state of Paraná, Brazil. RESULTS: The highest numbers water samples contaminated by TC (83% and FC (48% were found in the untreated water. TC and FC in samples taken from reservoirs used to store treated water was higher than that from taps midway along distribution lines. Among the treated water samples examined, coliform bacteria were found in 171 of the 1,033 sampling reservoirs. CONCLUSIONS: Insufficient treatment or regrowth is suggested by the observation that more than 17% of these treated potable water contained coliform. TC and FC positive samples appear to be similar and seasonally influenced in treated water. Two different periods must be considered for the occurrence of both TC and FC positive samples: (i a warm-weather period (September-March with high percentage of contaminated samples; and (ii cold-weather period (April-August were they are lower. Both TC and TF positive samples declined with the decreased of water temperature.OBJETIVO: Avaliar a qualidade microbiológica de amostras de água tratada e não-tratada proveniente de comunidades urbanas e rurais e examinar a relação entre ocorrência de coliformes e a média de temperatura da água, e uma comparação dos níveis de precipitação de chuva. MÉTODOS: No período de 1996 a 1999, foram analisadas 3.073 amostras de

  14. AREVA T and D wins de-icing contract in Quebec

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2005-04-01

    The ice storm that struck Quebec in the winter of 1998 left millions of people without electricity because the accumulation of ice caused the collapse of hundreds of kilometres of high-voltage transmission lines and thousands of transmission towers. In order to optimize the security of its power grid, Hydro-Quebec contracted AREVA T and D to construct and install HVDCice{sup TM}, a transmission line de-icing system based on high-voltage direct current (HVDC) technology. The system is intended to ensure maximum electrical efficiency and guarantee a secure electricity supply. The system will generate up to 7200A of direct current in the transmission lines. This will raise their temperature thereby allowing the ice to melt and fall off. The system will be implemented at the Levis substation, a major connection point for the transmission lines of the province. The system also acts as a Static Var Compensator (SVC) to improve the power quality of the transmission network. The SVC will stabilize the voltage on the 735 kV power grid, which can fluctuate depending on the amount of electricity being consumed. This is the world's first HVDC-based de-icing and power quality system. The contract awarded to AREVA's T and D division is estimated at 25 million Euros. 1 fig.

  15. Instructive for disposal of fluorescent; Instructivo de desecho de fluorescentes

    Energy Technology Data Exchange (ETDEWEB)

    Salazar Vargas, Gerlin

    2014-07-01

    An instructive is established for the management system of waste fluorescent lamps, ensuring the storage, collection, transportation, and final disposal. The lamp is changed by an official of the Seccion de Matenimiento Construccion of the Oficina de Servicios Generales or is produced with the support of an official of the unit. The fluorescent should be deposited in stock of materials of the building maintenance section or unit specified with the help of a staff and in appropriate conditions. The fluorescent lamp is transported according to the guidelines in the manual. A responsible company is contracted by la Vicerrectoria de Administracion of the Universidad de Costa Rica dedicated to the transport and proper handling of fluorescent lamps [Spanish] Un instructivo es establecido para el sistema de manejo de las lamparas fluorescentes de desecho, garantizando el almacenamiento, recoleccion, transporte, y disposicion final. La lampara es cambiada por un funcionario de la Seccion de Mantenimiento Construccion de la Oficina de Servicios Generales o es realizado con el apoyo de un funcionario de la Unidad. El fluorescente debe ser depositado en el almacen de materiales de la seccion de mantenimiento y construccion o en la unidad especifica con la ayuda de un funcionario y en condiciones adecuadas. La lampara fluorescente es transportada segun las pautas establecidas en el manual. Una empresa responsable es contratada por la Vicerrectoria de Administracion de la Universidad de Costa Rica dedicada al transporte y manejo adecuado de las lamparas fluorescentes.

  16. Adverse or acceptable: negotiating access to a post-apartheid health care contract.

    Science.gov (United States)

    Harris, Bronwyn; Eyles, John; Penn-Kekana, Loveday; Thomas, Liz; Goudge, Jane

    2014-05-15

    As in many fragile and post-conflict countries, South Africa's social contract has formally changed from authoritarianism to democracy, yet access to services, including health care, remains inequitable and contested. We examine access barriers to quality health services and draw on social contract theory to explore ways in which a post-apartheid health care contract is narrated, practiced and negotiated by patients and providers. We consider implications for conceptualizing and promoting more inclusive, equitable health services in a post-conflict setting. Using in-depth interviews with 45 patients and 67 providers, and field observations from twelve health facilities in one rural and two urban sub-districts, we explore access narratives of those seeking and delivering - negotiating - maternal health, tuberculosis and antiretroviral services in South Africa. Although South Africa's right to access to health care is constitutionally guaranteed, in practice, a post-apartheid health care contract is not automatically or unconditionally inclusive. Access barriers, including poverty, an under-resourced, hierarchical health system, the nature of illness and treatment, and negative attitudes and actions, create conditions for insecure or adverse incorporation into this contract, or even exclusion (sometimes temporary) from health care services. Such barriers are exacerbated by differences in the expectations that patients and providers have of each other and the contract, leading to differing, potentially conflicting, identities of inclusion and exclusion: defaulting versus suffering patients, uncaring versus overstretched providers. Conversely, caring, respectful communication, individual acts of kindness, and institutional flexibility and leadership may mitigate key access barriers and limit threats to the contract, fostering more positive forms of inclusion and facilitating easier access to health care. Building health in fragile and post-conflict societies requires

  17. A novel activating chicken IgY FcR is related to leukocyte receptor complex (LRC)

    NARCIS (Netherlands)

    Viertlboeck, B.C.; Schmitt, R.; Hanczaruk, M.A.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Gobel, T.W.

    2009-01-01

    FcRs have multifaceted roles in the immune system. Chicken FcRs were demonstrated on macrophages decades ago; however, only recently the chicken Ig-like receptor AB1, encoded in the leukocyte receptor complex, was molecularly identified as a high-affinity FcR. The present study was initiated to

  18. La terminación de políticas y organizaciones públicas. El caso de la extinción de Luz y Fuerza del Centro en México

    Directory of Open Access Journals (Sweden)

    Jesús Rubio Campos

    2016-05-01

    Full Text Available Esta investigación analiza los modelos y estrategias utilizadas durante el proceso de terminación de políticas públicas, tema que ha sido poco estudiado hasta el momento. Para cumplir con dicho objetivo, se decidió utilizar un estudio de caso instrumental, el de la extinción de Luz y Fuerza del Centro (LyFC en México, a fin de identificar variables y su comportamiento en los patrones de terminación que sirvan de marco de análisis para casos similares. Los marcos teóricos sobre la terminación de políticas y organizaciones públicas descritos en la literatura sobre el tema resultaron muy apropiados para explicar el proceso de extinción de LyFC. Destacan la figura del “terminador”, la compensación por encima de lo establecido bajo condiciones normales a los afectados por la política, la desacreditación de la oposición con el uso de los medios de comunicación, el elemento sorpresa, la no intromisión del legislativo, crear divisiones organizacionales, dar claridad respecto a los pasos siguientes y el contar con una clara estrategia para la implementación del plan de terminación. Las excepciones al modelo fueron el uso sorpresivo de la fuerza pública para tomar las instalaciones de LyFC, así como el congelamiento de las cuentas bancarias del Sindicato Mexicano de Electricistas (SME por la falta de “toma de nota” y la colaboración de un grupo adverso al SME, conformado por trabajadores de la Comisión Federal de Electricidad (CFE afiliados al Sindicato Único de Trabajadores Electricistas de la República Mexicana (SUTERM. Otro aprendizaje que nos deja el caso, es que en este tipo de intervenciones para la terminación de políticas y organizaciones públicas, debería prevalecer el cuidado de la ética en el ejercicio de la función pública, pues la terminación de políticas públicas no debe abordarse solamente desde un punto de vista meramente técnico, sino que debe entenderse que las decisiones de pol

  19. Demonstration, testing, & evaluation of in situ heating of soil. Draft final report, Volume II: Appendices A to E

    Energy Technology Data Exchange (ETDEWEB)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-02-12

    This document is a draft final report for US DOE contract entitled, {open_quotes}Demonstration Testing and Evaluation of In Situ Soil Heating,{close_quotes} Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report This document is Volume II, containing appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120{degrees}to 130{degrees}C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow.

  20. Association of FcγRIIa R131H polymorphism with idiopathic pulmonary fibrosis severity and progression

    Directory of Open Access Journals (Sweden)

    Hirani Nikhil

    2010-10-01

    Full Text Available Abstract Background A significant genetic component has been described for idiopathic pulmonary fibrosis (IPF. The R131H (rs1801274 polymorphism of the IgG receptor FcγRIIa determines receptor affinity for IgG subclasses and is associated with several chronic inflammatory diseases. We investigated whether this polymorphism is associated with IPF susceptibility or progression. Methods In a case-control study, we compared the distribution of FcγRIIa R131H genotypes in 142 patients with IPF and in 218 controls using allele-specific PCR amplification. Results No differences in the frequency of FcγRIIa genotypes were evident between IPF patients and control subjects. However, significantly impaired pulmonary function at diagnosis was observed in HH compared to RR homozygotes, with evidence of more severe restriction (reduced forced vital capacity (FVC and lower diffusing capacity for carbon monoxide (DLCO. Similarly, increased frequency of the H131 allele was observed in patients with severe disease (DLCO 10% drop in FVC and/or > 15% fall in DLCO at 12 months after baseline (0.48 vs. 0.33; p = 0.023. Conclusions These findings support an association between the FcγRIIa R131H polymorphism and IPF severity and progression, supporting the involvement of immunological mechanisms in IPF pathogenesis.

  1. AVALIAÇÃO DE PROPRIEDADES MECÂNICAS DA MADEIRA DE Eucalyptus urograndis SECOS

    Directory of Open Access Journals (Sweden)

    João Marcelo Soares Pereira

    2017-04-01

    Full Text Available O presente trabalho teve como objetivo avaliar as propriedades mecânicas de cisalhamento e compressão de corpos de prova de Eucalyptus urograndis secos. Os seis corpos de prova utilizados no estudo foram retirados de peças de calços com quatorze anos de idade, para cada ensaio mecânico: cisalhamento (fv0, compressão paralela às fibras (fc0 e normal às fibras (fc90. Os valores médios de resistência obtidos nos ensaios de cisalhamento, compressão paralela às fibras e normal às fibras foram 10,30 MPa, 59,17 MPa e 9,20 MPa, respectivamente. Todos os valores obtidos alcançaram valores médios acima da referência estabelecidos pela NBR 7190 (1997.

  2. 48 CFR 1352.201-72 - Contracting Officer's Representative (COR).

    Science.gov (United States)

    2010-10-01

    ... COR is also responsible for the final inspection and acceptance of all deliverables and such other... otherwise obligate the Government or authorize any changes which affect the contract price, terms or...

  3. At least two Fc Neu5Gc residues of monoclonal antibodies are required for binding to anti-Neu5Gc antibody.

    Science.gov (United States)

    Yu, Chuanfei; Gao, Kai; Zhu, Lei; Wang, Wenbo; Wang, Lan; Zhang, Feng; Liu, Chunyu; Li, Meng; Wormald, Mark R; Rudd, Pauline M; Wang, Junzhi

    2016-01-29

    Two non-human glycan epitopes, galactose-α-1,3-galactose (α-gal) and Neu5Gc-α-2-6-galactose (Neu5Gc) have been shown to be antigenic when attached to Fab oligosaccharides of monoclonal antibodies (mAbs) , while α-gal attached to Fc glycans was not. However, the antigenicity of Neu5Gc on the Fc glycans remains unclear in the context that most mAbs carry only Fc glycans. After studying two clinical mAbs carrying significant amounts of Fc Neu5Gc, we show that their binding activity with anti-Neu5Gc antibody resided in a small subset of mAbs carrying two or more Fc Neu5Gc, while mAbs harboring only one Neu5Gc showed no reactivity. Since most Neu5Gc epitopes were distributed singly on the Fc of mAbs, our results suggest that the potential antigenicity of Fc Neu5Gc is low. Our study could be referenced in the process design and optimization of mAb production in murine myeloma cells and in the quality control of mAbs for industries and regulatory authorities.

  4. Qualidade e teores de nutrientes de palmeira-rápis em substrato com fibra de coco Quality and nutrient content of lady palm in coconut fiber substrate

    Directory of Open Access Journals (Sweden)

    Flávia dos S Alves

    2010-03-01

    Full Text Available As avaliações foram realizadas em quatro substratos compostos de mistura de fibra de coco triturada (FC e substrato comercial Plantmax HT® (SC, nas proporções de 0, 25, 50 e 75% de FC, em vasos com capacidade para 35 L, em delineamento de blocos ao acaso, com quatro repetições e três vasos por parcela, com uma planta por vaso. A adubação das plantas foi feita alternando-se, a cada três meses, 25 g de 4-14-8 com 10 g de uréia por vaso, a partir do plantio e durante os 24 meses do período experimental. O crescimento foi avaliado medindo-se a altura da haste inicial (da base do caule à inserção da última folha completamente expandida, número de folhas da haste inicial, número de perfilhos, número de folhas dos perfilhos, altura dos perfilhos e teores de nutrientes da última folha completamente expandida da haste inicial. A qualidade foi avaliada através de análise sensorial visual, baseado nos critérios "gostei"(muito ou pouco e "compraria"(sim ou não. Não houve diferença entre os tratamentos sobre as características de crescimento, exceto para o número de folhas da haste inicial. As plantas com melhor aceitação foram aquelas cultivadas na mistura com 50% FC e 50% SC. Nenhuma das plantas apresentou sintoma visual de deficiência de nutrientes, sendo os teores foliares encontrados em plantas sadias com padrão de qualidade para comercialização de: 17,80 - 18,29 g kg-1 de N; 0,66 - 0,81 g kg-1 de NO-3; 2,02 - 2,34 g kg-1 de P; 18,11 - 20,40 g kg-1 de K; 11,63 - 13,84 g kg-1 de Cl; 2,69 - 4,04 g kg-1 de Ca; 1,61 - 2,07 g kg-1 de S; 1,98 - 2,64 g kg-1 de Mg.It was evaluated the quality and nutrient content of lady palm in four substrates made up of a mixture of shredded coconut fiber (FC and commercial substrate Plantmax HT® (SC, in proportions of 0, 25, 50 and 75% of FC, in 35 liters containers, in a randomized block experiment with four replicates and three pots per plot, with one plant per pot. The plants were

  5. Macrophage colony stimulating factor (M-CSF) induces Fc receptor expression on macrophages

    International Nuclear Information System (INIS)

    Magee, D.M.; Wing, E.J.; Waheed, A.; Shadduck, R.K.

    1986-01-01

    M-CSF is a glycoprotein that stimulates bone marrow progenitor cells to proliferate and differentiate into macrophages (M theta). In addition, M-CSF can modulate the function of mature M theta. In this study, the authors determined the effect of M-CSF on expression of receptors for IgG (Fc receptors). Murine resident peritoneal M theta monolayers were incubated with either M-CSF, recombinant gamma interferon (IFN), or left untreated for 48 hrs. Expression of Fc receptors was assessed by microscopy using an antibody coated sheet erythrocytes (EA) rosette assay. The results indicated that M-CSF treated M theta had significantly higher numbers of bound EA (7.1 erythrocytes/M theta), than IFN M theta (4.4), or untreated M theta (2.5) (p 51 Cr labelled EA assay, CSF M theta (16,411 cpm), IFN M theta (10,887), untreated M theta (6897) (p < 0.001). Additionally, the maximal response was noted between 10 and 500 units M-CSF. Purified anti-M-CSF IgG, when included in the cultures, ablated the enhancement of EA binding, whereas normal rabbit IgG did not. These findings indicate that M-CSF is a potent inducer of Fc receptor expression on M theta and supports other data concerning the role of M-CSF as a biological response modifier

  6. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 2, Appendices A--L.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1992-01-01

    This report consists of appendices A-L of the final environmental impact statement for the Bonneville Power Administration. The appendices provide information on the following: Ninth circuit Court opinion in Forelaws on Board v. Johnson; guide to Northwest Power act contracts; guide to hydro operations; glossary; affected environment supporting documentation; environmental impacts of generic resource types; information on models used; technical information on analysis; public involvement activities; bibliography; Pacific Northwest Electric Power Planning and Conservation Act; and biological assessment. (CBS)

  7. Consequence in Law of the Original Contract Obligation in Case of Recovery of Losses Incurred by Nonfulfillment or Improper Fulfillment of the Contract

    Directory of Open Access Journals (Sweden)

    Popov I. V.

    2012-11-01

    Full Text Available The issue of the obligations structure concerning the breach of a contract is considered in the article. According to the author’s opinion there simultaneously exists the initial obligation in conformity with the contract and obligation of losses compensation for the contract breach. Such an approach allows to recover damages before the moment when the initial obligation is discontinued by law or by a contract provision. The correlation between the initial obligation and the obligation to compensate losses because of the contract breach is being analyzed here.

  8. HIV-specific Fc effector function early in infection predicts the development of broadly neutralizing antibodies.

    Science.gov (United States)

    Richardson, Simone I; Chung, Amy W; Natarajan, Harini; Mabvakure, Batsirai; Mkhize, Nonhlanhla N; Garrett, Nigel; Abdool Karim, Salim; Moore, Penny L; Ackerman, Margaret E; Alter, Galit; Morris, Lynn

    2018-04-01

    While the induction of broadly neutralizing antibodies (bNAbs) is a major goal of HIV vaccination strategies, there is mounting evidence to suggest that antibodies with Fc effector function also contribute to protection against HIV infection. Here we investigated Fc effector functionality of HIV-specific IgG plasma antibodies over 3 years of infection in 23 individuals, 13 of whom developed bNAbs. Antibody-dependent cellular phagocytosis (ADCP), complement deposition (ADCD), cellular cytotoxicity (ADCC) and cellular trogocytosis (ADCT) were detected in almost all individuals with levels of activity increasing over time. At 6 months post-infection, individuals with bNAbs had significantly higher levels of ADCD and ADCT that correlated with antibody binding to C1q and FcγRIIa respectively. In addition, antibodies from individuals with bNAbs showed more IgG subclass diversity to multiple HIV antigens which also correlated with Fc polyfunctionality. Germinal center activity represented by CXCL13 levels and expression of activation-induced cytidine deaminase (AID) was found to be associated with neutralization breadth, Fc polyfunctionality and IgG subclass diversity. Overall, multivariate analysis by random forest classification was able to group bNAb individuals with 85% sensitivity and 80% specificity based on the properties of their antibody Fc early in HIV infection. Thus, the Fc effector function profile predicted the development of neutralization breadth in this cohort, suggesting that intrinsic immune factors within the germinal center provide a mechanistic link between the Fc and Fab of HIV-specific antibodies.

  9. Bonneville Purchasing Instructions. Appendix 14A, Contracting Officer`s Technical Representatives` Guide for Services Contracts.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1993-07-01

    This guide outlines the duties of BPA personnel designated as Contracting Officers Technical Representatives (COTRs). The BPA Administrator gives contracting officers (COs) in BPA responsibility and authority for awarding and administering contracts. COs are authorized to designate other BPA employees to act as their representatives for purposes of contract administration, from the time of contract award until final receipt and acceptance of the contracted services. COTRs are the individuals primarily relied upon to perform technical contract administration functions. Similar functions for supply and construction contracts are performed by engineering representatives, construction inspectors, and inspectors. Although this Guide is written primarily with the COTR in mind, the concept and operation of teamwork is essential throughout the entire process of contract administration. The CO administers the contract during performance, but rarely has expertise in all of the relevant technical areas. Therefore, CO decisions rely on input from a team. The COTR is an indispensable member of that team. The instructions in this Guide are designed to facilitate this essential CO-COTR cooperation. COTR duties are usually additional to those required of the COTR in his or her assigned line organization. The COTR is still accountable to the line supervisor for performance of regularly-assigned duties. These duties are to be reflected appropriately in performance appraisals and job descriptions. For contract administration duties, however, the COTR reports directly to, and is accountable only to, the CO. The COTR`s supervisor must allow sufficient time to ensure that the COTR can adequately monitor the contract for technical compliance. This Guide is designed for COTRs who are performing service contract (including intergovernmental contract) administration functions as an adjunct to their normal technical duties.

  10. Efecto de la Adición de dos Tipos de Almidones en las Propiedades Texturales de Queso Análogo / Effect of the Addition of Two Types of Starch in the Textural Properties of Analogue Cheese

    Directory of Open Access Journals (Sweden)

    Jacqueline Agudelo Chaparro

    2014-12-01

    Full Text Available Resumen. Se estudió el efecto que tienen dos tipos de almidónmodificado, maíz ceroso y papa, en las propiedades texturalesde un queso análogo con fibra prebiótica soluble. Se elaboraronquesos semiblandos, con humedad de 48%, reemplazando el10% de proteína por los almidones modificados, dando lugar atres tratamientos: Formulación control (FC, formulación maízceroso (FMC y formulación papa (FP. Se observó que la adiciónde los almidones afecta significativamente (P<0,05 la dureza, laadhesividad, la gomosidad, la elasticidad y la masticabilidad delproducto. /  Abstract. The effect they have two types of modified starch (waxycorn and potato in the textural properties of an analogue cheesewas studied. Semi-soft cheeses were made with 48% moisture,replacing the 10% protein by modified starches, resulting in threetreatments: Control formulation (CF, waxy corn formulation(WCF and potato formulation (PF. The study allowed note thatthe addition of starches significantly affect (P<0.05 the hardness,adhesiveness, gumminess, elasticity and chewiness of the product

  11. Medições instrumentais e sensoriais de dureza e suculência na carne caprina Instrumental and sensorial assessment of tenderness and juiciness in goat meat

    Directory of Open Access Journals (Sweden)

    Ângela da Silva Borges

    2006-12-01

    Full Text Available Foi avaliado o efeito do tipo de músculo e da maturação sobre algumas propriedades funcionais e sensoriais da carne caprina. Utilizaram-se os músculos longissimus dorsi, semimembranosus e biceps femoris de cabras com aproximadamente 20 meses de idade. A carne, sem maturar e maturada por sete dias, foi avaliada para perdas por cocção (PPC e força de cisalhamento (FC, por métodos instrumentais, e para dureza sensorial (DS e suculência sensorial (SS, por provadores treinados. As PPC não sofreram efeito significativo (p > 0,05 do tipo de músculo e da maturação da carne. A carne sem maturar do músculo semimembranosus apresentou maior FC que aquelas dos músculos longissimus dorsi e biceps femoris. Em relação ao tipo de músculo, após a maturação, as carnes dos músculos semimembranosus e biceps femoris se apresentaram mais macias que a do longissimus dorsi. Quanto ao efeito da maturação, a FC da carne do músculo semimembranosus diminuiu significativamente. A FC apresentou correlação positiva com DS e correlação negativa com SS. Dureza e suculência avaliadas de forma sensorial apresentaram correlação negativa. A maturação por 7 dias diminuiu a dureza, mas não afetou as PPC da carne dos músculos semimembranosus e bíceps femoris.The effect of muscle type and aging for seven days on certain functional and sensory properties of goat meat was evaluated. The experiment used meat from longissimus dorsi, semimembranosus and biceps femoris muscles from female goats that were approximately 20 months. After 24 h of being slaughtered and seven days, the aging meat was instrumentally analyzed for cooking losses (CL and shear force (SF, as well as for sensory firmness (F and juiciness (J by a trained panel. CL was not affected (p > 0.05 by the type of muscle and aging of the meat. Before aging, meat from semimembranosus muscles showed higher SF than those from longissimus dorsi or bicep femoris muscles. After aging, meat from

  12. Necesidades de metionina + cistina para pollos de engorda en iniciación

    Directory of Open Access Journals (Sweden)

    J. E. Morales

    2004-01-01

    Full Text Available Con el fin de conocer las necesidades de aminoácidos metionina + cistina (Met + Cis de pollos de engorda, durante la etapa de iniciación se realizaron tres experimentos, bajo un diseño completamente al azar con pollitos de engorda «Indian River» sin sexar, de 1 a 21 días de edad. Cada tratamiento fue por triplicado en grupos de 12 aves cada uno. En el primer experimento, una dieta a base de sorgo y pasta de soya con 22% de proteína y 3,000 Kcal de energía metabolizable (EM por kg fue suplementada con DL-Met en distintas cantidades para contar con cinco niveles de Met + Cis; 0.69%, 0.76%, 0.83%, 0.90% y 0.97%. Los resultados obtenidos para ganancia total de peso (506b, 570ab, 578ab, 617a y 585a g y eficiencia alimenticia (0.63b, 0.69a, 0.68ab, 0.72a y 0.70a fueron diferentes (P < 0.05 entre tratamientos. En el segundo experimento se empleó una dieta similar (23% proteína; 3,000 Kcal EM/kg y suplementada con DL-Met en distintas proporciones para evaluar cinco niveles de Met + Cis (0.68%, 0.75%, 0.82%, 0.90%, y 0.97%. Los datos fueron diferentes (P < 0.05 para consumo de alimento (670c, 693ab, 725ab, 732a y 721ab g, ganancia de peso (420c, 454bc, 492ab, 508a y 493a g y eficiencia alimenticia (0.62a, 0.65ab, 0.68ab, 0.69a y 0.68ab. En el tercer experimento, una dieta semejante (22 % proteína; 3,100 kcal EM/kg fue utilizada para evaluar cinco niveles de Met + Cis (0.66%, 0.74%, 0.82%, 0.89% y 0.97%. Los resultados obtenidos fueron diferentes (P < 0.05 en consumo de alimento (654a, 691ab, 746a, 713ab y 714ab g, ganancia de peso (445ab, 493ab, 551ab, 552a y 537a g y eficiencia alimenticia (0.68a, 0.71ab, 0.74ab, 0.77b y 0.75b. De acuerdo con estos resultados, dietas para pollos de engorda en iniciación (1 a 21 días de edad con 0.90 % de Met + Cis como aminoácidos totales, equivalentes a 0.81% de Met + Cis digeribles, causan un mayor aumento de peso corporal y mejor eficiencia alimenticia

  13. Real forms of complex quantum anti-de-Sitter algebra Uq(Sp(4;C)) and their contraction schemes

    International Nuclear Information System (INIS)

    Lukierski, J.; Nowicki, A.; Ruegg, H.

    1991-01-01

    We describe four types of inner involutions of the Cartan-Weyl basis providing (for vertical strokeqvertical stroke=1 and q real) three types of real quantum Lie algebras: U q (O(3, 2)) (quantum D=4 anti-de-Sitter), U q (O(4, 1)) (quantum D=4 de-Sitter) and U q (O(5)). We give also two types of inner involutions of the Cartan-Chevalley basis of U q (Sp(4; C)) which cannot be extended to inner involutions of the Cartan-Weyl basis. We outline twelve contraction schemes for quantum D=4 anti-de-Sitter algebra. All these contractions provide four commuting translation generators, but only two (one for vertical strokeqvertical stroke=1, the second for q real) lead to the quantum Poincare algebra with an undeformed space rotation O(3) subalgebra. (orig.)

  14. Capnografia volumétrica como meio de detectar obstrução pulmonar periférica precoce em pacientes com fibrose cística

    Directory of Open Access Journals (Sweden)

    Maria Ângela G. O. Ribeiro

    2012-12-01

    Full Text Available OBJETIVO: Comparar a espirometria e a capnografia volumétrica (CapV para determinar se os valores amostrados pela capnografia acrescentam informações sobre doenças pulmonares precoces em pacientes com fibrose cística (FC. MÉTODOS: Este foi um estudo do tipo corte transversal envolvendo pacientes com FC: Grupo I (42 pacientes, 6-12 anos de idade e Grupo II (22 pacientes, 13-20 anos de idade. Os grupos controle correspondentes eram formados por 30 e 50 indivíduos saudáveis, respectivamente. A capacidade vital forçada (CVF, o volume expiratório forçado no primeiro segundo (VEF1 e a relação VEF1/CVF foram determinados pela espirometria. Através da CapV, medimos a saturação periférica de oxigênio (SpO2, a frequência respiratória (FR, o tempo inspiratório (TI, o tempo expiratório (TE e o slope da fase III normalizado pelo volume corrente (slope da fase III/Vc. RESULTADOS: Em comparação com os grupos controle, todos os pacientes com FC apresentaram valores de slope da fase III/Vc (p < 0,001 mais altos independentemente do estágio de doença pulmonar. O slope da fase III/Vc foi significantemente mais alto nos 24 pacientes que tiveram resultados normais de espirometria (p = 0,018. Os pacientes do Grupo II apresentaram valores de CVF, VEF1, VEF1/CVF (p < 0,05 e SpO2 (p < 0,001 mais baixos que os pacientes do Grupo I. Os pacientes do Grupo II, comparados com os do Grupo Controle II, apresentaram FR (p < 0,001 mais alta e valores de TI e TE (p < 0,001 mais baixos. CONCLUSÕES: Todos os pacientes com FC mostraram ter valores mais altos de slope da fase III/Vc quando comparados com os pacientes dos grupos controle. A CapV identificou a heterogeneidade da distribuição da ventilação nas vias aéreas periféricas dos pacientes com FC que apresentaram espirometria normal.

  15. Effects of CTLA4-Fc on glomerular injury in humorally-mediated glomerulonephritis in BALB/c mice.

    Science.gov (United States)

    Kitching, A R; Huang, X R; Ruth, A-J; Tipping, P G; Holdsworth, S R

    2002-06-01

    The effect of cytotoxic T-lymphocyte-associated molecule 4-immunoglobulin fusion protein (CTLA4-Fc) on humorally-mediated glomerulonephritis was studied in accelerated anti-glomerular basement membrane (anti-GBM) glomerulonephritis induced in BALB/c mice. This strain of mice develops antibody and complement dependent glomerulonephritis under this protocol. Sensitized BALB/c mice developed high levels of circulating autologous antibody titres, intense glomerular deposition of mouse immunoglobulin and complement, significant proteinuria, renal impairment, significant glomerular necrosis and a minor component of crescent formation 10 days after challenge with a nephritogenic antigen (sheep anti-GBM globulin). Early treatment during the primary immune response, or continuous treatment throughout the disease with CTLA4-Fc, significantly suppressed mouse anti-sheep globulin antibody titres in serum, and immunoglobulin and complement deposition in glomeruli. The degree of glomerular necrosis was improved and proteinuria was reduced, particularly in the earlier stages of disease. Late treatment by CTLA4-Fc starting one day after challenge with sheep anti-mouse GBM did not affect antibody production and did not attenuate glomerulonephritis. The low level of crescent formation found in BALB/c mice developing glomerulonephritis was not prevented by the administration of CTLA4-Fc. These results demonstrate that CTLA4-Fc is of benefit in this model of glomerulonephritis by its capacity to attenuate antibody production, without affecting the minor degree of cell-mediated glomerular injury.

  16. Oscillatory exchange bias and training effects in nanocrystalline Pr0.5Ca0.5MnO3

    Directory of Open Access Journals (Sweden)

    S. Narayana Jammalamadaka

    2012-03-01

    Full Text Available We report on exchange bias effects in 10 nm particles of Pr0.5Ca0.5MnO3 which appear as a result of competing interactions between the ferromagnetic (FM/anti-ferromagnetic (AFM phases. The fascinating new observation is the demonstration of the temperature dependence of oscillatory exchange bias (OEB and is tunable as a function of cooling field strength below the SG phase, may be attributable to the presence of charge/spin density wave (CDW/SDW in the AFM core of PCMO10. The pronounced training effect is noticed at 5 K from the variation of the EB field as a function of number of field cycles (n upon the field cooling (FC process. For n > 1, power-law behavior describes the experimental data well; however, the breakdown of spin configuration model is noticed at n ≥ 1.

  17. 41 CFR 101-25.110-2 - Tires obtained through Federal Supply Schedules or regional term contracts.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tires obtained through Federal Supply Schedules or regional term contracts. 101-25.110-2 Section 101-25.110-2 Public Contracts... Federal Supply Schedules or regional term contracts. When tire manufacturers ship tires direct against...

  18. Efeitos do treinamento aeróbio e resistido nas respostas cardiovasculares de idosos ativos

    Directory of Open Access Journals (Sweden)

    Rafaella Ribas Locks

    Full Text Available OBJETIVO: Verificar os efeitos da associação do treinamento aeróbio e resistido nas respostas cardiovasculares de idosos. MÉTODOS: Onze sujeitos (ambos os gêneros, 70 ± 5 anos realizaram, duas vezes por semana, caminhada e exercícios resistidos para membros inferiores por 12 semanas. As avaliações foram realizadas antes, a cada quatro semanas de treinamento e após quatro semanas de destreinamento, por meio do teste de seis minutos de caminhada e aferição de pressão arterial (PA e frequência cardíaca (FC antes, imediatamente após e no quinto e décimo minutos subsequentes ao teste. Os resultados foram comparados pelo teste Wilcoxon (p ≤ 0,05. RESULTADOS: Quatro semanas de treinamento promoveram redução da PA sistólica e diastólica em repouso (120 ± 16 mmHg vs. 138 ± 20 mmHg, p = 0,01; 70 ± 9 mmHg vs. 84 ± 10 mmHg, p = 0,007, respectivamente e redução da PA diastólica imediatamente após o teste (78 ± 12 mmHg vs. 86 ± 9 mmHg, p = 0,01, que persistiu após dez minutos do esforço submáximo, quando comparadas ao pré-treino. Após 12 semanas, houve aumento da distância percorrida (555 ± 65m vs. 514 ± 100 m, p = 0,04 quando comparado ao pré-treino e recuperação dos valores de repouso da FC dez minutos após o esforço. CONCLUSÃO: A associação do treinamento aeróbio e resistido, em apenas quatro semanas, promoveu adaptações cardiovasculares eficientes na redução da PA sistólica e diastólica. Após 12 semanas, houve aumento da resistência à caminhada submáxima e recuperação dos valores em repouso da FC. Mesmo com o destreinamento, todos os resultados, exceto a FC, foram mantidos.

  19. Medicare program; contracts with health maintenance organizations (HMOs) and competitive medical plans (CMPs)--HCFA. Final rule with comment period.

    Science.gov (United States)

    1995-09-01

    This rule clarifies and updates portions of the HCFA regulations that pertain to the following: The conditions that an HMO or CMP must meet to qualify for a Medicare contract (Subpart J). The contract requirements (Subpart L). The rules for enrollment, entitlement, and disenrollment of Medicare beneficiaries in a contracting HMO or CMP (Subpart K). How a Medicare contract is affected when there is change of ownership or leasing of facilities of a contracting HMO or CMP (Subpart M). These are technical and editorial changes that do not affect the substance of the regulations. They are intended to make it easier to find particular provisions, to provide overviews of the different program aspects, and to better ensure uniform understanding of the rules.

  20. Desempenho, características de carcaça e composição química de diferentes cortes comerciais de novilhas mestiças não-gestantes ou gestantes terminadas em confinamento = Performance, carcass characteristics and chemical composition of nonpregnant or pregnant heifers finished in feedlot

    Directory of Open Access Journals (Sweden)

    Lívia Maria Araújo Macedo

    2007-10-01

    Full Text Available Objetivou-se avaliar o efeito da gestação sobre o desempenho, características de carcaça e composição físico-química de cinco cortes de novilhas mestiças em confinamento. Utilizaram-secinco novilhas gestantes e cinco não-gestantes com 20 meses e peso corporal de 323 kg. Não houve diferença (p > 0,05 para peso final, ganho médio diário, consumo, conversão alimentar, peso de carcaça, rendimento de carcaça, área de olho de lombo e espessura de gordura de cobertura entre os tratamentos. O acém das novilhas gestantes teve maiores teores (p This work was carried out to study the effect of pregnancy on performance, carcass characteristics and chemical composition of crossbred heifers in comparison with nonpregnant heifers finished in feedlot. Five pregnant heifers and five nonpregnant heifers, 20 months old and with initial live weight of 327 kg were used. The initial live weight, final weight, average daily gain, intake, feed conversion, carcass weight, hot carcass dressing, Longissimus area and fat thickness (4.21 mm did not differ (p > 0.05 between treatments. Pregnant heifers chuck showed higher levels (p < 0.05 of moisture and ash, and lower levels (p < 0.05 of total fat, than nonpregnant heifers. Pregnant heifers rump showed higher levels (p < 0.05 of moisture. Nonpregnant heifers striploin had the highest level (p < 0.05 of moisture. The fatty acid profile of pregnant heifers chuck had the highest levels (p < 0.05 of 14:0, 16:1n7 and 20:4n6, but showed the lowest level (p < 0.05 of 17:0. Nonpregnant heifers topside showed the highest levels (p < 0.05 of 18:1t11 and 18:2c9t1. Pregnant heifers chuck showed the highest level (p < 0.05 of PUFA. Nonpregnant heifers had higher levels of n-6 fatty acids than pregnant heifers. The striploin of pregnant heifers showed higher percentage (p < 0.05 of n-3.

  1. Estratégias de hedge com os contratos futuros de soja da Chicago Board of Trade Hedging strategies with Chicago Board of Trade soybeans futures contracts

    Directory of Open Access Journals (Sweden)

    Fábio Neves de Carvalho da Silva Maia

    2010-01-01

    Full Text Available Este trabalho avalia os retornos e os riscos de estratégias de hedge para as dez principais regiões produtoras de soja do Brasil em relação aos contratos futuros de soja da Chicago Board of Trade (CBOT. Verificou-se que as bases apresentaram padrão bem definido: fortalecimento entre maio e novembro, seguido por enfraquecimento nos seis meses subsequentes. Os hedgers de compra possuem oportunidades de obter retornos brutos maiores, mas os riscos envolvidos nas estratégias de hedge de compra também são maiores. Conclui-se que os contratos de soja em grão da CBOT apresentam diferentes possibilidades de retornos brutos em função do tipo de hedge, do período hedgeado e do contrato utilizado. Logo, as informações disponibilizadas neste trabalho se apresentam como importante subsídio ao processo de tomada de decisão por parte dos agentes da cadeia agroindustrial da soja.This paper analyzes the return and risks of hedging strategies of the major ten soybean producing regions in Brazil concerning Chicago Board of Trade (CBOT future contracts. It was verified that the bases presented a well defined pattern characterized by strengthening from May to November and weakening in the remaining months. Long hedging had larger returns and larger risks comparing with short hedging. The conclusion of this study is that the CBOT soybean contracts present different returns depending on the type of hedging, on the period of hedging, and on the contract used. Therefore, the information presented in this paper is very important to support the decision making process in the Brazilian soybean agricultural system.

  2. Activatory and Inhibitory Fcγ Receptors Augment Rituximab-mediated Internalization of CD20 Independent of Signaling via the Cytoplasmic Domain*

    Science.gov (United States)

    Vaughan, Andrew T.; Chan, Claude H. T.; Klein, Christian; Glennie, Martin J.; Beers, Stephen A.; Cragg, Mark S.

    2015-01-01

    Type I anti-CD20 mAb such as rituximab and ofatumumab engage with the inhibitory FcγR, FcγRIIb on the surface of B cells, resulting in immunoreceptor tyrosine-based inhibitory motif (ITIM) phosphorylation. Internalization of the CD20·mAb·FcγRIIb complex follows, the rate of which correlates with FcγRIIb expression. In contrast, although type II anti-CD20 mAb such as tositumomab and obinutuzumab also interact with and activate FcγRIIb, this interaction fails to augment the rate of CD20·mAb internalization, raising the question of whether ITIM phosphorylation plays any role in this process. We have assessed the molecular requirements for the internalization process and demonstrate that in contrast to internalization of IgG immune complexes, FcγRIIb-augmented internalization of rituximab-ligated CD20 occurs independently of the FcγRIIb ITIM, indicating that signaling downstream of FcγRIIb is not required. In transfected cells, activatory FcγRI, FcγRIIa, and FcγRIIIa augmented internalization of rituximab-ligated CD20 in a similar manner. However, FcγRIIa mediated a slower rate of internalization than cells expressing equivalent levels of the highly homologous FcγRIIb. The difference was maintained in cells expressing FcγRIIa and FcγRIIb lacking cytoplasmic domains and in which the transmembrane domains had been exchanged. This difference may be due to increased degradation of FcγRIIa, which traffics to lysosomes independently of rituximab. We conclude that the cytoplasmic domain of FcγR is not required for promoting internalization of rituximab-ligated CD20. Instead, we propose that FcγR provides a structural role in augmenting endocytosis that differs from that employed during the endocytosis of immune complexes. PMID:25568316

  3. Relaciones de puestos de trabajo. ¿Reglamento o acto administrativo? STS de 05 de febrero de 2014 (JUR 2014\\1572

    Directory of Open Access Journals (Sweden)

    Belén Andrés Segovia

    2015-06-01

    Full Text Available La Sentencia que ocupará las siguientes páginas, es objeto de un punto de inflexión a través del cual, el Tribunal Supremo cambia años de doctrina jurisprudencial. La figura por excelencia era el Reglamento en las Relaciones de Puesto de Trabajo. A través de este análisis podremos observar, como los criterios han cambiado, y ya no es el régimen normativo a seguir según el Tribunal Supremo. Para terminar realizaremos un análisis a modo de conclusiones extraídas a raíz de su régimen comparativo con la figura jurídica anterior. The Sentence analyzed a turning point through which the Supreme Court changed years of jurisprudence. The figure par excellence was the Regulation on Workplace Relations. Through this analysis we can see, the criteria have changed, and is no longer the regulatory regime to follow according to the Supreme Court. Finally make an analysis by way of conclusions drawn following its comparative legal regime with the previous figure.

  4. Demonstration, testing, ampersand evaluation of in situ heating of soil. Draft final report, Volume II: Appendices A to E

    International Nuclear Information System (INIS)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-01-01

    This document is a draft final report for US DOE contract entitled, open-quotes Demonstration Testing and Evaluation of In Situ Soil Heating,close quotes Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report This document is Volume II, containing appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120 degrees to 130 degrees C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow

  5. Differential Use of Human Neutrophil Fcγ Receptors for Inducing Neutrophil Extracellular Trap Formation.

    Science.gov (United States)

    Alemán, Omar Rafael; Mora, Nancy; Cortes-Vieyra, Ricarda; Uribe-Querol, Eileen; Rosales, Carlos

    2016-01-01

    Neutrophils (PMN) are the most abundant leukocytes in the blood. PMN migrate from the circulation to sites of infection, where they are responsible for antimicrobial functions. PMN use phagocytosis, degranulation, and formation of neutrophil extracellular traps (NETs) to kill microbes. NETs are fibers composed of chromatin and neutrophil-granule proteins. Several pathogens, including bacteria, fungi, and parasites, and also some pharmacological stimuli such as phorbol 12-myristate 13-acetate (PMA) are efficient inducers of NETs. Antigen-antibody complexes are also capable of inducing NET formation. However the particular Fcγ receptor involved in triggering this function is a matter of controversy. In order to provide some insight into what Fcγ receptor is responsible for NET formation, each of the two human Fcγ receptors was stimulated individually by specific monoclonal antibodies and NET formation was evaluated. FcγRIIa cross-linking did not promote NET formation. Cross-linking other receptors such as integrins also did not promote NET formation. In contrast FcγRIIIb cross-linking induced NET formation similarly to PMA stimulation. NET formation was dependent on NADPH-oxidase, PKC, and ERK activation. These data show that cross-linking FcγRIIIb is responsible for NET formation by the human neutrophil.

  6. Differential Use of Human Neutrophil Fcγ Receptors for Inducing Neutrophil Extracellular Trap Formation

    Directory of Open Access Journals (Sweden)

    Omar Rafael Alemán

    2016-01-01

    Full Text Available Neutrophils (PMN are the most abundant leukocytes in the blood. PMN migrate from the circulation to sites of infection, where they are responsible for antimicrobial functions. PMN use phagocytosis, degranulation, and formation of neutrophil extracellular traps (NETs to kill microbes. NETs are fibers composed of chromatin and neutrophil-granule proteins. Several pathogens, including bacteria, fungi, and parasites, and also some pharmacological stimuli such as phorbol 12-myristate 13-acetate (PMA are efficient inducers of NETs. Antigen-antibody complexes are also capable of inducing NET formation. However the particular Fcγ receptor involved in triggering this function is a matter of controversy. In order to provide some insight into what Fcγ receptor is responsible for NET formation, each of the two human Fcγ receptors was stimulated individually by specific monoclonal antibodies and NET formation was evaluated. FcγRIIa cross-linking did not promote NET formation. Cross-linking other receptors such as integrins also did not promote NET formation. In contrast FcγRIIIb cross-linking induced NET formation similarly to PMA stimulation. NET formation was dependent on NADPH-oxidase, PKC, and ERK activation. These data show that cross-linking FcγRIIIb is responsible for NET formation by the human neutrophil.

  7. Ion-exchange mechanism of layered transition-metal oxides: case study of LiNi(0.5)Mn(0.5)O₂.

    Science.gov (United States)

    Gwon, Hyeokjo; Kim, Sung-Wook; Park, Young-Uk; Hong, Jihyun; Ceder, Gerbrand; Jeon, Seokwoo; Kang, Kisuk

    2014-08-04

    An ion-exchange process can be an effective route to synthesize new quasi-equilibrium phases with a desired crystal structure. Important layered-type battery materials, such as LiMnO2 and LiNi(0.5)Mn(0.5)O2, can be obtained through this method from a sodium-containing parent structure, and they often show electrochemical properties remarkably distinct from those of their solid-state synthesized equivalents. However, while ion exchange is generally believed to occur via a simple topotactic reaction, the detailed phase transformation mechanism during the process is not yet fully understood. For the case of layered LiNi(0.5)Mn(0.5)O2, we show through ex situ X-ray diffraction (XRD) that the ion-exchange process consists of several sequential phase transformations. By a study of the intermediate phase, it is shown that the residual sodium ions in the final structure may greatly affect the electrochemical (de)lithiation mechanism.

  8. HIV-specific Fc effector function early in infection predicts the development of broadly neutralizing antibodies.

    Directory of Open Access Journals (Sweden)

    Simone I Richardson

    2018-04-01

    Full Text Available While the induction of broadly neutralizing antibodies (bNAbs is a major goal of HIV vaccination strategies, there is mounting evidence to suggest that antibodies with Fc effector function also contribute to protection against HIV infection. Here we investigated Fc effector functionality of HIV-specific IgG plasma antibodies over 3 years of infection in 23 individuals, 13 of whom developed bNAbs. Antibody-dependent cellular phagocytosis (ADCP, complement deposition (ADCD, cellular cytotoxicity (ADCC and cellular trogocytosis (ADCT were detected in almost all individuals with levels of activity increasing over time. At 6 months post-infection, individuals with bNAbs had significantly higher levels of ADCD and ADCT that correlated with antibody binding to C1q and FcγRIIa respectively. In addition, antibodies from individuals with bNAbs showed more IgG subclass diversity to multiple HIV antigens which also correlated with Fc polyfunctionality. Germinal center activity represented by CXCL13 levels and expression of activation-induced cytidine deaminase (AID was found to be associated with neutralization breadth, Fc polyfunctionality and IgG subclass diversity. Overall, multivariate analysis by random forest classification was able to group bNAb individuals with 85% sensitivity and 80% specificity based on the properties of their antibody Fc early in HIV infection. Thus, the Fc effector function profile predicted the development of neutralization breadth in this cohort, suggesting that intrinsic immune factors within the germinal center provide a mechanistic link between the Fc and Fab of HIV-specific antibodies.

  9. Propuesta de gestión del servicio de soporte al cliente final en empresas proveedoras de servicios de telecomunicaciones, basada en ITIL v3

    OpenAIRE

    Loza Aguirre, Edison Fernando; Roa Marín, Henry; Samaniego, Cesar Gustavo

    2010-01-01

    El presente trabajo es una propuesta teórica de gestión de los procesos de soporte al cliente final en empresas proveedoras de servicios de telecomunicaciones. Primero, se analiza el uso de buenas prácticas y marcos referenciales de gestión de IT en el sector de las telecomunicaciones del Ecuador. A continuación, se describen los procesos involucrados en el soporte al cliente final y se desarrolla una propuesta de gestión del servicio de soporte tomando como base el marco referencial ITILv3....

  10. Comprehensive evaluation of cesium removal by CuFC adsorption. The effects of initial concentration, CuFC dosage and co-existing ions in solution

    International Nuclear Information System (INIS)

    Yao Xu; Ping Gu; Guang-Hui Zhang; Jun Zhao; Lu Wang; Xiang-Zhu Xiao; Fei Han

    2017-01-01

    To use copper ferrocyanide (CuFC) more efficiently in wastewater treatment, the method of isotope carrying used in "1"3"7Cs removal was investigated. A calculation model based on Freundlich isotherm was established to determine the optimum initial cesium concentration, at which the highest decontamination factor (DF) could be obtained at a certain CuFC dosage. An accurate DF prediction model was developed to describe synergistic effects of sodium and potassium. A novel index called volumetric distribution coefficient (K_v_d) was proposed to evaluate adsorption performance in terms of DF and concentration factor. (author)

  11. Farelo de cacau (Theobroma cacao L. e torta de dendê (Elaeis guineensis, Jacq na alimentação de cabras em lactação: consumo e produção de leite Effects of feeding cocoa meal (Theobroma cacao L. and palm kernel cake (Elaeis guineensis, Jacq on milk intake and yield for lactating goats

    Directory of Open Access Journals (Sweden)

    Herymá Giovane de Oliveira Silva

    2005-10-01

    Full Text Available Foram avaliados o consumo e a produção de leite de cabras recebendo dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao milho e ao farelo de soja da ração concentrada. Foram utilizadas cinco cabras da raça Saanen, com produção média diária de 2,0 kg de leite e aos 60 dias de lactação, distribuídas em um quadrado latino 5 x 5. Os períodos experimentais tiveram duração de 14 dias, em que os dez primeiros foram destinados à adaptação e os quatro últimos, à coleta de amostras. As rações foram isoprotéicas, com 13,2% de proteína bruta. As dietas constituíram-se de 36% de volumoso (silagem de milho e 64% de concentrado na matéria seca. Os tratamentos consistiram de concentrado à base de milho e soja com 0, 15 e 30% de FC ou TD. Os consumos de matéria seca, matéria orgânica, proteína bruta, nutrientes digestíveis totais, carboidratos totais e carboidratos não-fibrosos reduziram com a inclusão de 30% de FC. Os consumos de fibra em detergente neutro e extrato etéreo (EE não foram alterados pelas dietas. O consumo de fibra em detergente ácido diferiu apenas entre os tratamentos com 30% de TD e 30% de FC, sendo 0,94 e 0,59% do peso vivo animal, respectivamente. O tratamento com 30% de FC proporcionou menor produção de leite (1,208 kg/dia, se assemelhando apenas ao tratamento com inclusão de 30% de TD quando a produção foi corrigida para 3,5% de gordura. O FC e a TD apresentam viabilidade de uso como alternativa na dieta de cabras em lactação em até 9,13 e 18,81% da matéria seca, respectivamente.The effects of replacing corn and soybean meal with cocoa meal (CF or palm kernel cake (PKC in the concentrate on milk intake and yield of goats were evaluated. Five Saanen goats, averaging 2 kg daily milk yield at 60 days of lactation, were assigned to a 5 x 5 Latin square experimental design. The experiment lasted 14 days, with 10 days for adaptation period and four days for sample

  12. 40 CFR 97.355 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.355 Section 97.355 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... System § 97.355 Banking. (a) CAIR NOX Ozone Season allowances may be banked for future use or transfer in...

  13. Prolonged activity of a recombinant factor VIII-Fc fusion protein in hemophilia A mice and dogs

    Science.gov (United States)

    Dumont, Jennifer A.; Liu, Tongyao; Low, Susan C.; Zhang, Xin; Kamphaus, George; Sakorafas, Paul; Fraley, Cara; Drager, Douglas; Reidy, Thomas; McCue, Justin; Franck, Helen W. G.; Merricks, Elizabeth P.; Nichols, Timothy C.; Bitonti, Alan J.; Pierce, Glenn F.

    2012-01-01

    Despite proven benefits, prophylactic treatment for hemophilia A is hampered by the short half-life of factor VIII. A recombinant factor VIII-Fc fusion protein (rFVIIIFc) was constructed to determine the potential for reduced frequency of dosing. rFVIIIFc has an ∼ 2-fold longer half-life than rFVIII in hemophilia A (HemA) mice and dogs. The extension of rFVIIIFc half-life requires interaction of Fc with the neonatal Fc receptor (FcRn). In FcRn knockout mice, the extension of rFVIIIFc half-life is abrogated, and is restored in human FcRn transgenic mice. The Fc fusion has no impact on FVIII-specific activity. rFVIIIFc has comparable acute efficacy as rFVIII in treating tail clip injury in HemA mice, and fully corrects whole blood clotting time (WBCT) in HemA dogs immediately after dosing. Furthermore, consistent with prolonged half-life, rFVIIIFc shows 2-fold longer prophylactic efficacy in protecting HemA mice from tail vein transection bleeding induced 24-48 hours after dosing. In HemA dogs, rFVIIIFc also sustains partial correction of WBCT 1.5- to 2-fold longer than rFVIII. rFVIIIFc was well tolerated in both species. Thus, the rescue of FVIII by Fc fusion to provide prolonged protection presents a novel pathway for FVIII catabolism, and warrants further investigation. PMID:22246033

  14. Contract types for nuclear power projects, non-turnkey type contracts in particular

    International Nuclear Information System (INIS)

    Nyte'n, T.

    1975-01-01

    A non-turnkey contract differs from a turnkey contract in no special formal way. The way the buyer chooses to exercise his project leadership must be concretized in the contract. The way and extent he wishes to exercise technical checking must be laid down in the form of clear rules. The way information has to flow from one contractor over buyer to others and vice versa has to be laid down in detail and the consequences of non conformance fixed in such a manner that optimum project performance is reached. (orig./FW) [de

  15. 34 CFR 97.103 - Assuring compliance with this policy-research conducted or supported by any Federal Department or...

    Science.gov (United States)

    2010-07-01

    ... Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.103 Assuring compliance with this... responsibilities for protecting the rights and welfare of human subjects of research conducted at or sponsored by...

  16. Conformational destabilization of Immunoglobulin G increases the low pH-binding affinity with the Neonatal Fc Receptor

    DEFF Research Database (Denmark)

    Walters, Benjamin T; Jensen, Pernille Foged; Larraillet, Vincent

    2016-01-01

    Crystallographic evidence suggests that the pH-dependent affinity of IgG molecules for the neonatal Fc receptor (FcRn) receptor primarily arises from salt bridges involving IgG histidine residues, resulting in moderate affinity at mildly acidic conditions. However, this view does not explain the ......H-dependent affinity in IgG-FcRn interactions and exemplify the important and often ignored role of intrinsic conformational dynamics in a protein ligand, to dictate affinity for biologically important receptors.......Crystallographic evidence suggests that the pH-dependent affinity of IgG molecules for the neonatal Fc receptor (FcRn) receptor primarily arises from salt bridges involving IgG histidine residues, resulting in moderate affinity at mildly acidic conditions. However, this view does not explain...... the diversity in affinity found in IgG variants, such as the YTE mutant (M252Y,S254T,T256E), which increases affinity to FcRn by up to 10×. Here we compare hydrogen exchange measurements at pH 7.0 and pH 5.5 with and without FcRn bound with surface plasmon resonance estimates of dissociation constants and Fc...

  17. Recombinant IgG1 Fc hexamers block cytotoxicity and pathological changes in experimental in vitro and rat models of neuromyelitis optica.

    Science.gov (United States)

    Tradtrantip, Lukmanee; Felix, Christian M; Spirig, Rolf; Morelli, Adriana Baz; Verkman, A S

    2018-05-01

    Intravenous human immunoglobulin G (IVIG) may have therapeutic benefit in neuromyelitis optica spectrum disorders (herein called NMO), in part because of the anti-inflammatory properties of the IgG Fc region. Here, we evaluated recombinant Fc hexamers consisting of the IgM μ-tailpiece fused with the Fc region of human IgG1. In vitro, the Fc hexamers prevented cytotoxicity in aquaporin-4 (AQP4) expressing cells and in rat spinal cord slice cultures exposed to NMO anti-AQP4 autoantibody (AQP4-IgG) and complement, with >500-fold greater potency than IVIG or monomeric Fc fragments. Fc hexamers at low concentration also prevented antibody-dependent cellular cytotoxicity produced by AQP4-IgG and natural killer cells. Serum from rats administered a single intravenous dose of Fc hexamers at 50 mg/kg taken at 8 h did not produce complement-dependent cytotoxicity when added to AQP4-IgG-treated AQP4-expressing cell cultures. In an experimental rat model of NMO produced by intracerebral injection of AQP4-IgG, Fc hexamers at 50 mg/kg administered before and at 12 h after AQP4-IgG fully prevented astrocyte injury, complement activation, inflammation and demyelination. These results support the potential therapeutic utility of recombinant IgG1 Fc hexamers in AQP4-IgG seropositive NMO. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Qualidade da carne de cordeiros castrados e não-castrados confinados sob dois fotoperíodos Meat quality of feedlot castrated or intact male lambs exposed to two photoperiod lengths

    Directory of Open Access Journals (Sweden)

    Manoel Henrique Klein Júnior

    2006-08-01

    Full Text Available Objetivou-se avaliar a qualidade da carne por meio da determinação da composição centesimal e das características físicas da paleta e do lombo de 20 cordeiros mestiços Ideal, não-castrados (NC e castrados (C, submetidos a fotoperíodos curto, de 12 horas (FC, e longo, de 18 horas (FL. Os animais foram divididos ao acaso em esquema fatorial 2 x 2 (condição sexual x fotoperíodo, em quatro tratamentos (NC em FC; C em FC; NC em FL; e C em FL, com cinco repetições, sendo terminados em confinamento individual até que atingissem 37 kg de PV. A qualidade da carne foi determinada em amostras da paleta e do músculo Longissimus lumborum (LL. Os mais baixos teores de umidade e os mais altos de EE, tanto na paleta como no lombo, foram determinados na carne dos animais castrados. O fotoperíodo longo influenciou significativamente os teores de EE e proteína total do músculo LL. A capacidade de retenção de água foi afetada pelo FL, no qual foram encontrados percentuais mais baixos. Não houve efeito do fotoperíodo nem da condição sexual sobre a capacidade de absorção de água e a perda de peso por cozimento do músculo LL. Os valores de força de cisalhamento (FoCi na carne de cordeiros NC e dos submetidos ao FL foram superiores aos da carne dos animais castrados ou expostos ao FC.The objective of this study was to evaluate muscle composition and physical-chemical characteristics of 20 intact and castrated crossbred Ideal male lambs exposed to either a short photoperiod (SP of 12 h or to a long photoperiod (LP of 18 h. Animals were randomly assigned to four treatments (T in a 2 x 2 factorial arrangement with five repetitions as follows: intact lambs exposed to a SP; castrated lambs exposed to a SP; intact lambs exposed to a LP or castrated lambs exposed to a LP. Animals were maintained in individual pens until they reached 37 kg of body weight. Meat quality was determined in meat samples from the blade and from the Longissimus lumborum

  19. 48 CFR 48.201 - Clauses for supply or service contracts.

    Science.gov (United States)

    2010-10-01

    ... production, based on planning and programming or production documentation at the time the VECP is accepted... production, based on planning and programming or production documentation at the time the VECP is accepted... low-rate-initial-production or early production units, the contracting officer must modify the clause...

  20. Army Contracting Command Workforce Model Analysis

    Science.gov (United States)

    2012-02-09

    Empresas in Madrid. His Air Force contracting experience includes F-22 Fighter, C-17 Cargo Transport , and a contingency deployment as director of Joint...and the University of Maryland (University College). He has also conducted visiting seminars at American University in Cairo and Instituto de ...the long total process times that are sometimes involved in weapon system contracting, such an assessment may equate to a de facto future work

  1. Protein kinase activity associated with Fcγ/sub 2a/ receptor of a murine macrophage like cell line, P388D1

    International Nuclear Information System (INIS)

    Hirata, Y.; Suzuki, T.

    1987-01-01

    The properties of protein kinase activity associated with Fc receptor specific for IgG/sub 2a/(Fcγ/sub 2a/R) of a murine macrophage like cell line, P388D 1 , were investigated. IgG/sub 2a/-binding protein isolated from the detergent lysate of P388D 1 cells by affinity chromatography of IgG-Sepharose was found to contain four distinct proteins of M/sub r/ 50,000, 43,000, 37,000, and 17,000, which could be autophosphorylated upon incubation with [γ- 32 P]ATP. The autophosphorylation of Fcγ/sub 2a/ receptor complex ceased when exogenous phosphate acceptors (casein or histone) were added in the reaction mixture. Phosphorylation of casein catalyzed by Fcγ/sub 2a/ receptor complex was dependent on casein concentration, increased with time or temperature, was dependent on the concentration of ATP and Mg 2+ , and was maximum at pH near 8. Casein phosphorylation was significantly inhibited by a high concentration of Mn 2+ or KCl or by a small amount of heparin and was enhanced about 2-fold by protamine. Casein kinase activity associated with Fcγ/sub 2a/ receptor used ATP as substrate with an apparent K/sub m/ of 2 μM as well as GTP with an apparent K/sub m/ of 10 μM. Prior heating (60 0 C for 15 min) or treatment with protease (trypsin or Pronase) of Fcγ/sub 2a/ receptor complex almost totally abolished casein kinase activity. Thin-layer chromatography of a partial acid hydrolysate of the phosphorylated casein showed that the site of phosphorylation is at a seryl residue. These results suggest that Fcγ 2 /sub a/ receptor forms a molecule complex with protein kinase, whose characteristics resemble those of type II casein kinase but are different from those of cyclic nucleotide dependent protein kinase or from those of C protein kinase

  2. Adaptabilidade e estabilidade de cultivares de soja em cinco épocas de plantio no cerrado de Rondônia

    Directory of Open Access Journals (Sweden)

    Prado Eloi Elias do

    2001-01-01

    Full Text Available Este trabalho teve o objetivo de avaliar o desempenho, a estabilidade e a adaptabilidade de 21 cultivares de soja (Glycine max (L. Merrill, em cinco épocas de plantio no cerrado de Rondônia. O delineamento experimental foi blocos ao acaso, com três repetições. Os ensaios foram conduzidos no ano de 1996/97 pelo Centro de Pesquisa Agroflorestal de Rondônia, no Campo Experimental de Vilhena em Rondônia, RO. Os métodos utilizados apresentaram concordância entre os resultados alcançados, sendo que o comportamento das cultivares nas diferentes épocas de semeadura pode ser representado por um modelo linear. O coeficiente de resposta linear beta1i não apresentou diferença significativa (P<0,05 da unidade pelo teste t (beta1i = 1 em todas as cultivares testadas. As cultivares que apresentaram desvios de regressão sigma²(d i significativos (P<0,05 foram MT/BR50 e EMBRAPA 31, com R² = 58,56% e 74,43%, respectivamente. As demais cultivares não apresentaram desvios de regressão significativos.

  3. 48 CFR 970.3102-05-28 - Other business expenses.

    Science.gov (United States)

    2010-10-01

    ..., but not limited to, service charges, the cost of disbursing cash, necessary guards, cashiers, and... AGENCY SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05-28 Other business expenses. (i) Reasonable costs associated with the establishment and...

  4. Activatory and inhibitory Fcγ receptors augment rituximab-mediated internalization of CD20 independent of signaling via the cytoplasmic domain.

    Science.gov (United States)

    Vaughan, Andrew T; Chan, Claude H T; Klein, Christian; Glennie, Martin J; Beers, Stephen A; Cragg, Mark S

    2015-02-27

    Type I anti-CD20 mAb such as rituximab and ofatumumab engage with the inhibitory FcγR, FcγRIIb on the surface of B cells, resulting in immunoreceptor tyrosine-based inhibitory motif (ITIM) phosphorylation. Internalization of the CD20·mAb·FcγRIIb complex follows, the rate of which correlates with FcγRIIb expression. In contrast, although type II anti-CD20 mAb such as tositumomab and obinutuzumab also interact with and activate FcγRIIb, this interaction fails to augment the rate of CD20·mAb internalization, raising the question of whether ITIM phosphorylation plays any role in this process. We have assessed the molecular requirements for the internalization process and demonstrate that in contrast to internalization of IgG immune complexes, FcγRIIb-augmented internalization of rituximab-ligated CD20 occurs independently of the FcγRIIb ITIM, indicating that signaling downstream of FcγRIIb is not required. In transfected cells, activatory FcγRI, FcγRIIa, and FcγRIIIa augmented internalization of rituximab-ligated CD20 in a similar manner. However, FcγRIIa mediated a slower rate of internalization than cells expressing equivalent levels of the highly homologous FcγRIIb. The difference was maintained in cells expressing FcγRIIa and FcγRIIb lacking cytoplasmic domains and in which the transmembrane domains had been exchanged. This difference may be due to increased degradation of FcγRIIa, which traffics to lysosomes independently of rituximab. We conclude that the cytoplasmic domain of FcγR is not required for promoting internalization of rituximab-ligated CD20. Instead, we propose that FcγR provides a structural role in augmenting endocytosis that differs from that employed during the endocytosis of immune complexes. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  5. 17 CFR 9.7 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 9.7 Section 9.7... DISCIPLINARY, ACCESS DENIAL OR OTHER ADVERSE ACTIONS General Provisions § 9.7 Settlement. At any time before... accordance with § 9.20, the parties may file a stipulation for dismissal based on a settlement agreement...

  6. 29 CFR 97.33 - Supplies.

    Science.gov (United States)

    2010-07-01

    ... aggregate fair market value upon termination or completion of the award, and if the supplies are not needed... 29 Labor 1 2010-07-01 2010-07-01 true Supplies. 97.33 Section 97.33 Labor Office of the Secretary... GOVERNMENTS Post-Award Requirements Changes, Property, and Subawards § 97.33 Supplies. (a) Title. Title to...

  7. CAPACIDADE DE DESENVOLVER TRABALHO FÍSICO PROGRESSIVO EM CONDIÇÕES DE HIPOTERMIA BRANDA

    Directory of Open Access Journals (Sweden)

    Bárbara Regina Alvarez

    2008-07-01

    Full Text Available O propósito deste estudo determinar, em 12 voluntários do Grupo de Busca e Salvamento da Polícia Militar de Santa Catarina, a capacidade de desenvolver trabalho físico na bicicleta ergométrica (cargas escalonadas de 50, 100 e 150 watt em condições ambientais neutras (28 graus e subnormal (20 graus, com varredura ampliada da temperatura cutânea (7 sensores periféricos, da temperatura central (sensor piloto e da temperatura ambiental (sensor referência, a estimativa do VO2 máximo foi efetuada com auxílio do nomograma desenvolvido por Astrand (1960, empregando um cicloergômetro de frenagem magnética da FUNBEC. Já o % de mobilização do VO2 max foi predito pela equação proposta por Katch (1978, empregando o % da mobilidade da FC. Os dados foram tratados através da ferramenta eletrônica MICROSTAT, empregando o artifício estático "t" de student monocaudal. Foi observada uma variação significativa (P < 0.05 na temperatura de repouso entre as duas condições (%= -0.52. Considerando a estimativa do valor padrão (3 watt/Kg, a PWC170 apresentou uma diferença significativa entre médias (%=-14.29. A sobreposição dos pontos térmicos evidenciou um marcado estado de equilíbrio na FC nos minutos finais de cada desempenho biológico, corroborando a hipótese de ajustamento imediato dos sistemas cardiorrespiratório e metabólico para atender a demanda tecidual de oxigênio e nutrientes. Para estudos complementares, sugerimos a utilização da banda inferior da zona hipotérmica (flutuação de 20 a 5 graus Celsius para que o impacto da condição subnormal produza alterações mais importantes na temperatura central.

  8. Engineering and Statistical Research Institute contract reports to May, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Thuns, A; Morrison, B A

    1983-06-01

    The purpose of this publication is to provide information on certain Canadian agricultural research contracts which are completed, published and available for loan. These contracts reports are documentation of research contracted out to non-federal government agencies, universities or individuals. Reports on contracts under the control of the Engineering and Statistical Research Institute are written by the contractor, and are reviewed by the scientific authority. Some reports date back to 1973, when the initial contracting program began. The first program was called DREAM (Development, Research, and Evaluation in Agricultural Mechanization). In 1977-78, projects under the Energy in Agriculture program were added. This was the beginning of the AERD (Agricultural Enginering Research and Development) program. In 1981, energy research had expanded and came under a separate progam called ERDAF (Energy Research and Development in Agriculture and Food). The remaining contract work stayed with the AERD program. This publication lists only contracts completed having final reports, and available contract reports with separate listings sorted by contract file number, title, author or subject.

  9. Desempenho de bezerros recebendo silagens de sorgo ou de cana-de-açúcar como únicos alimentos volumosos

    Directory of Open Access Journals (Sweden)

    Edison Valvasori

    1998-01-01

    Full Text Available Silagens de sorgo granífero (tratamento SS e de cana-de-açúcar (tratamento SC, suplementadas com farelo de algodão para ajustar o nível protéico das dietas a 16%, foram fornecidas a bezerros da raça Holandesa variedade malhada de preto, para avaliação de seus desempenhos em termos de consumo de alimentos, ganhos de peso e conversões alimentares. Os animais apresentaram média de peso de 97,7 ± 1,0 kg ao início do período de adaptação, de 14 dias, ao qual seguiu-se período experimental de 70 dias. Os resultados mostraram que o tratamento com silagem de sorgo granífero foi superior ao com cana-de-açúcar (p;0,05.

  10. Substituição do farelo de soja por uréia ou amiréia para vacas em final de lactação - DOI: 10.4025/actascianimsci.v27i2.1234 Replacement of soybean meal by urea or starea in diets for late lactation cows urea and starea in diets for lactation cows - DOI: 10.4025/actascianimsci.v27i2.1234

    Directory of Open Access Journals (Sweden)

    Hugo Imaizumi

    2005-03-01

    Full Text Available Dois experimentos foram conduzidos para estudar a substituição parcial do farelo de soja (FS por uréia, na forma extrusada com milho (A150S ou convencional (U. No experimento 1 utilizou-se 38 vacas em final de lactação. A substituição não afetou (P > 0,05 a produção de leite e leite corrigido para gordura, o teor e produção de proteína, a produção de sólidos totais e as concentrações plasmáticas de glicose e N-uréico. O tratamento U aumentou (P 0,05. A substituição parcial do farelo de soja por uréia é uma alternativa viável para vacas em final de lactação. O processamento da uréia não apresentou vantagens em relação à forma convencionalTwo trials were conducted to study the partial replacement of soybean meal (FS by urea (U in diets for late lactation cows. Conventional urea was compared to extruded urea (A150S. In trial 1, 38 late lactation cows were used. The partial replacement of soybean meal by urea sources or the urea processing did not affect milk and 3.5% FCM yields, protein content and yield, total solids yield, and plasma urea N and glucose. Feeding U increased milk fat and total solids content. In trial 2, five dry cows, fitted with ruminal canulas were used. Dry matter intake, total tract nutrient digestibility’s, rumen VFA molar concentration, plasma urea-N and plasma glucose were not affected by treatments (p > 0.05. The partial replacement of soybean meal by urea is an alternative to reduce costs of diets for late lactating cows. Extrusion of urea did not show any advantage compared to conventional urea

  11. Fc engineering of anti-Nectin-2 antibody improved thrombocytopenic adverse event in monkey.

    Directory of Open Access Journals (Sweden)

    Tsutomu Oshima

    Full Text Available Nectin-2 is a transmembrane glycoprotein which is involved in the process of Ca2+-independent cell-cell adhesion. In our previous study, we have demonstrated that Nectin-2 is over-expressed in breast and ovarian cancer tissues by using gene expression analysis and immunohistochemistry. Furthermore, we discovered multiple anti-Nectin-2 fully human monoclonal antibodies which inhibited tumor growth in in vivo subcutaneous xenograft models with antibody-dependent cellular cytotoxicity (ADCC as the principal mechanism of action. In this report, we assessed the toxicity of Y-443, a fully human IgG1/kappa anti-Nectin-2 monoclonal antibody exhibiting strong in vitro ADCC and in vivo anti-tumor activity in cynomolgus monkeys (Macaca fascicularis (Cynos. Unexpectedly, upon administration, Y-443 induced strong thrombocytopenia through Nectin-2 expressed on Cyno platelets, presumably followed by phagocytosis in the mononuclear phagocytic system. To mitigate the adverse safety profile, we mutated the Fc region of Y-443 to reduce the Fc binding activity to Fcγ receptor I, which is the primary receptor for phagocytosis on macrophages. Moreover, we further engineered the Fc through defucosylation to maintain ADCC activity. The resultant Fc engineered antibody, termed Y-634, demonstrated diminished thrombocytopenia in Cyno toxicological studies and maintained anti-tumor activity in a mouse xenograft model. These findings suggest that Y-634 may have a therapeutic potential for the treatment of Nectin-2 positive cancers, and moreover, Fc engineering is a potential mitigation strategy to ameliorate safety liabilities in antibody induced thrombocytopenia while maintaining antibody potency.

  12. Correlating the Impact of Well-Defined Oligosaccharide Structures on Physical Stability Profiles of IgG1-Fc Glycoforms.

    Science.gov (United States)

    More, Apurva S; Toprani, Vishal M; Okbazghi, Solomon Z; Kim, Jae H; Joshi, Sangeeta B; Middaugh, C Russell; Tolbert, Thomas J; Volkin, David B

    2016-02-01

    As part of a series of articles in this special issue describing 4 well-defined IgG1-Fc glycoforms as a model system for biosimilarity analysis (high mannose-Fc, Man5-Fc, GlcNAc-Fc and N297Q-Fc aglycosylated), the focus of this work is comparisons of their physical properties. A trend of decreasing apparent solubility (thermodynamic activity) by polyethylene glycol precipitation (pH 4.5, 6.0) and lower conformational stability by differential scanning calorimetry (pH 4.5) was observed with reducing size of the N297-linked oligosaccharide structures. Using multiple high-throughput biophysical techniques, the physical stability of the Fc glycoproteins was then measured in 2 formulations (NaCl and sucrose) across a wide range of temperatures (10°C-90°C) and pH (4.0-7.5) conditions. The data sets were used to construct 3-index empirical phase diagrams and radar charts to visualize the regions of protein structural stability. Each glycoform showed improved stability in the sucrose (vs. salt) formulation. The HM-Fc and Man5-Fc displayed the highest relative stability, followed by GlcNAc-Fc, with N297Q-Fc being the least stable. Thus, the overall physical stability profiles of the 4 IgG1-Fc glycoforms also show a correlation with oligosaccharide structure. These data sets are used to develop a mathematical model for biosimilarity analysis (as described in a companion article by Kim et al. in this issue). Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

  13. Efecto del BiFeO3 en las propiedades del sistema ferroeléctrico libre de plomo K0.5Na0.5NbO3

    Directory of Open Access Journals (Sweden)

    Pinza, Billy N.

    2014-10-01

    Full Text Available In order to obtain a multiferroic material, powders and ceramic pieces, of the lead-free ferroelectric (1-x-x K0.5Na0.5NbO3 (Bi0.8La0.2FeO3 (KNN-BLFO (x = 0.005, 0.010, 0.015, 0.020, 0.025 system were prepared using the combustion reaction method. For all the studied perovskite phase, stoichiometries feature KNN was obtained. Using characterisation techniques, it was determined that the BLFO is incorporated in the crystal structure of KNN without modifying present a phase transition. Moreover, It was also proved that the addition of the BLFO to KNN, alters the particle size of the obtained powders and generates magnetic behavior in this ferroelectric.En la búsqueda de un material multiferroico, se prepararon polvos y piezas cerámicas del sistema ferroeléctrico libre de plomo (1-xK0.5Na0.5NbO3-x(Bi0.8La0.2FeO3 (KNN-BLFO (x=0.005, 0.010, 0.015, 0.020, 0.025, mediante el método de reacción por combustión. Para todas las estequiometrias estudiadas se obtuvo la fase perovskita característica del KNN. Con las diferentes caracterizaciones se determinó que el BLFO se incorpora en la estructura cristalina del KNN modificándola sin que se presente una transición de fase. Se comprobó además que la adición del BLFO al KNN, altera el tamaño de partícula de los polvos obtenidos y genera comportamiento magnético en este ferroeléctrico.

  14. fcGENE: a versatile tool for processing and transforming SNP datasets.

    Directory of Open Access Journals (Sweden)

    Nab Raj Roshyara

    Full Text Available Modern analysis of high-dimensional SNP data requires a number of biometrical and statistical methods such as pre-processing, analysis of population structure, association analysis and genotype imputation. Software used for these purposes often rely on specific and incompatible input and output data formats. Therefore extensive data management including multiple format conversions is necessary during analyses.In order to support fast and efficient management and bio-statistical quality control of high-dimensional SNP data, we developed the publically available software fcGENE using C++ object-oriented programming language. This software simplifies and automates the use of different existing analysis packages, especially during the workflow of genotype imputations and corresponding analyses.fcGENE transforms SNP data and imputation results into different formats required for a large variety of analysis packages such as PLINK, SNPTEST, HAPLOVIEW, EIGENSOFT, GenABEL and tools used for genotype imputation such as MaCH, IMPUTE, BEAGLE and others. Data Management tasks like merging, splitting, extracting SNP and pedigree information can be performed. fcGENE also supports a number of bio-statistical quality control processes and quality based filtering processes at SNP- and sample-wise level. The tool also generates templates of commands required to run specific software packages, especially those required for genotype imputation. We demonstrate the functionality of fcGENE by example workflows of SNP data analyses and provide a comprehensive manual of commands, options and applications.We have developed a user-friendly open-source software fcGENE, which comprehensively supports SNP data management, quality control and analysis workflows. Download statistics and corresponding feedbacks indicate that software is highly recognised and extensively applied by the scientific community.

  15. LIMIAR ANAERÓBIO EM EXERCÍCIOS RESISTIDOS: ANÁLISE DE ASPECTOS METODOLÓGICOS E HEMODINÂMICOS

    Directory of Open Access Journals (Sweden)

    Lucas Dantas Maia Forte

    2015-12-01

    Full Text Available Introdução A determinação do limiar anaeróbio em exercícios resistidos tem sido tema de diversos estudos. No entanto, o impacto desta avaliação sobre os parâmetros hemodinâmicos de pressão arterial e frequência cardíaca ainda é desconhecido. Objetivo Comparar a estimativa do limiar anaeróbio (LAn obtido em teste e reteste de protocolo incremental nos exercícios resistidos de supino reto (SR e rosca direta (RD e analisar o comportamento das variáveis hemodinâmicas de frequência cardíaca (FC, pressão arterial sistólica (PAS e diastólica (PAD durante protocolo de cargas incrementais. Métodos Oito voluntários do sexo masculino praticantes de treinamento resistido foram recrutados e realizaram quatro testes de cargas incrementais (dois no SR e dois na RD em dias distintos para a determinação do LAn. Durante cada teste, as variáveis de lactato sanguíneo, FC, PAS e PAD foram mensuradas ao final de cada estágio. Resultados Os valores do LAn expressos em porcentagens da carga máxima (1-RM para o SR em teste e reteste foram de 19,7±4,0% e 18,4±3,4% respectivamente e para RD de 17,7±3,4% e 19,4±3,1% respectivamente, não sendo identificadas diferenças estatísticas entre estas. No decorrer dos testes, a FC variou em média entre 90 e 135bpm para SR e entre 98 a 150bpm para RD. Apenas a PAS se alterou no decorrer dos testes, variando entre 111,8 a 123,3mmHg no SR e entre 119,4 a 141,3mmHg na RD. Conclusão Tais resultados nos sugerem que a intensidade relativa ao LAn não é diferente para SR ou RD em teste ou reteste. Não obstante, apesar de diferenças nos comportamentos hemodinâmicos entre os tipos de exercícios (SR vs. RD, os valores de FC e PAS se elevaram dentro de limites clinicamente aceitáveis, como sugerido pela literatura.

  16. Estudio experimental para la obtención de dióxido de titanio a partir de ilmenita vía acido clorhídrico

    Directory of Open Access Journals (Sweden)

    Pedro Hernández

    2010-07-01

    Full Text Available Una ilmenita colombiana con un tamaño de partícula que pasa malla 100, se lixivió con soluciones de ácido clorhídrico cuyas concentraciones oscilaron entre 17% y el 41% (p/v, en relaciones estequiométricas de 1.0 a 2.5 veces, temperaturas entre 75°C y lOrC y tiempos de 1 a 5 horas. La mezcla resultante se filtró obteniéndose un licor que contenía entre 70% y 80% del TiO^ presente en la ilmenita, el cual se hidrolizó térmicamente. El producto final fue obtenido por calcinación a 900°C y posee un contenido de TiO^ mayor del 97%.

  17. To tender, re-negotiate or partner: Strategies for contracting service companies

    International Nuclear Information System (INIS)

    Gouldie, T.A.

    1994-01-01

    The contracting of oilfield service companies by petroleum exploration and production operating companies is different than the contracting of civil engineering, construction or other project-oriented contractors. The relationship between operating companies and oilfield service companies has had a long and unique history which has evolved since the first oil wells were drilled over a century ago. The process of contracting service companies by operating companies for petroleum exploration and production work can be split into three distinct stages: (1) decide what it is that should be contracted out and what should be kept in house; (2) determine the method to use to select the contractor(s) to perform the work; and (3) agree to the contractual structure to best reflect the relationship the operating company and the service company with to initiate and maintain. As there are ongoing changes to the business structures and corporate thinking of both operating and service companies, there are also evolving changes to what are considered core businesses and the methods of selecting and contracting service companies by operating companies. Operating companies are recognizing the high costs of tendering for contractor services in terms of personnel time and administrative effort, and are relying more on negotiating and rolling-over existing contracts with their suitable, capable contractors. Partnering, in its many forms and levels, is increasingly being recognized as a useful method to get better work done at cheaper overall costs

  18. Analysis of cardiovascular system responses to forced vital capacity in COPD Análise das respostas do sistema cardiovascular ao teste de capacidade vital forçada na DPOC

    Directory of Open Access Journals (Sweden)

    Felipe A. R. Mendes

    2011-04-01

    Full Text Available BACKGROUND: The forced vital capacity (FVC test is routinely performed to evaluate pulmonary function in patients with chronic obstructive pulmonary disease (COPD. However, the influence of the FVC maneuver on the cardiovascular system of patients with COPD is poorly understood. OBJECTIVES: To analyze the behavior of heart rate (HR, blood pressure (BP and heart rate variability (HRV during the FVC test in COPD patients. METHODS: Nineteen men with COPD (72±7 years, GOLD stage I=3, II=5, III=7 and IV=4 patients performed the FVC test while having their HR monitored. HRV was assessed in time (rMSSD and frequency domains (LF, HF and LF/HF at rest, before and after the best FVC maneuver. BP was measured at rest, immediately before and at the end of the test, as well as 10 minutes after the end of the test. RESULTS: At the beginning of the FVC maneuver, HR decreased (pCONTEXTUALIZAÇÃO: O teste de capacidade vital forçada (CVF é rotineiramente realizado na avaliação da função pulmonar de pacientes com doença pulmonar obstrutiva crônica (DPOC. Entretanto, permanece pouco compreendida a influência do teste de CVF sobre o sistema cardiovascular de pacientes com DPOC. OBJETIVOS: Analisar o comportamento da frequência cardíaca (FC, pressão arterial (PA e variabilidade da frequência cardíaca (VFC no teste de CVF na DPOC. MÉTODOS: Dezenove homens com DPOC (72 ± 7 anos, no estágio de gravidade GOLD I=3, II=5, III=7 e IV=4 pacientes realizaram a manobra de CVF e tiveram sua FC monitorada durante todo o exame, e a VFC analisada nos domínios do tempo (rMSSD e da frequência (BF, AF e BF/AF durante o repouso, antes e após a melhor manobra de CVF. A PA foi analisada no repouso, imediatamente ao final da manobra de CVF e 10 minutos após o término de todos os testes. RESULTADOS: Ao início da manobra de CVF, a FC reduziu (p<0,001 e, em seguida, aumentou progressivamente até o final do teste (p<0,001. Após término da manobra, a FC continuou

  19. Field induced ferromagnetic fraction enlargement in phase separated La_0.5Ca_0.5MnO_3

    Science.gov (United States)

    Ghivelder, Luis; Freitas, R. S.; Sacanel, J.; Parisi, F.; Levy, P.

    2001-03-01

    A systematic study of the magnetic and transport properties of a series of phase separated La_0.5Ca_0.5MnO3 compounds is reported. The investigated samples all have the same composition but different grain sizes, which modifies the volume fraction of the coexisting ferromagnetic (FM) and antiferromagnetic charge-ordered (AFM-CO) phases. Magnetoresistance and magnetization measurements were performed with two different experimental procedures: a standard field-cooled cooling (FC) mode, and a second method in which the field is turned on only while measuring each data point, and switched off while cooling the samples. Magnetization and magnetoresistance measurements display big differences when comparing the data obtained with the different procedures. The overall results are interpret in terms of a field induced FM fraction enlargement. In transport measurements this effect yield a percolative transition. Magnetization data shows evidence for the formation of AFM-CO regions within the FM phase. * e-mail: luisghiv@if.ufrj.br

  20. Intramuscular fatty acid metabolism in contracting and non-contracting human skeletal muscle

    DEFF Research Database (Denmark)

    Sacchetti, M; Saltin, B; Osada, T

    2002-01-01

    The present study was undertaken to investigate the fate of blood-borne non-esterified fatty acids (NEFA) entering contracting and non-contracting knee extensor muscles of healthy young individuals. [U-(13)C]-palmitate was infused into a forearm vein during 5 h of one-legged knee extensor exercis...... and degraded and that the metabolic fate of plasma NEFA entering the muscle is influenced by muscle contraction, so that a higher proportion is directed towards oxidation at the expense of storage in mTAG.......The present study was undertaken to investigate the fate of blood-borne non-esterified fatty acids (NEFA) entering contracting and non-contracting knee extensor muscles of healthy young individuals. [U-(13)C]-palmitate was infused into a forearm vein during 5 h of one-legged knee extensor exercise.......05) in the contracting muscle, whereas it was unchanged in the non-contracting muscle. The uptake of plasma NEFA, as well as the proportion directed towards oxidation, was higher in the exercising compared to the non-exercising leg, whereas the rate of palmitate incorporation into mTAG was fourfold lower (0.70 +/- 0...

  1. Avaliação da bupivacaína hipobárica a 0,5% na raquianestesia Evaluación de la bupivacaína hipobárica a 0,5% en la anestesia espinal Evaluation of 0.5% hypobaric bupivacaine in spinal anesthesia

    Directory of Open Access Journals (Sweden)

    Marcelo Cursino Pinto dos Santos

    2007-08-01

    paciente o no. Uno de los factores es la densidad del anestésico con relación al líquor, interfiriendo en el número de dermátomos bloqueados y consecuentemente en el nivel del bloqueo simpático y la disminución de la presión arterial (PA. El objetivo del estudio fue el de evaluar la dispersión de la bupivacaína hipobárica a 0,5%, preparada asépticamente en laboratorio y con una densidad controlada y uniforme. MÉTODO: Treinta pacientes, ASA I, II o III, con edad entre 18 y 60 anos, sin comorbidades circulatorias, sometidos a operaciones ortopédicas en el miembro inferior participaron en el estudio. Se sedaron con diazepam 0,03 mg.kg-1, posicionados en decúbito lateral con el lado a ser operado para arriba, y puncionados entre L3-L4, con aguja de Quincke 27G, siendo estandarizados con bisel y a velocidad de inyección. Se evaluaron los niveles sensitivos y motor (escala modificada de Bromage. RESULTADOS: Al final de la operación, de los pacientes (6,6% no presentaron bloqueo motor clasificado como 3 en la escala de Bromage, con el bloqueo sensitivo variando entre T4 y T12. Solamente 12,9% de los pacientes presentaron nivel sensitivo considerado "alto" para la operación propuesta (por encima de T6. La disminución de la presión arterial fue significativa bajo el punto de vista estadístico, sin llegar al 20% por debajo de los valores basales, por tanto sin significancia clínica. La variación de la frecuencia cardiaca no fue significativa. CONCLUSIONES: La bupivacaína hipobárica a 0,5% mostró ser una opción segura, y con pocas repercusiones hemodinámicas para operaciones ortopédicas en los miembros inferiores. La duración promedio observada, de 250 minutos, posibilita la realización de procedimientos ortopédicos de medio porte.BACKGROUND AND OBJECTIVES: Spinal anesthesia may cause hemodynamic changes due to factors related or not to the patient. The density of the anesthetic compared to the CSF, which interferes with the number of dermatomes

  2. Case histories of West Valley spent fuel shipments: Final report

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    In 1983, NRC/FC initiated a study on institutional issues related to spent fuel shipments originating at the former spent fuel processing facility in West Valley, New York. FC staff viewed the shipment campaigns as a one-time opportunity to document the institutional issues that may arise with a substantial increase in spent fuel shipping activity. NRC subsequently contracted with the Aerospace Corporation for the West Valley Study. This report contains a detailed description of the events which took place prior to and during the spent fuel shipments. The report also contains a discussion of the shipment issues that arose, and presents general findings. Most of the institutional issues discussed in the report do not fall under NRC's transportation authority. The case histories provide a reference to agencies and other institutions that may be involved in future spent fuel shipping campaigns. 130 refs., 7 figs., 19 tabs.

  3. Case histories of West Valley spent fuel shipments: Final report

    International Nuclear Information System (INIS)

    1987-01-01

    In 1983, NRC/FC initiated a study on institutional issues related to spent fuel shipments originating at the former spent fuel processing facility in West Valley, New York. FC staff viewed the shipment campaigns as a one-time opportunity to document the institutional issues that may arise with a substantial increase in spent fuel shipping activity. NRC subsequently contracted with the Aerospace Corporation for the West Valley Study. This report contains a detailed description of the events which took place prior to and during the spent fuel shipments. The report also contains a discussion of the shipment issues that arose, and presents general findings. Most of the institutional issues discussed in the report do not fall under NRC's transportation authority. The case histories provide a reference to agencies and other institutions that may be involved in future spent fuel shipping campaigns. 130 refs., 7 figs., 19 tabs

  4. Efficacy and tolerability of fixed-combination brinzolamide/timolol in Latin American patients with open-angle glaucoma or ocular hypertension previously on brimonidine/timolol fixed combination.

    Science.gov (United States)

    Alezzandrini, Arturo; Hubatsch, Douglas; Alfaro, Rene

    2014-09-01

    Fixed-combination glaucoma medications are commonly used to achieve target intraocular pressure (IOP) reduction in patients uncontrolled with monotherapy; however, ocular discomfort associated with eye drops can decrease adherence. This study assessed the efficacy and tolerability of twice-daily fixed-combination brinzolamide 1%/timolol 0.5% (BRINZ/TIM-FC) in Latin American patients transitioned from fixed-combination brimonidine 0.2%/timolol 0.5% (BRIM/TIM-FC) because of insufficient IOP control or treatment intolerance. This 8-week, open-label, prospective study was conducted at six sites in Argentina, Chile, and Mexico. Enrolled patients were aged ≥18 years with open-angle glaucoma (including primary, exfoliative, or pigment-dispersion glaucoma) or ocular hypertension with IOP of 19-35 mmHg in ≥1 eye at baseline (on BRIM/TIM-FC). Patients self-administered BRINZ/TIM-FC to both eyes at 8 a.m. and 8 p.m. daily for 8 weeks. The primary and secondary efficacy endpoints were mean IOP change from baseline at week 8 and percentage of patients achieving target IOP (≤18 mmHg) at week 8, respectively. Exploratory endpoints included patient and investigator preference for treatment at week 8. Adverse events (AEs) were assessed as the safety endpoint. Fifty patients (mean ± SD age, 66.7 ± 11.5 years) received BRINZ/TIM-FC, and 49 were included in the intent-to-treat population. Mean ± SD IOP was significantly reduced from baseline after 8 weeks of treatment with BRINZ/TIM-FC (-3.6 ± 3.0 mmHg; P Wilcoxon signed-rank test; 17.1% reduction). Overall, 55.3% of patients achieved IOP ≤18 mmHg at week 8. Significantly more patients (89.4%) and investigators (95.7%) preferred BRINZ/TIM-FC to BRIM/TIM-FC (both P test). Of the 13 AEs observed, 8 were related to BRINZ/TIM-FC; the most common treatment-related AEs were eye irritation (n = 4) and abnormal sensation in the eye (n = 2). BRINZ/TIM-FC provides an effective and well-tolerated treatment

  5. Minerals Industry' 97. Survey report

    International Nuclear Information System (INIS)

    1997-01-01

    The aim of this annual survey is to provide timely and accurate financial data such as production, price movements, profitability, distribution of assets by activity, employment and labour cost and taxation on the Australian minerals industry. It aims to facilitate more informed debate on the industry's role and importance in the economy. The report also includes information on the safety and health performance and overseas exploration expenditure of the minerals industry. This twenty-first survey relates to the year ended 30 June 1997. The proportion of activity covered in this year's survey is comparable with the 1996 survey. The mineral industry is defined as including exploration for, extraction and primary processing of minerals in Australia. The oil, gas, iron and steel industries are excluded. As for the uranium industry, increased mine capacity over the medium term saw a switch away from spot market purchases to long term contracts for uranium in 1996. This, coupled with announced releases from the US stockpile, saw downward pressure on spot market prices for uranium during 1996/97. The average spot market price for U 3 O 8 fell by an average of 6 percent during 1996/97 and was approximately 16 percent lower than three years ago. General uncertainty over the future profitability of coal industry is compounded by the likely softness of future coal prices

  6. HAL/S-FC compiler system functional specification

    Science.gov (United States)

    1974-01-01

    Compiler organization is discussed, including overall compiler structure, internal data transfer, compiler development, and code optimization. The user, system, and SDL interfaces are described, along with compiler system requirements. Run-time software support package and restrictions and dependencies are also considered of the HAL/S-FC system.

  7. Transition de dépiégeage élastique de vortex supraconducteurs*

    Directory of Open Access Journals (Sweden)

    Fily Yaouen

    2012-04-01

    Full Text Available We present 2D numerical simulation results of superconductor vortex lattices driven over a random disorder. The vortex dynamics at the depinning threshold Fc is studied at zero temperature in the case of weak disorder. The dynamics is elastic and the depinning transition is analysed in the framework of a second order phase transition where the velocity response v to the driving force F behaves like v ~ (F − Fcβ. The analysis of the critical region of several large lattice sizes leads to the result that β = 0.27 ± 0.04. Nous présentons des résultats de simulations numériques à deux dimensions sur des réseaux de vortex dans les supraconducteurs que l’on met en mouvement dans un potentiel aléatoire. On étudie la dynamique des vortex au seuil de dépiégeage Fc dans le cas d’un faible désordre à température nulle. Les régimes élastiques au seuil de dépiégeage sont analysés dans le cadre des transitions de phase continues (transitions du second ordre. La réponse en vitesse v à la force d’entraînement F se comporte comme v ~ (F − Fcβ au voisinage immédiat du seuil de dépiégeage. Dans la région critique obtenue pour différentes grandes tailles du système simulé, nous mesurons l’exposant critique β = 0.27 ± 0.04.

  8. Ligand binding and antigenic properties of a human neonatal Fc receptor with mutation of two unpaired cysteine residues

    DEFF Research Database (Denmark)

    Andersen, Jan T; Justesen, Sune; Fleckenstein, Burkhard

    2008-01-01

    knowledge gives incentives for the design of IgG and albumin-based diagnostics and therapeutics. To study FcRn in vitro and to select and characterize FcRn binders, large quantities of soluble human FcRn are needed. In this report, we explored the impact of two free cysteine residues (C48 and C251......) of the FcRn heavy chain on the overall structure and function of soluble human FcRn and described an improved bacterial production strategy based on removal of these residues, yielding approximately 70 mg.L(-1) of fermentation of refolded soluble human FcRn. The structural and functional integrity...... was proved by CD, surface plasmon resonance and MALDI-TOF peptide mapping analyses. The strategy may generally be translated to the large-scale production of other major histocompatibility complex class I-related molecules with nonfunctional unpaired cysteine residues. Furthermore, the anti-FcRn response...

  9. Physical environment and life expectancy at birth in Mexico: an eco-epidemiological study Ambiente físico y esperanza de vida al nacer en México: un estudio eco-epidemiológico

    Directory of Open Access Journals (Sweden)

    Alvaro J. Idrovo

    2011-06-01

    Full Text Available The objective of this ecological study was to ascertain the effects of physical environment on life expectancy at birth, using data from all 32 Mexican states. 50 environmental indicators with information about demography, housing, poverty, water, soils, biodiversity, forestry resources, and residues were included in exploratory factor analysis. Four factors were extracted: population vulnerability/susceptibility, and biodiversity (FC1, urbanization, industrialization, and environmental sustainability (FC2, ecological resilience (FC3, and free-plague environments (FC4. Using OLS regressions, FC2, FC3, and FC4 were found to be positively associated with life expectancy at birth, while FC1 was negatively associated. This study suggests that physical environment is an important macro-determinant of the health of the Mexican population, and highlights the usefulness of ecological concepts in epidemiological studies.Para indagar los efectos del ambiente físico sobre la esperanza de vida al nacer se diseñó un estudio ecológico con datos de los estados mexicanos. Cincuenta indicadores ambientales con información sobre demografía, vivienda, pobreza, agua, suelos, biodiversidad, recursos forestales y residuos fueron incluidos en un análisis factorial exploratorio. Cuatro factores fueron extraídos: vulnerabilidad/susceptibilidad poblacional y biodiversidad (FC1, urbanización, industrialización y sustentabilidad ambiental (FC2, resiliencia ecológica (FC3 y ambientes libres de plagas (FC4. En regresiones lineales se observó que FC2, FC3 y FC4 se asociaron positivamente con la esperanza de vida al nacer, mientras FC1 estuvo asociado negativamente. Este estudio sugiere que el ambiente físico es un macro-determinante importante de la salud poblacional mexicana, y muestra la utilidad de los conceptos ecológicos en estudios epidemiológicos.

  10. Choreographies and Behavioural Contracts on the Way to Dynamic Updates

    Directory of Open Access Journals (Sweden)

    Mario Bravetti

    2014-11-01

    Full Text Available We survey our work on choreographies and behavioural contracts in multiparty interactions. In particular theories of behavioural contracts are presented which enable reasoning about correct service composition (contract compliance and service substitutability (contract refinement preorder under different assumptions concerning service communication: synchronous address or name based communication with patient non-preemptable or impatient invocations, or asynchronous communication. Correspondingly relations between behavioural contracts and choreographic descriptions are considered, where a contract for each communicating party is, e.g., derived by projection. The considered relations are induced as the maximal preoders which preserve contract compliance and global traces: we show maximality to hold (permitting services to be discovered/substituted independently for each party when contract refinement preorders with all the above asymmetric communication means are considered and, instead, not to hold if the standard symmetric CCS/pi-calculus communication is considered (or when directly relating choreographies to behavioral contracts via a preorder, no matter the communication mean. The obtained maximal preorders are then characterized in terms of a new form of testing, called compliance testing, where not only tests must succeed but also the system under test (thus relating to controllability theory, and compared with classical preorders such as may/must testing, trace inclusion, etc. Finally, recent work about adaptable choreographies and behavioural contracts is presented, where the theory above is extended to update mechanisms allowing choreographies/contracts to be modified at run-time by internal (self-adaptation or external intervention.

  11. Espinha bífida aberta: achados ultra-sonográficos e presença de contrações uterinas na predição da evolução motora neonatal Open spina bifida: antenatal ultrasound findings and uterine contractions as predictors of the neonatal neuromotor outcome

    Directory of Open Access Journals (Sweden)

    Wagner Jou Hisaba

    2003-07-01

    Full Text Available OBJETIVO: avaliar a influência das alterações ultra-sonográficas pré-natais e das contrações uterinas de trabalho de parto na evolução motora neonatal em fetos portadores de espinha bífida aberta. MÉTODOS: foram analisados fetos portadores de espinha bífida aberta. Estes fetos foram acompanhados nos serviços de Medicina Fetal do Hospital São Paulo (Universidade Federal de São Paulo e do Hospital e Maternidade Santa Joana. Todos os partos foram realizados nestes serviços e a avaliação neonatal foi realizada pela equipe de Neurocirurgia comum a ambas as instituições Foi observada a influência das alterações ultra-sonográficas (macrocrania, microcrania, nível da falha de fechamento da coluna, pé torto e tipo de apresentação fetal na força muscular de membros inferiores no período neonatal. Foi analisada, também, a influência das contrações uterinas sobre a movimentação dos membros inferiores. Todos os partos foram realizados por cesárea. Foram utilizados os testes de c² e Fisher para comparações categóricas, com pPURPOSE: to determine whether prenatal sonographic findings and uterine contractions can predict neonatal motor outcome in fetuses with open spina bifida. METHODS: we evaluated retrospectively 53 fetuses with open spina bifida from 1993 to 2001. These fetuses were born and followed-up at the fetal medicine units of the Hospital São Paulo ("Universidade Federal de São Paulo" and the "Hospital Santa Joana". The influence of the alterations observed through ultrasound scan on neonatal muscular strength (macrocrania, microcrania, level of the spinal column opening, clubfoot and type of fetus position was evaluated. The influence of uterine contractions on neonatal motor outcome was also evaluated. All deliveries were made through cesarian section. c² and Fisher tests were used for categorical comparisons. A p<0.05 was considered significant. RESULTS: Fifty-three cases of isolated open spina bifida

  12. A suplementação de ácidos graxos ômega 3 e triglicérides de cadeia média não alteram os indicadores metabólicos em um teste de exaustão La suplementacion de ácidos grasos omega 3 en los trigliceridos de cadena media como alteración en los indicadores metabólicos en un test de agotamiento The supplementation of omega-3 lipids and medium chain triglicerides do not affect metabolic indicators in the exhaustion test

    Directory of Open Access Journals (Sweden)

    Carlos Alexandre Fett

    2004-02-01

    Full Text Available PROPÓSITO: Este estudo compara os efeitos do treinamento de força (TF com ou sem a suplementação de lipídios ômega 3 (W-3 ou triglicérides de cadeia média (TCM, nos indicadores metabólicos em um teste de exaustão (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 anos de idade; 82,6 ± 10kg e grupo TCM (GTCM: n = 5, 18,8 ± 1,3 ano de idade; 74,6 ± 9,7kg com 11 meses mínimos em TF. Houve dois momentos de TE: depois de 28 dias somente com TF e coletas de sangue antes (M1a e após (M1d, e após mais 28 dias de TF mais a suplementação com W-3 ou TCM e repetindo o mesmo procedimento (M2a e M2d. RESULTADOS: O hematócrito (Ht, osmolalidade (Os, sódio (Na+ e pressão de dióxido de carbono (PCO2 não tiveram mudanças significativas em nenhum momento, grupo ou D M2 (P > 0,05. A pressão de oxigênio (PO2 aumentou significativamente após TE nos dois momentos e grupos (P PROPÓSITO: Este estudio compara los efectos de entrenamiento de fuerza (TF con o sin la suplementación de lípidos omega 3 (W-3 o triglicéridos de cadena media (TCM, los indicadores metabólicos en un test de agotamiento (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 años de idade; 82,6 ± 10 kg y grupo TCM (GTCM: n = 5, 18,8 ± 1,3 año de edad; 74,6 ± 9,7 kg con 11 meses mínimos en TF. Hubo 2 momentos de TE: después de 28 días solamente con TF y colectas de sangre antes (M1a y después (M1d, y después de mas de 28 días de TF más la suplementación con W-3 o TCM y repitiendo el mismo procedimiento (M2a e M2d. RESULTADOS: El hematocrito (Ht, osmolalidad (Os, sodio (Na+ y presión de dióxido de carbono (PCO2 no tuvieron cambios significativos en ningún momento, grupo de D M2 (P > 0,05. La presión de oxígeno (PO2 aumentó significativamente después TE los dos momentos y grupos (P OBJECTIVE: This study compares the effects of strength training (ST with or without supplementation of omega-3 lipids (W-3 or medium chain triglycerides (MCT in metabolic

  13. Efeito da adição de feno de catingueira (Caesalpinea bracteosa na ração sobre o balanço de energia e de nitrogênio em ovinos morada nova Effect of vatingueira hay (Caesalpinea Bracteosa adition on apparent nitrogen and energy balance by morada nova sheep

    Directory of Open Access Journals (Sweden)

    Severino Gonzaga Neto

    2004-10-01

    Full Text Available Objetivando avaliar o efeito da adição de feno de catingueira (FC sobre os balanços de nitrogênio e de energia em ovinos Morada Nova, foram utilizados 15 animais machos, castrados, durante 22 dias. O delineamento estatístico foi inteiramente casualizado, com três tratamentos e cinco repetições. Os tratamentos consistiram da inclusão de 0, 50 e 100% de FC à ração, na base da matéria seca. Os níveis de inclusão do FC às dietas não influenciaram nenhum dos parâmetros de balanço de nitrogênio. A perda média total de nitrogênio foi de 75,60% do ingerido e através da urina, de 61,31%. Não se observou efeito dos níveis de inclusão de FC sobre os parâmetros de balanço de energia, exceto para a energia bruta perdida pelas fezes, que diminuiu linearmente, à medida que se aumentou a participação do FC às dietas. A perda média total de energia foi de 58,40% da ingerida. Os resultados permitem indicar o feno de catingueira como fonte estratégica de alimento para os animais do semi-árido nordestino, sobretudo no período seco.The objective of this study was to determine the effect of "catingueira" hay (CH addition on nutritional balance by sheep. Fifteen "Morada Nova" males castrated sheep were used in a complete randomized design with three treatments (0, 50 and 100% CH addition and five replications. The inclusion of CH did not influence the apparent nitrogen balance. The energy retained as percentage of the ingested energy was not affected by treatment, however, the energy retained as percentage of the digested energy declined linearly in function of the CH inclusion level. Considering the nutrititonal demands of the experimental animals, it was concluded that the average intake observed at the intermediary levels of CH, showed that the "catingueira" have a reasonable nutritive value, being a strategic forage plant to the herd in the dry season in the semi-arid region.

  14. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  15. Proteção da recuperação funcional do miocárdio pelo omeprazol após isquemia-reperfusão em corações isolados de ratos Myocardium functional recovery protection by omeprazole after ischemia-reperfusion in isolated rat hearts

    Directory of Open Access Journals (Sweden)

    Otoni Moreira Gomes

    2010-09-01

    Full Text Available OBJETIVO: Analisar efeitos do omeprazol na proteção da recuperação funcional de corações isolados de ratos submetidos à lesão de isquemia-reperfusão. MÉTODOS: Foram estudados 12 ratos Wistar, peso corpóreo médio de 280g. Após anestesia com injeção intra-abdominal de 10mg de cetamina e 2mg de xilazina, os corações foram removidos e mantidos em perfusão com solução Krebs-Henseleit (95%O2 e 5% CO2, 37ºC, 110-120mmHg de pressão de perfusão e pressão diastólica de 8 mmHg em sistema Langendorff, modificado, descartável, modelo FCSFA-ServCor (Comex Ltda.. Os seis corações do Grupo I (GI e os seis do Grupo II (GII foram submetidos a 20 minutos de isquemia e 30 minutos de reperfusão. Nos corações do Grupo II, imediatamente antes da isquemia, foram administrados via perfusão coronária 200mcg de omeprazol. Foram controlados frequência cardíaca (FC, fluxo coronário (FCo, pressão sistólica (PS, +dP/dt e -dP/dt, após estabilização (t0 e no final da reperfusão (t30. Empregou-se método não paramétrico de Kruskal-Wallis (P0,05 entre os valores de FCo e FC nos dois grupos. No final do período de reperfusão (t30, foram significantes (POBJECTIVE: To evaluate the myocardium contractility alterations of isolated hearts of rats, submitted to ischemia and reperfusion with and without administration of the omeprazole. METHODS: Twelve Wistar breed rats with 270g mean body weight was studied. After anesthesia by intraperitoneal injection of ketamine 10mg and xylazine 2mg, their hearts were removed and perfused with Krebs-Henseleit solution (95% of O2 and 5% of CO2, 37ºC, 110-120 mmHg perfusion pressure, 8 mmHg ventricular diastolic pressure in the São Francisco de Assis disposable Langendorff system model Comex Ltda, MG. The six hearts of Group I (GI and of the Group II (GII were submitted to 20 min ischemia and 30 min reperfusion. In GII hearts, intracoronary injection of omeprazole 200 mcg was done immediately before the

  16. 40 CFR 97.155 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.155 Section 97.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR NOX allowances may be banked for future use or transfer in a compliance account or a...

  17. Influência do sexo e faixas de peso ao abate nas características físico-químicas da carne de capivara Effect of the factors sex and different slaughter weight in the physico-chemical characteristics of capybara meat (Hydrochaeris hydrochaeris

    Directory of Open Access Journals (Sweden)

    Maria C. Bressan

    2004-09-01

    Full Text Available Este trabalho objetivou avaliar o efeito dos fatores sexo e faixas de peso ao abate (30-40, 40-50, 50-60kg sobre o declínio de pH, pH final, cor, capacidade de retenção de água (CRA, perda de peso por cozimento (PPC e força de cisalhamento (FC da carne de capivara (Hydrochaeris hydrochaeris. As amostras do músculo longissimus dorsi (LD foram obtidas de 28 capivaras (16 machos e 12 fêmeas, provenientes de um zoocriadouro. Não houve influência dos fatores sexo e faixas de peso ao abate sobre o pH as 2h (6,29, 5h (6,29, 8h (6,25 e 24h (6,01 post mortem; na cor (Sistema CIE LAB para luminosidade (34,28, teor de vermelho (10,74 e teor de amarelo (1,74; CRA (0,47, PPC (32,27% e FC (5,20kgf/g. Comparando com espécies domésticas, a carne de capivara apresentou pH final elevado; índice de luminosidade baixo e teor de vermelho elevado, assemelhando-se à carnes de bovinos e ovinos (carnes vermelhas; CRA e PPC dentro dos limites considerados normais; e, textura (FC considerada macia.The aim of this work was to evaluate the effects of the factors sex and different slaughter weight groups (30-40, 40-50, 50-60kg in the pH decline, ultimate pH, colour, water holding capacity (WHC, cooking loss (CL and shear force (SF of capybara (Hydrochaeris hydrochaeris meat. Samples were constituted of longissimus dorsi (LD muscle of 28 capybaras (16 males and 12 females from the same farm. There were no effect of the factors sex and slaughter weight groups on the pH values at 2h (6.29, 5h (6.29, 8h (6.25 and 24h (6.01 post mortem; on colour values (CIE LAB System for brightness (34.28, redness (10.74 and yellowness (1.74; WHC (0.47, CL (32.27% and SF (5.20kgf/g. Comparing to livestock species, capybara meat had a high ultimate pH value, low values of brightness and high values of redness, looking like bovine and ovine meats (red meats; WHC and CL inside limits considered normal; and SF considered soft.

  18. Bloqueio do plexo lombar pela via posterior para analgesia pós-operatória em artroplastia total do quadril: estudo comparativo entre Bupivacaína a 0,5% com Epinefrina e Ropivacaína a 0,5% Bloqueo del plexo lumbar por la vía posterior para analgesia postoperatoria en artroplastia total de la cadera: estudio comparativo entre Bupivacaína a 0,5% con Epinefrina y Ropivacaína a 0,5% Posterior lumbar plexus block in postoperative analgesia for total hip arthroplasty: a comparative study between 0.5% Bupivacaine with Epinephrine and 0.5% Ropivacaine

    Directory of Open Access Journals (Sweden)

    Leonardo Teixeira Domingues Duarte

    2009-06-01

    diferentes bloqueos de nervios periféricos. El objetivo de este estudio, fue comparar la eficacia de la analgesia postoperatoria, resultante de la administración en dosis única de la bupivacaína a 0,5% o de la ropivacaína a 0,5% en el bloqueo del plexo lumbar por la vía posterior en la artroplastia total de la cadera. MÉTODO: Treinta y siete pacientes fueron ubicados aleatoriamente en dos grupos según el anestésico local utilizado en el bloqueo: Grupo B - bupivacaína a 0,5% con epinefrina 1:200.000 o Grupo R - ropivacaína a 0,5%. Durante el período postoperatorio, los puntajes de dolor y el consumo de morfina en la analgesia controlada por el paciente, fueron comparados entre los grupos. El sangramiento durante la operación y la incidencia de efectos adversos y de complicaciones también fueron comparados. RESULTADOS: Pese a que los puntajes de dolor hayan sido menores en el Grupo R 8 horas, 12 horas y 24 horas después del bloqueo, esas diferencias no fueron clínicamente significativas. La regresión lineal múltiple no identificó el anestésico local como una variable independiente. No hubo diferencia en el consumo de morfina, en el sangramiento intraoperatorio y en la incidencia de complicaciones y efectos adversos entre los dos grupos. CONCLUSIONES: La bupivacaína a 0,5% y la ropivacaína a 0,5%, ofrecieron un alivio eficaz y prolongado del dolor postoperatorio después de la artroplastia total de la cadera, sin diferencia clínica, cuando dosis equivalentes fueron administradas en el bloqueo del plexo lumbar por la vía posteriorBACKGROUND AND OBJECTIVES: Posterior lumbar plexus block promotes effective postoperative analgesia in total knee arthroplasty. Ropivacaine and bupivacaine do not show differences in analgesic efficacy when used in different peripheral nerve blocks. The objective of this study was to compare the efficacy of postoperative analgesia resulting from the administration of a single dose of 0.5% bupivacaine or 0.5% ropivacaine in

  19. Low-affinity FcγR interactions can decide the fate of novel human IgG-sensitised red blood cells and platelets

    Science.gov (United States)

    Armour, Kathryn L; Smith, Cheryl S; Turner, Craig P; Kirton, Christopher M; Wilkes, Anthony M; Hadley, Andrew G; Ghevaert, Cedric; Williamson, Lorna M; Clark, Michael R

    2014-01-01

    G1Δnab is a mutant human IgG1 constant region with a lower ability to interact with FcγR than the natural IgG constant regions. Radiolabelled RBCs and platelets sensitised with specific G1Δnab Abs were cleared more slowly from human circulation than IgG1-sensitised counterparts. However, non-destructive splenic retention of G1Δnab-coated RBCs required investigation and plasma radioactivities now suggest this also occurred for platelets sensitised with an IgG1/G1Δnab mixture. In vitro assays with human cells showed that G1Δnab-sensitised RBCs did not cause FcγRI-mediated monocyte activation, FcγRIIIa-mediated antibody-dependent cell-mediated cytotoxicity (ADCC) or macrophage phagocytosis although they did adhere to macrophages. Thus, FcγRII was implicated in the adhesion despite the Δnab mutation reducing the already low-affinity binding to this receptor class. Additional contacts via P-selectin enhance the interaction of sensitised platelets with monocytes and this system provided evidence of FcγRII-dependent activation by G1Δnab. These results emphasise the physiological relevance of low-affinity interactions: It appears that FcγRII interactions of G1Δnab allowed splenic retention of G1Δnab-coated RBCs with inhibitory FcγRIIb binding preventing RBC destruction and that FcγRIIb engagement by G1Δnab on IgG1/G1Δnab-sensitised platelets overcame activation by IgG1. Considering therapeutic blocking Abs, G1Δnab offers lower FcγR binding and a greater bias towards inhibition than IgG2 and IgG4 constant regions. PMID:24285214

  20. 17 CFR 256.01-4 - Construction or service contracts, and centralized procurement accounting.

    Science.gov (United States)

    2010-04-01

    ... contracts, and centralized procurement accounting. 256.01-4 Section 256.01-4 Commodity and Securities... § 256.01-4 Construction or service contracts, and centralized procurement accounting. (a) Specific accounts have not been provided in which to classify expenditures made in the performance of construction...